(data stored in ACNUC27125 zone)

EMBL: AB375793

ID   AB375793; SV 1; linear; mRNA; STD; MAM; 321 BP.
XX
AC   AB375793;
XX
DT   19-JAN-2008 (Rel. 94, Created)
DT   19-JAN-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Bos taurus mRNA for calcineurin A gamma, partial cds.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-321
RA   Shibata M., Matsumoto K., Oe M., Nakajima I., Muroya S., Chikuni K.;
RT   ;
RL   Submitted (17-JAN-2008) to the INSDC.
RL   Contact:Masahiro Shibata National Agricultural Research Center for Western
RL   Region; Yoshinaga 60, Ohda, Shimane 694-0013, Japan
XX
RN   [2]
RA   Shibata M.;
RT   "Gene expression of calcineurin during development of skeletal muscle in
RT   Cattle";
RL   Unpublished.
XX
DR   MD5; 338b24d6daf04169420f6f3bb65dad54.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..321
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_type="skeletal muscle"
FT                   /note="breed: Japanese Black Cattle"
FT                   /db_xref="taxon:9913"
FT   CDS_pept        <1..>321
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /product="calcineurin A gamma"
FT                   /note="protein phosphatase 3 (formerly 2B), catalytic
FT                   subunit, gamma isoform (calcineurin A gamma)"
FT                   /db_xref="GOA:A9ZTJ8"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A9ZTJ8"
FT                   /protein_id="BAF99031.1"
FT                   /translation="CSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQMTGFP
FT                   SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGE
FT                   KV"
XX
SQ   Sequence 321 BP; 91 A; 70 C; 60 G; 100 T; 0 other;
     ggtgctctta tttttacagt taccctgcag tttgtgaatt tctgcagaac aataatttgc        60
     tctcaataat cagagcccat gaagcccaag atgccgggta tcgaatgtac aggaagagcc       120
     aaatgacggg ttttccatcg ctcattacaa ttttctctgc acccaattac ctagatgtct       180
     ataacaataa agctgctgtg ttaaaatatg aaaacaacgt catgaatatc aggcagttta       240
     actgttctcc acacccctac tggcttccaa actttatgga tgttttcacg tggtctttgc       300
     cttttgtcgg ggaaaaagtt a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page