(data stored in ACNUC7820 zone)

EMBL: AB263478

ID   AB263478; SV 1; linear; genomic DNA; STD; MAM; 649 BP.
XX
AC   AB263478;
XX
DT   18-JUN-2008 (Rel. 96, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Monodelphis domestica opor13 gene for olfactory receptor, partial cds.
XX
KW   .
XX
OS   Monodelphis domestica (gray short-tailed opossum)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
XX
RN   [1]
RP   1-649
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   ;
RL   Submitted (21-JUN-2006) to the INSDC.
RL   Contact:Takushi Kishida Kyoto University, Department of Zoology; 459,
RL   Shirahama, Wakayama 649-2211, Japan
XX
RN   [2]
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   "The opossum olfactory receptor genes";
RL   Unpublished.
XX
DR   MD5; e72ae4bcd813cb861db68639a9ff8a21.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Monodelphis domestica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:13616"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /gene="opor13"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:B3ITD4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:B3ITD4"
FT                   /protein_id="BAG48917.1"
FT                   /translation="FVDLCIITTTVPNMLVNFLKRSKVIPYAGCLAQLYFFMAFGSLDN
FT                   FLLTAMAYDRFVAICHPLHYATIMSPRLCVLLVLLSWIISLVQSLIQNLMVTRLSFCRD
FT                   HEIQHFFCDFPQILKLSCSDTFINYMLLYITTGLLGIVPLTGIVFSYSQIFSSILKVPS
FT                   AKGKYKAFSTCGSHLSVVSLFYGTGIGVYLSSSTTQSSWKSTVASAMYAVIIP"
XX
SQ   Sequence 649 BP; 146 A; 152 C; 117 G; 234 T; 0 other;
     ctttgtggat ctctgtatca taaccactac agttcccaat atgctggtga acttcttgaa        60
     acgaagtaag gttataccct atgctggctg tcttgcccag ttgtacttct tcatggcttt       120
     tggtagtttg gacaatttcc ttctcactgc aatggcctat gaccgttttg tggcaatctg       180
     tcaccctctg cattatgcaa ccatcatgag ccctagactc tgtgtcctct tggtgctact       240
     ctcctggata ataagccttg tacagtccct cattcagaat ctgatggtaa caaggctctc       300
     tttctgtaga gatcatgaaa ttcagcactt cttttgtgat ttccctcaaa ttttgaaact       360
     ctcttgttct gacaccttta tcaattatat gttattatat attacgactg ggctgctggg       420
     tattgtccca ctcacaggga ttgttttctc atacagtcag atcttttctt caattttgaa       480
     agtcccatct gctaagggta agtacaaagc cttttctacc tgtggatctc atctctctgt       540
     tgtttcttta ttctatggta cagggatagg agtatattta agttcttcca ctacccaatc       600
     ttcctggaag agcacagttg cttcagcaat gtatgctgtg atcatcccc                   649
//

If you have problems or comments...

PBIL Back to PBIL home page