(data stored in ACNUC7820 zone)

EMBL: AB263473

ID   AB263473; SV 1; linear; genomic DNA; STD; MAM; 649 BP.
XX
AC   AB263473;
XX
DT   18-JUN-2008 (Rel. 96, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Monodelphis domestica opor6 gene for olfactory receptor, partial cds.
XX
KW   .
XX
OS   Monodelphis domestica (gray short-tailed opossum)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
XX
RN   [1]
RP   1-649
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   ;
RL   Submitted (21-JUN-2006) to the INSDC.
RL   Contact:Takushi Kishida Kyoto University, Department of Zoology; 459,
RL   Shirahama, Wakayama 649-2211, Japan
XX
RN   [2]
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   "The opossum olfactory receptor genes";
RL   Unpublished.
XX
DR   MD5; 3ba5a48b9b32fc84b15597caf74ac4e4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Monodelphis domestica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:13616"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /gene="opor6"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:B3ITD0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:B3ITD0"
FT                   /protein_id="BAG48913.1"
FT                   /translation="FVDLCVVSSTVPKMLVSILTQNKAISYAGCLAQMSLFMFFGCLDN
FT                   FLLTAMAYDRFVAICHPLRYTSIMSPELCCLMVLLSWILSLLNTLLHSLMVTRLSFCTG
FT                   HEIQHFFCDLEKVLKLSCSDTLINYVLLYVIAGLLGVLPLTGILFSYSQIFSSILKVPS
FT                   ARGKYKAFSTCGSHLSVVSLFYGTGLGVCLSSSVTQSSWKSTVASAMYAVVTP"
XX
SQ   Sequence 649 BP; 131 A; 166 C; 130 G; 222 T; 0 other;
     ctttgtagat ctctgtgtgg tatctagcac ggtacccaag atgttagtaa gtatcttgac        60
     acaaaacaag gccatctcct atgctggctg tcttgcccag atgtccctat ttatgttttt       120
     tggttgttta gacaattttc ttctcactgc aatggcctat gaccgttttg tggctatctg       180
     tcaccctctg cgctatacat ccatcatgag tcctgagctg tgctgcctga tggtgctgct       240
     ctcctggata ctaagtcttc tcaacaccct ccttcacagt ctgatggtga caaggctctc       300
     cttctgtaca ggccatgaaa tccagcactt cttttgtgat cttgaaaaag ttctaaaact       360
     ctcatgttct gacaccctta tcaattatgt cttgctatat gttatagctg gtctgcttgg       420
     tgttctcccc ctcacaggga ttctcttctc atacagtcag atcttttctt ccattttgaa       480
     agtcccatct gctaggggta agtacaaagc cttttcgacc tgtggatctc atctctcagt       540
     tgtttcctta ttctatggca cagggctggg agtgtgtttg agctcctcag tgacccagtc       600
     ttcctggaag agtacagttg cctcagcaat gtatgctgtg gtcaccccc                   649
//

If you have problems or comments...

PBIL Back to PBIL home page