(data stored in ACNUC7820 zone)

EMBL: AB263611

ID   AB263611; SV 1; linear; genomic DNA; STD; MAM; 649 BP.
XX
AC   AB263611;
XX
DT   18-JUN-2008 (Rel. 96, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Monodelphis domestica opor10 gene for olfactory receptor, partial cds.
XX
KW   .
XX
OS   Monodelphis domestica (gray short-tailed opossum)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
XX
RN   [1]
RP   1-649
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   ;
RL   Submitted (21-JUN-2006) to the INSDC.
RL   Contact:Takushi Kishida Kyoto University, Department of Zoology; 459,
RL   Shirahama, Wakayama 649-2211, Japan
XX
RN   [2]
RA   Kishida T., Hoshiyama D., Iwabe N.;
RT   "The opossum olfactory receptor genes";
RL   Unpublished.
XX
DR   MD5; 43afacf5d1caf55a677241c8134fb624.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Monodelphis domestica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:13616"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /gene="opor10"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:B3ITQ8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:B3ITQ8"
FT                   /protein_id="BAG49041.1"
FT                   /translation="FVDLCVVSTTVPKMLVSILTQNKAISYAGCLAQMYLFIVFAGLDN
FT                   FLLTAMAYDRFVAICHPLRYTSIMSPELCCLLVLLSWILSLLDALLHSLMVTRLSFCTG
FT                   HKIQHFFCDLDQVLKLSCSDTLINYVLIYIVAGLLGILPLTGILFSYSQIFSSILKVPS
FT                   AGGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSSVTHSSWKSTVASAMYAVVTP"
XX
SQ   Sequence 649 BP; 127 A; 164 C; 128 G; 230 T; 0 other;
     ctttgtagat ctctgtgtgg tatctaccac ggtacccaag atgttagtga gtatcttgac        60
     acaaaacaag gccatctcct atgctggctg tcttgcccag atgtatctat ttatcgtttt       120
     tgctggtttg gacaatttcc ttctcactgc aatggcctat gaccgttttg tggctatctg       180
     tcaccctctg cgttatacat ccattatgag tcctgagctg tgttgcctgc tggtgctgct       240
     ctcctggata ctaagtcttc tcgatgccct tcttcacagt ttgatggtaa caaggctctc       300
     cttctgtaca ggccataaaa ttcagcactt cttttgtgat cttgatcaag ttctaaaact       360
     ctcatgttct gacaccctta tcaattatgt cttgatatat attgtagccg gtctgcttgg       420
     tattctcccc ctcacaggga ttctcttctc atacagtcag atcttttctt ccattttgaa       480
     agtcccatct gctgggggta agtacaaagc cttttctacc tgtggatctc atctctctgt       540
     tgtttcctta ttctatggca cagggctggg agtgtatttg agctcctctg tgacccactc       600
     ttcctggaag agtacagttg cctcagcaat gtatgctgtg gtcaccccc                   649
//

If you have problems or comments...

PBIL Back to PBIL home page