(data stored in ACNUC21429 zone)

EMBL: AB209468

ID   AB209468; SV 1; linear; mRNA; STD; HUM; 6054 BP.
XX
AC   AB209468;
XX
DT   31-MAR-2005 (Rel. 83, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for ubiquilin 1 isoform 1 variant protein.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-6054
RA   Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.,
RA   Ohara O., Nagase T., Kikuno R.F.;
RT   ;
RL   Submitted (22-MAR-2005) to the INSDC.
RL   Osamu Ohara, Kazusa DNA Research Institute, Department of Human Gene
RL   Research; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:cdnainfo@kazusa.or.jp, URL:http://protein.gsc.riken.go.jp/,
RL   Tel:81-438-52-3930, Fax:81-438-52-3931)
XX
RN   [2]
RA   Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.,
RA   Ohara O., Nagase T., Kikuno R.F.;
RT   "Homo sapiens protein coding cDNA";
RL   Unpublished.
XX
DR   MD5; e19a11b80217720f8cbebfbc134904fa.
XX
CC   This work was supported in part by the National Project on Protein
CC   Structural and Functional Analysis , Ministry of Education,
CC   Culture , Sports, Science and Technology of Japan.
CC   Totoki Y, Toyoda A, Takeda T, Sakaki Y, Tanaka A, Yokoyama S.
CC   RIKEN Genomic Sciences Center, 1-7-22 Suehiro-cho, Tsurumi,
CC   Yokohama 230-0045, Japan.
CC   URL: http://protein.gsc.riken.go.jp/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6054
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="ah04629"
FT                   /tissue_type="brain"
FT                   /note="this clone is also named as hsk003001496"
FT                   /note="vector:pBluescriptII SK plus"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..978
FT                   /codon_start=1
FT                   /product="ubiquilin 1 isoform 1 variant"
FT                   /note="Start codon is not identified."
FT                   /db_xref="H-InvDB:HIT000329403.11"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR028799"
FT                   /db_xref="UniProtKB/TrEMBL:Q59FJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD92705.1"
FT                   /translation="GIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTS
FT                   GSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSM
FT                   LSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDR
FT                   ALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTEN
FT                   RDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTP
FT                   GMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQVSL"
XX
SQ   Sequence 6054 BP; 1806 A; 1063 C; 1171 G; 2014 T; 0 other;
     ggaattcatg atggacttac tgttcacctt gtcattaaaa cacaaaacag gcctcaggat        60
     cattcagctc agcaaacaaa tacagctgga agcaatgtta ctacatcatc aactcctaat       120
     agtaactcta catctggttc tgctactagc aacccttttg gtttaggtgg ccttggggga       180
     cttgcaggtc tgagtagctt gggtttgaat actaccaact tctctgaact acagagtcag       240
     atgcagcgac aacttttgtc taaccctgaa atgatggtcc agatcatgga aaatcccttt       300
     gttcagagca tgctctcaaa tcctgacctg atgagacagt taattatggc caatccacaa       360
     atgcagcagt tgatacagag aaatccagaa attagtcata tgttgaataa tccagatata       420
     atgagacaaa cgttggaact tgccaggaat ccagcaatga tgcaggagat gatgaggaac       480
     caggaccgag ctttgagcaa cctagaaagc atcccagggg gatataatgc tttaaggcgc       540
     atgtacacag atattcagga accaatgctg agtgctgcac aagagcagtt tggtggtaat       600
     ccatttgctt ccttggtgag caatacatcc tctggtgaag gtagtcaacc ttcccgtaca       660
     gaaaatagag atccactacc caatccatgg gctccacaga cttcccagag ttcatcagct       720
     tccagcggca ctgccagcac tgtgggtggc actactggta gtactgccag tggcacttct       780
     gggcagagta ctactgcgcc aaatttggtg cctggagtag gagctagtat gttcaacaca       840
     ccaggaatgc agagcttgtt gcaacaaata actgaaaacc cacaactgat gcaaaacatg       900
     ttgtctgccc cctacatgag aagcatgatg cagtcactaa gccagaatcc tgaccttgct       960
     gcacaggtga gtttgtaatt gtattgaaaa agactgtgca gtgtgaatta aaataaccta      1020
     atcttgtaat tgtgattttg gcacatttgt gttgtgtatg atatcttaat acactagaaa      1080
     aataagtaaa ctgtgtctcc aattttttag accgtgtgtt tctttgcagt aaattaatac      1140
     ttcatatgta attaaaacaa ctttatctct gccattcatt gactagaaag aagtgcaggt      1200
     ttagtttgtt tctacatatg ttgagttagg agacaagtac agagttctgg aatgcccact      1260
     cttttgaaga taaactactt aatgaaatgt aaatcttgaa agcaattaag agcaatgtta      1320
     atacatttga aatactttta tttagtagat cactcagatt ataatagtca tgctcagaat      1380
     ggcagttgta aaatagcatt tattaaagac gggaatttgt cagaacaatg ttctccttct      1440
     ttcaactatt gattcccctg ctgaaaatcg tatacaggtc ccttattaat gtattccttt      1500
     ttctaatttg tttctaaaga gaccacagct aagaaaattg gggatcttaa tgctggctga      1560
     acactcagga tcacttggga agctttatag acagtaccga tggttggggc ctcatcctta      1620
     gagattttga gataattgcg tccgataacc ctttctccct caagttgcct aggtactatc      1680
     taggttccat accacagggc ttgaaaaacc acggagaatg tgaaataaac cttgataatc      1740
     tgtagtttat atttgctgtt cgttaaaaat ggcttctgta gtgtgtcagg aatttggaag      1800
     actttatagt taatctcatc ccttaaattt taaaagcttt aagtcaaatg aatggttttt      1860
     attttctaaa ttctaaaact atattgattc aggtatcttt gtgtataatt ctcagtaata      1920
     acttatgccc tcaccaaatt tgtggaattg gaaataacaa attttaagaa gaatttttgt      1980
     gtctgtgatt ctgtatattg gaggtacatt ttatggaaga ttgatttatg catatgaaac      2040
     ttatcagact gagttgttag tattaaatgc ttcaatttac cataataagc cattttaagt      2100
     gtgtatttgg ctaatactga atgtgcatct tgcttttaaa atttgacttt aacaagcaca      2160
     tgcgtagcaa ttttgtaata atcttacttt agtaaagtga cttgagcact cacatactat      2220
     ttttttactc taaaacaaaa tgttgctagt actagattgg catgtctttt attacagata      2280
     atttagaaac ttttacaatg ttcttgttat ctgcagatta aaatttgtgg tttttctatt      2340
     cttttgattt ttaaatattt aaaaagactc ttgagtgtaa aaacttgtgg tataagcact      2400
     caggtaagtt ataagaagta tctaataaga tgattatctg tgaaaggata cgtttaagat      2460
     gacatgcttt tttaagatga aatgaagtga attccaaaag atatgtgtga taacctcgtt      2520
     aatatgttga tgataagtat ttggaaccaa taaagaagca ggtttgttga ccttaagcct      2580
     gtatgagttt acttactgtg aacttactgg tcactttgaa ataaatactg tatgttcctg      2640
     aaaggttgtc tgacatctgc ttttgttatt gtattgaaat taactaaaag atcactttgc      2700
     aagaattggg gcgaattttc tctaccagca tttacattgc tcttaaatac ggttaacttc      2760
     ttgagggcaa ggatcatttc ctccccagac tttggataga taaataggct atcagtaaat      2820
     ccttgttagt tgacttttta ctccgcctgg ggaaaatgat ataaaatgtg tcttttgagc      2880
     tacaagaatt tattagctct ggttatgctc cttgtgtatt ttaatcttat tttcaggtat      2940
     atgacatcat actaataatg atcctgattt ttaaattctt aacgtttatt tgaagtttag      3000
     gagatgccac ttttctcatc tctggtagta gtgaggtgaa atccagatgc taatcttggt      3060
     gttctcaaac ggatttacat cttttaggtc ttaaatcatt ttaatacttt tcccagagga      3120
     ctgttggtgc taggcctgac tgattttcac ctagcagctc catttctctg gcaagttggt      3180
     tgctgttttg cggtgttatt tttttggacc taatattagc tgttttgtag taggcaggta      3240
     gatgtagtgg tccttttcag atctagattt tctctgtgcc tgccacttgt gtgttgaggt      3300
     ttctaagcaa gccatgttac atagttcatg tattgatgtt tatgtttatt ctgccagtgt      3360
     agtagaaaat atatcttcat gaatgccagt tactcccatt tttctttcaa tggcatatat      3420
     tcacgtttgt tcaaggaaaa gcctaagaaa atgattgctt ttatttttta ggatattgca      3480
     tgtcattatc ataaccacca ttctcattga gagagaatat gcctcatttt tttgtttttg      3540
     ttcttctgga gatccctctt gtggacagta tcttcccttt tccttttttt atttatgttc      3600
     taccttcctc ccttttaagt gccagctgag gcacttgggg gaagatagaa taaaacaagg      3660
     tacattactt gtttcagata tttccagtta aaattgtttg aacacttgcc ccatagatga      3720
     tgctgaataa tcccctattt gctggaaatc ctcagcttca agaacaaatg agacaacagc      3780
     tcccaacttt cctccaacaa atgcagaatc ctgatacact atcagcaatg tcaaacccta      3840
     gagcaatgca ggccttgtta cagattcagc agggtttaca gacattagca acggaagccc      3900
     cgggcctcat cccagggttt actcctggct tgggggcatt aggaagcact ggaggctctt      3960
     cgggaactaa tggatctaac gccacaccta gtgaaaacac aagtcccaca gcaggaacca      4020
     ctgaacctgg acatcagcag tttattcagc agatgctgca ggctcttgct ggagtaaatc      4080
     ctcagctaca gaatccagaa gtcagatttc agcaacaact ggaacaactc agtgcaatgg      4140
     gatttttgaa ccgtgaagca aacttgcaag ctctaatagc aacaggaggt gatatcaatg      4200
     cagctattga aaggttactg ggctcccagc catcatagca gcatttctgt atcttgaaaa      4260
     aatgtaattt atttttgata acggctctta aactttaaaa tacctgcttt atttcatttt      4320
     gactcttgga attctgtgct gttataaaca aacccaatat gatgcatttt aaggtggagt      4380
     acagtaagat gtgtgggttt ttctgtattt ttcttttctg gaacagtggg aattaaggct      4440
     actgcatgca tcacttctgc atttattgta attttttaaa aacatcacct tttatagttg      4500
     ggtgaccaga ttttgtcctg catctgtcca gtttatttgc tttttaaaca ttagcctatg      4560
     gtagtaattt atgtagaata aaagcattaa aaagaagcaa atcatttgca ctctataatt      4620
     tgtggtacag tattgcttat tgtgactttg gcatgcattt ttgcaaacaa tgctgtaaga      4680
     tttatactac tgataatttt gttttatttg tatacaatat agagtatgca catttgggac      4740
     tgcatttctg gaaacatact gcaataggct ctctgagcaa aacacctgta actaaaaaag      4800
     tgaagataag aaaatactct taaagctgag tatttcctaa ttgtatagaa tcttacagca      4860
     tctttgacaa acatctccca gcaaaagtgc cggttagtca ggtttgttga aaatacagta      4920
     gaaaagctga ttctggttat ctctttaagg acaattaatt gtacagacac ataatgtaac      4980
     attgtctcaa cattcattca cagattgact gtaaattacc ttaatctttg tgcagactga      5040
     aggaacactg tagtataccc caaagtgcat ttgcctagga cttctcagct tctcccatag      5100
     gtagtttaac aggcattaaa atttgtaatt gaaatgttgc tttcactgaa aaagtgtctt      5160
     gatgtttcag ttatttttaa tcgccataaa aaaatagaac tatcttttgg gtttatctgt      5220
     tttctcatgc acaggcaata cacaaattta aaatgagttg tgagccaatt gtttctgaag      5280
     tgttttggta gttctattaa gaaatagtta aatattgtgc ttttcagagc ctcagagaaa      5340
     gggggacggg gtgggggggt ggggcagcgg aatctgtcct ggatggggcc agcttaaata      5400
     atactggcaa ccaagattct gttaggattt ctgtgcatat agtgtagtaa agaagtatca      5460
     ttcaggggtg aaaaacaaag agccgtttta atgatgttga gtacatttgg ctgttttata      5520
     gcctttttct tccctccccc aaagaattct gtttgcctaa ctcccaaact gttggggtgg      5580
     tacattcctt taggaccaat taaaacataa ttgagggtca gtgatacatt tggctgactc      5640
     tggttcagta ttctcttagg tgattatatt ctctcatgta cagttacagg aaattaaaat      5700
     gttaaagtaa cctaaaatga attcagacca ataaaatcaa gggaaataca agttgattgc      5760
     attacttctg tatgttgctt gctattaaaa aggttaagag gccaggttac ccaccagtcc      5820
     ttgcactgtt ctgacacttt ccccaggagg aaaacaagta caaaggttac ggtggaggca      5880
     taagtagaag agattgttaa gaagggtatt catgtgtctt tgctctttct gctttatgcc      5940
     tcagtttggt ttaaaaactt ctgtactggc aaatggtggt attcagtgtg ggatagtgtc      6000
     ataactaatt tgacaattta ttaatcataa aataacaata aatctctagc tttt            6054
//

If you have problems or comments...

PBIL Back to PBIL home page