(data stored in ACNUC8465 zone)

EMBL: AB104460

ID   AB104460; SV 1; linear; mRNA; STD; PLN; 1112 BP.
XX
AC   AB104460;
XX
DT   02-MAY-2003 (Rel. 75, Created)
DT   02-MAY-2003 (Rel. 75, Last updated, Version 1)
XX
DE   Arabidopsis thaliana ANQ1/AtMKK6 mRNA for MAP kinase kinase, complete cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1112
RA   Soyano T., Machida Y.;
RT   ;
RL   Submitted (21-FEB-2003) to the INSDC.
RL   Yasunori Machida, Nagoya university, Division of Biological Science,
RL   Graduate School of Science; Furo-cho, Chikusa-ku, Aichi 464-8602, Japan
RL   (E-mail:yas@bio.nagoya-u.ac.jp, Tel:81-52-789-2502, Fax:81-52-789-2966)
XX
RN   [2]
RX   DOI; 10.1101/gad.1071103.
RX   PUBMED; 12704083.
RA   Soyano T., Nishihama R., Morikiyo K., Ishikawa M., Machida Y.;
RT   "NQK1/NtMEK1 is a MAPKK that acts in the NPK1 MAPKKK-mediated MAPK cascade
RT   and is required for plant cytokinesis";
RL   Genes Dev. 17(8):1055-1067(2003).
XX
DR   MD5; ee1ad2e74cb50f94344cc09c0ffc3bed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1112
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /cultivar="Col-0"
FT                   /mol_type="mRNA"
FT                   /dev_stage="seedling"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        42..1112
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="ANQ1/AtMKK6"
FT                   /product="MAP kinase kinase"
FT                   /note="Arabidopsis homolog of NQK1"
FT                   /db_xref="GOA:Q9FJV0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJV0"
FT                   /protein_id="BAC76067.1"
FT                   /translation="MVKIKSNLKQLKLSVPAQESPISSFLTASGTFHDGDFLLNQKGLR
FT                   LTSDEKQSRQSDSKELDFEITAEDLETVKVIGKGSGGVVQLVRHKWVGKFFAMKVIQMN
FT                   IQEEIRKQIVQELKINQASSQCPHVVVCYHSFYHNGAFSLVLEYMDRGSLADVIRQVKT
FT                   ILEPYLAVVCKQVLLGLVYLHNERHVIHRDIKPSNLLVNHKGEVKISDFGVSASLASSM
FT                   GQRDTFVGTYNYMSPERISGSTYDYSSDIWSLGMSVLECAIGRFPYLESEDQQNPPSFY
FT                   ELLAAIVENPPPTAPSDQFSPEFCSFVSACIQKDPPARASSLDLLSHPFIKKFEDKDID
FT                   LGILVGTLEPPVNYLR"
XX
SQ   Sequence 1112 BP; 350 A; 223 C; 236 G; 303 T; 0 other;
     aaagagagcg ataatcccaa ggaagaaacc aaagaaaaaa aatggtgaag atcaaatcga        60
     acttgaagca gcttaagctc tccgttccag ctcaagaatc cccaatctct tccttcctga       120
     ctgcgagtgg aacatttcac gatggagatt ttcttctgaa tcaaaagggg ctaaggttga       180
     cgtcagatga gaagcaatca aggcaatctg atagcaagga gcttgatttc gaaattactg       240
     ctgaagactt agagactgtc aaagtcatcg gaaaaggcag tggtggtgtt gttcaattag       300
     ttcgtcataa atgggttggc aaattctttg ctatgaaggt catacagatg aatatacaag       360
     aagaaatccg taagcaaatt gttcaggagc ttaaaataaa ccaagcatca tcacaatgtc       420
     cacatgtagt agtttgctac cattctttct atcacaatgg agccttttcg cttgtgcttg       480
     aatacatgga ccgtggatct cttgcggatg tgattagaca agtcaagact attcttgaac       540
     cttaccttgc tgttgtctgt aaacaggttt tgctaggtct tgtgtaccta cacaacgaaa       600
     gacatgtcat acacagagac attaagccat caaaccttct tgtaaaccat aaaggggaag       660
     tgaaaatctc agattttggt gtaagtgcaa gtcttgctag ctccatggga cagagggaca       720
     catttgttgg aacctacaac tatatgtcgc ctgagaggat tagtggaagc acatatgact       780
     acagcagtga catttggagt ttggggatgt cagtgttaga atgtgcaata ggaagatttc       840
     cttatttaga atctgaagat cagcaaaacc cgccaagctt ttatgaactc ttggcagcaa       900
     tagtagagaa tccaccacca actgctcctt ctgatcaatt ctcacctgaa ttctgctcct       960
     ttgtatcagc ctgcatacaa aaagatcctc cagcaagagc atcatctttg gacctcttga      1020
     gtcatccatt cataaaaaag tttgaggaca aggatatcga tctcgggata cttgttggca      1080
     ctctggaacc acctgttaac taccttagat aa                                    1112
//

If you have problems or comments...

PBIL Back to PBIL home page