(data stored in ACNUC21562 zone)

EMBL: AB154410

ID   AB154410; SV 1; linear; mRNA; STD; HUM; 966 BP.
XX
AC   AB154410;
XX
DT   27-MAY-2004 (Rel. 80, Created)
DT   27-MAY-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Homo sapiens mRNA for G protein-coupled receptor TGR7, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-966
RA   Watanabe T., Moriya T., Komatsu H., Ogi K., Fukusumi S., Itoh Y.,
RA   Hinuma S.;
RT   ;
RL   Submitted (16-DEC-2003) to the INSDC.
RL   Yasuaki Itoh, Takeda Chemical Industries Ltd., Discovery Research
RL   Laboratories; Wadai 10, Tsukuba, Ibaraki 300-4293, Japan
RL   (E-mail:Ito_Yasuaki@takeda.co.jp, Tel:81-29-864-5034, Fax:81-29-864-5000)
XX
RN   [2]
RX   DOI; 10.1074/jbc.M314240200.
RX   PUBMED; 15037633.
RA   Shinohara T., Harada M., Ogi K., Maruyama M., Fujii R., Tanaka H.,
RA   Fukusumi S., Komatsu H., Hosoya M., Noguchi Y., Watanabe T., Moriya T.,
RA   Itoh Y., Hinuma S.;
RT   "Identification of a G protein-coupled receptor specifically responsive to
RT   beta-alanine";
RL   J Biol Chem 279(22):23559-23564(2004).
XX
DR   MD5; 55ea5383ac0c58a0d3109825ebbf3d88.
DR   Ensembl-Gn; ENSG00000172938; homo_sapiens.
DR   Ensembl-Tr; ENST00000309106; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..966
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..966
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="G protein-coupled receptor TGR7"
FT                   /db_xref="GOA:Q8TDS7"
FT                   /db_xref="H-InvDB:HIT000242440.11"
FT                   /db_xref="HGNC:HGNC:29626"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026232"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TDS7"
FT                   /protein_id="BAD20638.1"
FT                   /translation="MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGN
FT                   SMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRL
FT                   MYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSF
FT                   CSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVV
FT                   VLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGS
FT                   RRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA"
XX
SQ   Sequence 966 BP; 167 A; 303 C; 275 G; 221 T; 0 other;
     atgaaccaga ctttgaatag cagtgggacc gtggagtcag ccctaaacta ttccagaggg        60
     agcacagtgc acacggccta cctggtgctg agctccctgg ccatgttcac ctgcctgtgc       120
     gggatggcag gcaacagcat ggtgatctgg ctgctgggct ttcgaatgca caggaacccc       180
     ttctgcatct atatcctcaa cctggcggca gccgacctcc tcttcctctt cagcatggct       240
     tccacgctca gcctggaaac ccagcccctg gtcaatacca ctgacaaggt ccacgagctg       300
     atgaagagac tgatgtactt tgcctacaca gtgggcctga gcctgctgac ggccatcagc       360
     acccagcgct gtctctctgt cctcttccct atctggttca agtgtcaccg gcccaggcac       420
     ctgtcagcct gggtgtgtgg cctgctgtgg acgctctgtc tcctgatgaa cgggttgacc       480
     tcttccttct gcagcaagtt cttgaaattc aatgaagatc ggtgcttcag ggtggacatg       540
     gtccaggccg ccctcatcat gggggtctta accccagtga tgactctgtc cagcctgacc       600
     ctctttgtct gggtgcggag gagctcccag cagtggcggc ggcagcccac acggctgttc       660
     gtggtggtcc tggcctctgt cctggtgttc ctcatctgtt ccctgcctct gagcatctac       720
     tggtttgtgc tctactggtt gagcctgccg cccgagatgc aggtcctgtg cttcagcttg       780
     tcacgcctct cctcgtccgt aagcagcagc gccaaccccg tcatctactt cctggtgggc       840
     agccggagga gccacaggct gcccaccagg tccctgggga ctgtgctcca acaggcgctt       900
     cgcgaggagc ccgagctgga aggtggggag acgcccaccg tgggcaccaa tgagatgggg       960
     gcttga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page