(data stored in ACNUC15260 zone)

EMBL: AB263468

ID   AB263468; SV 1; linear; genomic DNA; STD; MAM; 645 BP.
XX
AC   AB263468;
XX
DT   18-JUN-2008 (Rel. 96, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Monodelphis domestica opor1 gene for olfactory receptor, partial cds.
XX
KW   .
XX
OS   Monodelphis domestica (gray short-tailed opossum)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
XX
RN   [1]
RP   1-645
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   ;
RL   Submitted (21-JUN-2006) to the INSDC.
RL   Contact:Takushi Kishida Kyoto University, Department of Zoology; 459,
RL   Shirahama, Wakayama 649-2211, Japan
XX
RN   [2]
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   "The opossum olfactory receptor genes";
RL   Unpublished.
XX
DR   MD5; e4c1f3a57e597cc642abcf97a15ddfeb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..645
FT                   /organism="Monodelphis domestica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:13616"
FT   CDS_pept        <1..>645
FT                   /codon_start=1
FT                   /gene="opor1"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:B3ITC6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:B3ITC6"
FT                   /protein_id="BAG48909.1"
FT                   /translation="VDLCVASTTVPKMLMNILTQSKVITYADCLAQMYFFLVFAGLDNF
FT                   LLMAMAYDRFVAICHPLHYTVIMSPRLCVLLLLLSWIFSLLNSLLHSLMVTQLSFCTDH
FT                   TIQHFFCDLPQVLKLSCSDSLVNNVLAYMLAGLIGIVSITGIFFSYSQICSSILKVPSA
FT                   GGKYKAFSTCGSHLSVVSLFYGTGLGVYFSSSVIHSSWKSTVASAMYAVVTP"
XX
SQ   Sequence 645 BP; 129 A; 162 C; 121 G; 233 T; 0 other;
     gtggatctct gtgtggcctc taccacagtt cccaagatgc tgatgaatat cttaacacaa        60
     agcaaagtca tcacctatgc tgattgtctt gcccagatgt acttcttctt ggtttttgct       120
     ggtttggaca atttcctcct catggcaatg gcctatgacc gttttgtggc tatctgtcac       180
     cctctacatt acacagtcat catgagccct aggctttgtg tcctcttgct gctgctctcc       240
     tggatcttca gccttctaaa ttccctcctt cacagtctga tggtaacaca gctctccttt       300
     tgtacagacc acacaattca acatttcttt tgtgatcttc cccaggttct gaaactgtct       360
     tgttctgaca gccttgtcaa taatgtcttg gcatatatgt tagccggatt gattggtatt       420
     gtctccatca cagggatatt tttctcttat agtcagatct gttcttccat tttgaaagtc       480
     ccatctgctg ggggtaagta taaagccttt tctacttgtg gatctcacct ttctgttgtt       540
     tccttattct atgggacagg gcttggagtc tatttcagct cttcagttat ccattcttcc       600
     tggaagagca cagttgcctc agcaatgtat gctgttgtta ccccc                       645
//

If you have problems or comments...

PBIL Back to PBIL home page