(data stored in ACNUC26462 zone)

EMBL: AB451407

ID   AB451407; SV 1; linear; mRNA; STD; HUM; 1110 BP.
XX
AC   AB451407;
XX
DT   02-SEP-2008 (Rel. 97, Created)
DT   02-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens CAMK1 mRNA for calcium/calmodulin-dependent protein kinase I,
DE   partial cds, clone: FLJ08111AAAF.
XX
KW   Gateway cloning system.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1110
RA   Kawamura Y., Nomura N., Goshima N.;
RT   ;
RL   Submitted (31-JUL-2008) to the INSDC.
RL   Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC),
RL   National Institute of Advanced Industrial Science and Technology (AIST);
RL   2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
XX
RN   [2]
RA   Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R.,
RA   Wakamatsu A., Yamamoto J.-I., Kimura K., Nishikawa T., Andoh T., Iida Y.,
RA   Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.,
RA   Kenmochi K.-I., Kimura R., Kobayashi M., Kuroita T., Kuwayama H.,
RA   Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R.,
RA   Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N.,
RA   Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T.,
RA   Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H.,
RA   Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T.,
RA   Imai J.-I., Watanabe S., Nomura N.;
RT   "Human Protein Factory: an infrastructure to convert the human
RT   transcriptome into the in vitro-expressed human proteome of versatile
RT   utility";
RL   Unpublished.
XX
DR   MD5; 295f2aa1aebad012f253ce314b104b75.
XX
CC   This human Gateway entry clone was constructed by recombining an
CC   attB-attached open reading frame (ORF) fragment with attP
CC   sequences of the Gateway donor vector pDONR201. The ORF sequence
CC   in the entry clone is flanked with attL1 sequence (100 nt) -
CC   spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
CC   spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
CC   translational initiation codon (ATG) and is also flanked with
CC   spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
CC   the ORF. This is an F-type clone that deletes the stop codon for
CC   C-terminal tagged proteins. DNA sequences of the entire ORF and
CC   flanking regions were validated by sequencing. Clone structure of
CC   the ORF and flanking sequences is as follows:
CC   5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
CC   tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
CC   TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
CC   gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
CC   attL sequences are described in lower cases).
CC   Clone information: http://www.HGPD.jp/
CC   This clone was produced in the "Functional Analysis of Protein and
CC   Research Application" project supported by the New Energy and
CC   Industrial Technology Development Organization (NEDO), Japan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="FLJ08111AAAF"
FT                   /note="Vector: pDONR201"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..>1110
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CAMK1"
FT                   /product="calcium/calmodulin-dependent protein kinase I"
FT                   /db_xref="GOA:B5BU41"
FT                   /db_xref="H-InvDB:HIT000487620.4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B5BU41"
FT                   /protein_id="BAG70221.1"
FT                   /translation="MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKL
FT                   VAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELF
FT                   DRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDF
FT                   GLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDEN
FT                   GAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTA
FT                   LDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTP
FT                   VAGGPAAGCCCRDCCVEPGTELSPTLPHQL"
XX
SQ   Sequence 1110 BP; 264 A; 290 C; 338 G; 218 T; 0 other;
     atgctggggg cagtggaagg ccccaggtgg aagcaggcgg aggacattag agacatctac        60
     gacttccgag atgttctggg cacgggggcc ttctcggagg tgatcctggc agaagataag       120
     aggacgcaga agctggtggc catcaaatgc attgccaagg aggccctgga gggcaaggaa       180
     ggcagcatgg agaatgagat tgctgtcctg cacaagatca agcaccccaa cattgtagcc       240
     ctggatgaca tctatgagag tgggggccac ctctacctca tcatgcagct ggtgtcgggt       300
     ggggagctct ttgaccgtat tgtggaaaaa ggcttctaca cggagcggga cgccagccgc       360
     ctcatcttcc aggtgctgga tgctgtgaaa tacctgcatg acctgggcat tgtacaccgg       420
     gatctcaagc cagagaatct gctgtactac agcctggatg aagactccaa aatcatgatc       480
     tccgactttg gcctctccaa gatggaggac ccgggcagtg tgctctccac cgcctgtgga       540
     actccgggat acgtggcccc tgaagtcctg gcccagaagc cctacagcaa ggctgtggat       600
     tgctggtcca taggtgtcat cgcctacatc ttgctctgcg gttaccctcc cttctatgac       660
     gagaatggtg ccaaactctt tgaacagatt ttgaaggccg agtacgagtt tgactctcct       720
     tactgggacg acatctctga ctctgccaaa gatttcatcc ggcacttgat ggagaaggac       780
     ccagagaaaa gattcacctg tgagcaggcc ttgcagcacc catggattgc aggagataca       840
     gctctagata agaatatcca ccagtcggtg agtgagcaga tcaagaagaa ctttgccaag       900
     agcaagtgga agcaagcctt caatgccacg gctgtggtgc ggcacatgag gaaactgcag       960
     ctgggcacca gccaggaggg gcaggggcag acggcgagcc atggggagct gctgacacca      1020
     gtggctgggg ggccggcagc tggctgttgc tgtcgagact gctgcgtgga gccgggcaca      1080
     gaactgtccc ccacactgcc ccaccagctc                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page