(data stored in ACNUC15260 zone)

EMBL: AB263575

ID   AB263575; SV 1; linear; genomic DNA; STD; MAM; 649 BP.
XX
AC   AB263575;
XX
DT   18-JUN-2008 (Rel. 96, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Monodelphis domestica opor18 gene for olfactory receptor, partial cds.
XX
KW   .
XX
OS   Monodelphis domestica (gray short-tailed opossum)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
XX
RN   [1]
RP   1-649
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   ;
RL   Submitted (21-JUN-2006) to the INSDC.
RL   Contact:Takushi Kishida Kyoto University, Department of Zoology; 459,
RL   Shirahama, Wakayama 649-2211, Japan
XX
RN   [2]
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   "The opossum olfactory receptor genes";
RL   Unpublished.
XX
DR   MD5; b3d3b8b151acc70ee45d6af5bb1c0b42.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Monodelphis domestica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:13616"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /gene="opor18"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:B3ITM3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:B3ITM3"
FT                   /protein_id="BAG49006.1"
FT                   /translation="LVDLCLVTTLVPKMLVNMLTQNKVISYAECFSQMYFFMNFACSDN
FT                   LLLTVMAYDRFVAICHPLHYVTLMSPRICSLLILISWSISILNSIFQILMMLRLSFCTK
FT                   REISHFFCDLSEVMKISCSDTLINTIEVYFATGLLGVLPLTGILFSYSQICSSILKVPS
FT                   PGGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSATTHSSRNISIASVMYSVVTP"
XX
SQ   Sequence 649 BP; 151 A; 153 C; 111 G; 234 T; 0 other;
     cctggtagat ctctgtctag ttactacctt ggtacccaag atgctggtga acatgctaac        60
     acaaaataag gttatctcat atgctgagtg cttttctcag atgtacttct ttatgaattt       120
     tgcttgttca gacaatttac tccttactgt catggcctat gaccgctttg tggccatctg       180
     tcaccctcta cactatgtca ctctgatgag tccacgcatt tgtagcctac tgattctgat       240
     ctcatggtct ataagtattc taaattccat tttccaaatt ttaatgatgt tgaggttgtc       300
     tttctgcaca aaacgtgaaa tttcccactt tttctgtgat cttagtgaag ttatgaagat       360
     ttcttgttct gacaccctca ttaataccat agaagtatat tttgcaactg gtctcctggg       420
     tgttctcccc ctcacaggga tccttttctc ttactctcag atctgctcct caatattaaa       480
     agtaccatca ccgggaggaa aatataaagc cttttctacc tgtgggtctc acctctctgt       540
     tgtttcatta ttctatggga caggtcttgg agtttatctg agttctgcaa ctacccactc       600
     ctctaggaat atctcaattg cctcagtgat gtattctgtg gtaaccccc                   649
//

If you have problems or comments...

PBIL Back to PBIL home page