(data stored in ACNUC7820 zone)

EMBL: AB263471

ID   AB263471; SV 1; linear; genomic DNA; STD; MAM; 649 BP.
XX
AC   AB263471;
XX
DT   18-JUN-2008 (Rel. 96, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Monodelphis domestica opor4 gene for olfactory receptor, partial cds.
XX
KW   .
XX
OS   Monodelphis domestica (gray short-tailed opossum)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
XX
RN   [1]
RP   1-649
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   ;
RL   Submitted (21-JUN-2006) to the INSDC.
RL   Contact:Takushi Kishida Kyoto University, Department of Zoology; 459,
RL   Shirahama, Wakayama 649-2211, Japan
XX
RN   [2]
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   "The opossum olfactory receptor genes";
RL   Unpublished.
XX
DR   MD5; e8a8ffe1df37ea838163e322efd818fa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Monodelphis domestica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:13616"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /gene="opor4"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:B3ITC8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:B3ITC8"
FT                   /protein_id="BAG48911.1"
FT                   /translation="FVDLCVVSTTVPKMLVGILTQNKAISYAGCLAQMYFFIVFVGLDN
FT                   FLLTAMAYDRFVAICHPLRYTSIMSPELCCLMVLLSWILSLLNTLLHSLMVTRLSFCTG
FT                   HEIQHFFCDLDQVLKLSCSDTLINYVLLYILAGLLGILPLTGILFSYSQIFSSILKVPS
FT                   AGGKYKAFSTCGSHLSVVSLFYGTAMGVYFSSSVTQSSWKSTVASAMYAVVTP"
XX
SQ   Sequence 649 BP; 129 A; 166 C; 127 G; 227 T; 0 other;
     ctttgtagat ctttgtgtgg tatctaccac ggtacccaag atgttagtgg gcatcttgac        60
     acaaaacaag gccatctcct atgctggctg ccttgcccag atgtacttct ttatagtttt       120
     tgttggtttg gacaatttcc ttctcactgc aatggcctat gaccgttttg tggctatctg       180
     tcaccctctg cgctatacat ccatcatgag tcctgagttg tgctgcctga tggtgctgct       240
     ctcctggata ctaagtcttc tcaacaccct ccttcacagt ctgatggtga caaggctctc       300
     cttctgtaca ggccatgaaa tccagcactt cttttgtgat cttgatcaag ttctaaaact       360
     ctcatgttct gacactctta tcaattatgt cttgctatat attttagctg gtctgcttgg       420
     tattctcccc ctcacaggga ttctcttctc atatagtcag atcttttctt ccattttgaa       480
     agtcccatct gctgggggta agtacaaagc attttctacc tgtggatctc atctctctgt       540
     tgtttcctta ttctatggca cagcgatggg agtgtatttc agctcctcag tgacccagtc       600
     ttcctggaag agtacagttg cctcagcaat gtatgctgtg gtcaccccc                   649
//

If you have problems or comments...

PBIL Back to PBIL home page