(data stored in ACNUC7820 zone)

EMBL: AB263474

ID   AB263474; SV 1; linear; genomic DNA; STD; MAM; 644 BP.
XX
AC   AB263474;
XX
DT   18-JUN-2008 (Rel. 96, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Monodelphis domestica opor7 gene for olfactory receptor, partial cds.
XX
KW   .
XX
OS   Monodelphis domestica (gray short-tailed opossum)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
XX
RN   [1]
RP   1-644
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   ;
RL   Submitted (21-JUN-2006) to the INSDC.
RL   Contact:Takushi Kishida Kyoto University, Department of Zoology; 459,
RL   Shirahama, Wakayama 649-2211, Japan
XX
RN   [2]
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   "The opossum olfactory receptor genes";
RL   Unpublished.
XX
DR   MD5; edb7f0f7548ab952413ed1f51e90ba87.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..644
FT                   /organism="Monodelphis domestica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:13616"
FT   CDS_pept        <1..>644
FT                   /codon_start=3
FT                   /gene="opor7"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:B3ITD1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:B3ITD1"
FT                   /protein_id="BAG48914.1"
FT                   /translation="DLCVVSSTVPKMLVSILTQNKAISYAGCLAQMSLFMFFGCLDNFL
FT                   LTAMAYDRFVAICHPLRYTSIMSPELCCLMVLLSWILSLLNTLLHSLMVTRLSFCTGHE
FT                   IQHFFCDLEKVLKLSCSDTLINYVLLYVIAGLLGVLPLTGILFSYSQIFSSILKVPSAR
FT                   GKYKAFSTCGSHLSVVSLFYGTGLGVCLSSSVTQSSWKSTVASAMYAVVTP"
XX
SQ   Sequence 644 BP; 132 A; 164 C; 128 G; 220 T; 0 other;
     tagatctctg tgtggtatct agcacggtac ccaagatgtt agtaagtatc ttgacacaaa        60
     acaaggccat ctcctatgct ggctgtcttg cccagatgtc cctatttatg ttttttggtt       120
     gtttggacaa ttttcttctc actgcaatgg cctatgaccg ttttgtggct atctgtcacc       180
     ctctgcgcta tacatccatc atgagtcctg agctgtgctg cctgatggtg ctgctctcct       240
     ggatactaag tcttctcaac accctccttc acagtctgat ggtgacaaga ctctccttct       300
     gtacaggcca tgaaatccag cacttctttt gtgatcttga aaaagttcta aaactctcat       360
     gttctgacac ccttatcaat tatgtcttgc tatatgttat agctggtctg cttggtgttc       420
     tccccctcac agggattctc ttctcataca gtcagatatt ttcttccatt ttgaaagtcc       480
     catctgctag gggtaagtac aaagcctttt ctacctgtgg atctcatctc tcagttgttt       540
     ccttattcta tggcacaggg ctgggagtgt gtttgagctc ctcagtgacc cagtcttcct       600
     ggaagagtac agttgcctca gcaatgtatg ctgtggtcac cccc                        644
//

If you have problems or comments...

PBIL Back to PBIL home page