(data stored in ACNUC10243 zone)

EMBL: AB201711

ID   AB201711; SV 1; linear; mRNA; STD; MUS; 1636 BP.
XX
AC   AB201711;
XX
DT   09-FEB-2005 (Rel. 82, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus hnRNPA3 mRNA for heterogeneous nuclear ribonucleoprotein A3,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1636
RA   Tsuchiya N., Tanaka E., Nakagama H.;
RT   ;
RL   Submitted (07-FEB-2005) to the INSDC.
RL   Naoto Tsuchiya, National Cancer Center Research Institute, Biochemistry
RL   Division; 5-1-1, Chuo-ku Tsukiji, Tokyo 104-0045, Japan
RL   (E-mail:ntsuchiy@gan2.res.ncc.go.jp, Tel:81-3-3542-2511(ex.4552),
RL   Fax:81-3-3542-2530)
XX
RN   [2]
RX   DOI; 10.1016/j.bbrc.2007.04.177.
RX   PUBMED; 17502110.
RA   Tanaka E., Fukuda H., Nakashima K., Tsuchiya N., Seimiya H., Nakagama H.;
RT   "HnRNP A3 binds to and protects mammalian telomeric repeats in vitro";
RL   Biochem. Biophys. Res. Commun. 358(2):608-614(2007).
XX
DR   MD5; 6faeed45d99c20b33af033d130811d7f.
DR   Ensembl-Gn; ENSMUSG00000059005; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AKRJ_G0025802; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025828; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0025569; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025788; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025120; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000090792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111964; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AKRJ_T0055393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0055851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0055053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054373; mus_musculus_wsbeij.
DR   EuropePMC; PMC2945768; 20885981.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1636
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda Zap II"
FT                   /cell_line="NIH3T3"
FT                   /cell_type="mouse fibroblast"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        40..1179
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="hnRNPA3"
FT                   /product="heterogeneous nuclear ribonucleoprotein A3"
FT                   /db_xref="GOA:Q5FB19"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FB19"
FT                   /protein_id="BAD89508.1"
FT                   /translation="MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFE
FT                   TTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRV
FT                   VEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQS
FT                   GKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGN
FT                   FMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGP
FT                   GYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQ
FT                   QSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
XX
SQ   Sequence 1636 BP; 468 A; 237 C; 492 G; 439 T; 0 other;
     tattgaactc gagttggaag aggcgagtcc ggtctcaaaa tggaggtaaa accgccgccc        60
     ggtcgccccc agcctgactc cggccgtcgc cgccgccgcc ggggggagga gggccatgat       120
     ccaaaggaac cagagcagct gaggaagcta tttattggtg gtctgagctt tgaaaccaca       180
     gatgatagct taagagaaca ttttgagaaa tggggcacac ttacagactg tgtggtaatg       240
     agagatcccc aaacaaaacg ttccagaggc tttggttttg tgacctactc ttgtgttgaa       300
     gaggtggatg ctgcaatgtg tgctcggcca cacaaggttg atgggcgtgt ggtggaaccg       360
     aagagagctg tttctagaga ggattctgta aagcctggtg cccatttaac ggtgaagaaa       420
     atttttgttg gtggtattaa agaggatacg gaagaatata acctgagaga ctactttgaa       480
     aagtatggca agattgaaac catagaggtt atggaagaca ggcagagtgg gaaaaagaga       540
     ggatttgctt ttgtaacttt tgatgatcat gacacagttg ataaaattgt tgttcagaaa       600
     taccacacta ttaatgggca taattgtgaa gtgaaaaagg ccctttctaa acaagagatg       660
     cagtctgctg gatcacagag aggtcgtgga ggtggatctg gcaactttat gggtcgtgga       720
     ggaaactttg gaggtggtgg aggaaacttt ggtcgtggag gaaactttgg tggaagaggt       780
     ggatatggtg gtggaggtgg tggcagcaga ggtagttatg gaggtggtga tggtggatat       840
     aatggatttg gaggtgatgg tggcaactat ggtggtggtc ctggttacag cagtagagga       900
     ggttatggag gtggtggacc aggatatgga aaccagggtg gtggatatgg tggtggagga       960
     ggaggctatg atggttacaa tgaaggagga aattttggtg gaggtaacta tggtggtggt      1020
     ggaaactata atgactttgg aaattatagt ggacagcaac aatcaaatta tggacccatg      1080
     aaggggggca gttttggtgg aagaagctca ggcagtccct atggtggtgg ctatggatct      1140
     ggaggtggaa gtggtggata tggtagcaga aggttttaaa ataaaacaga aacggctaca      1200
     gttcttagca ggagagagag cgaggagttg tcaggaaagc tgcaggttac tttgagacag      1260
     tcgtcccaaa tgcattagag gaactgtaaa aatctgccac agaaggaacg atgatccata      1320
     gtcagaaaag ttactgcagc ttaaacagga aacccttctt gttcaggact gtcatagcca      1380
     cagtttgcaa aaagtgcagc tattgattaa tgcaatgtag tgtcaattag atgtacattc      1440
     ctgaggtctt ttatctgttg tagctttgtc tttttctttt tcttttcatt acatcaggta      1500
     tattgccctg taaattgtgg tagtggtacc aggaataaaa aattaaggaa tttttaactt      1560
     ttcaatattt gtgtagttca gtttttctac attttagtac agaaacttta acaaaatgca      1620
     gtttcgaagg tgtttc                                                      1636
//

If you have problems or comments...

PBIL Back to PBIL home page