(data stored in ACNUC21429 zone)

EMBL: AC007127

ID   AC007127; SV 7; linear; genomic DNA; STD; PLN; 35515 BP.
XX
AC   AC007127;
XX
DT   24-MAR-1999 (Rel. 59, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   Arabidopsis thaliana chromosome 2 clone T23A1 map mi398, complete sequence.
XX
KW   HTG.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-35515
RA   Lin X., Kaul S., Shea T.P., Fujii C.Y., Shen M., VanAken S.E.,
RA   Barnstead M.E., Mason T.M., Bowman C.L., Ronning C.M., Benito M.-I.,
RA   Carrera A.J., Creasy T.H., Buell C.R., Town C.D., Nierman W.C.,
RA   Fraser C.M., Venter J.C.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-35515
RA   Lin X.;
RT   ;
RL   Submitted (09-MAR-2000) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr., Rockville, MD
RL   20850, USA
XX
RN   [3]
RP   1-35515
RA   Town C.D., Kaul S.;
RT   ;
RL   Submitted (27-FEB-2002) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA, cdtown@tigr.org
XX
DR   MD5; 163eced2327ba4795f0970c418dd9a5e.
DR   GOA; Q8H111.
DR   InterPro; IPR000270; PB1_dom.
DR   InterPro; IPR003035; RWP-RK_dom.
DR   InterPro; IPR034891; PB1_NLP.
DR   UniProtKB/Swiss-Prot; Q8H111; NLP1_ARATH.
XX
CC   On Apr 18, 2002 this sequence version replaced gi:6598670.
CC   Information on performance of analysis and a more detailed
CC   annotation of this entry and other sequences of chromosome 4 can
CC   be
CC   viewed at: http://websvr.mips.biochem.mpg.de/proj/thal/.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..35515
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /map="mi398"
FT                   /cultivar="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /clone="T23A1"
FT                   /db_xref="taxon:3702"
FT   repeat_region   complement(3265..3291)
FT                   /rpt_family="(GA)n"
FT   mRNA            join(<3535..3567,4305..4493,4728..>4793)
FT                   /gene="At2g17160"
FT   CDS_pept        join(3535..3567,4305..4493,4728..4793)
FT                   /codon_start=1
FT                   /gene="At2g17160"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:O23010"
FT                   /db_xref="UniProtKB/TrEMBL:O23010"
FT                   /protein_id="AAD25135.1"
FT                   /translation="MGTKARRPNPEAPVRRNGKFVTELMNPNLKGKFSTEEAFLVFKLA
FT                   SECLQCEHRKSLITKELVATLKALQTKPHIPTSEMTKQNLEASSSSQTKA"
FT   mRNA            join(<5517..5810,5880..6015,6336..6463,6543..6612,
FT                   6682..6767,6864..7055,7139..>7219)
FT                   /gene="At2g17170"
FT   CDS_pept        join(5517..5810,5880..6015,6336..6463,6543..6612,
FT                   6682..6767,6864..7055,7139..7219)
FT                   /codon_start=1
FT                   /gene="At2g17170"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9SIJ1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SIJ1"
FT                   /protein_id="AAD25145.1"
FT                   /translation="MGGCCFSTPLDNNQQPPQQPQIPPGERKNDGFVNWPVTEFFLSDI
FT                   TTATNNFSSDEIISENAEESSNVVYKGCLLENLGFVAVKRFKNTPWDDPDYFTEDAKTA
FT                   GELKHKRLVKLLGYCCEEDEGLLVAEFMPNDTLAKRLFQEKNMEWSMRLRVAYHIVEAL
FT                   DYCNSVRFDEYDNLSAYTVLFDKDGDACLSSFGLVKEIIRYNRREGGNVRTGNVTYRFG
FT                   TILVNLLTGLQISPSHAPEMINGKDVTELMDPNLKGKFSTEEATIVLKLASECLQWKGY
FT                   IENGITKKLVATLKALQAKKEISSSEMHEVTKQHDVASSSSQQQLPP"
FT   mRNA            complement(<7616..>8428)
FT                   /gene="At2g17180"
FT   CDS_pept        complement(7616..8428)
FT                   /codon_start=1
FT                   /gene="At2g17180"
FT                   /product="putative C2H2-type zinc finger protein"
FT                   /db_xref="GOA:Q9SIJ0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SIJ0"
FT                   /protein_id="AAD25136.1"
FT                   /translation="MSNTSNSDPNSDIPFASSNVTLPSYNQNPRRKRTKLTNNEVGSSS
FT                   SSPRPKPVTQPDPDASQIARPCTECGKQFGSLKALFGHMRCHPERQWRGINPPSNFKRR
FT                   INSNAASSSSSWDPSEEEHNIASCLLMMANGDVPTRSSEVEERFECDGCKKVFGSHQAL
FT                   GGHRATHKDVKGCFANKNITEDPPPPPPQEIVDQDKGKSVKLVSGMNHRCNICSRVFSS
FT                   GQALGGHMRCHWEKDQEENQVRGIDLNVPAATSSDTTLGCSLDLRLGL"
FT   mRNA            complement(join(8737..8937,9046..9201,9284..9373,
FT                   9518..9546,9936..9991,10094..10207,10292..10494,
FT                   10790..11536,11914..>12265))
FT                   /gene="At2g17190"
FT   CDS_pept        complement(join(9053..9201,9284..9373,9518..9546,
FT                   9936..9991,10094..10207,10292..10494,10790..11536,
FT                   11914..12142))
FT                   /codon_start=1
FT                   /gene="At2g17190"
FT                   /product="putative ubiquitin-like protein"
FT                   /db_xref="GOA:Q9SII9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII9"
FT                   /protein_id="AAD25137.2"
FT                   /translation="MGGEADSRQPLTAEGVAVAVNVRCSNGTKFSVTTSLDSTVESFKE
FT                   LIAQNSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTVHMVRGFVPSSPSAPAANAGN
FT                   QTTAPQAVGSNDSSNLGGGESLFPGLGFNPLGGGNAMAGLFGSGLPDLEQAQQQLAQNP
FT                   NMIREMMNTPAIQNLMNNPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQTLEAA
FT                   RNPELMREMMRNTDRAMSNIESMPEGFNMLRRMYENVQEPLMNATTMSENAGNNTSSNP
FT                   FAALLGNQGVTTQGSDTSNNISAPNAETGTPNANPLPNPWGATAGQTTAPGRTNAGLGG
FT                   LGGLGGLGGLGMLGADSPLGATPDASQLSQILQNPAMSQMMQSVLSNPQYMNQLMSLNP
FT                   QLRSMLDMNPQLREMMQNPDFLRQFSSPEMMQQMMSLQQSLFSQNRNTAGQDPTQTGAA
FT                   TGTANNGGLDLLMNMFGSLGAGGLSGTNQPNVPPEERFATQLQQLQEMGFYDRAENIRA
FT                   LLATNGNVNAAVERLLGSIGQ"
FT   mRNA            complement(join(<12798..13062,13139..13222,13395..13423,
FT                   13816..13868,14049..14162,14239..14471,14766..15530,
FT                   15643..>16014))
FT                   /gene="At2g17200"
FT   CDS_pept        complement(join(12914..13062,13139..13222,13395..13423,
FT                   13816..13868,14049..14162,14239..14471,14766..15530,
FT                   15643..15871))
FT                   /codon_start=1
FT                   /gene="At2g17200"
FT                   /product="putative ubiquitin-like protein"
FT                   /db_xref="GOA:Q9SII8"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII8"
FT                   /protein_id="AAD25138.1"
FT                   /translation="MGGEGDSSQPQSGEGEAVAVNIRCSNGTKFSVKTSLDSTVESFKE
FT                   LVAQSSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTIHMVRGSAPSSAPPPAPAASQ
FT                   TTAPSVTRGVGSDNSSNLGGASPGESLFPGLGFNPLGGGNAMSGLFGAGLPDLVQTQQQ
FT                   LAQNPNMIRDMMNTPAIQNLMNNPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQ
FT                   TLEAARNPELMREMMRNTDRAMSNIESMPEGFNMLRRMYENVQEPLMNATTMSGNAGNN
FT                   TGSNPFAALLGNQGVTTQGSDASNNSSTPNAGTGTIPNANPLPNPWGATGGQTTAPGRT
FT                   NVGGDARSPGLGGLGGLGSLGGLGGLGMLGADSPLGATPDASQLSQLLQNPAISQMMQS
FT                   VFSNPQYMNQLMSLNPQLRSMLDSNPQLREMMQNPDFLRQFSSPEMMQQMMTLQQSLSQ
FT                   NRNTASQDAGQTGAATGNNGGLDLLMNMFGSLGAGGLSGTNQSNVPPEERYATQLQQLQ
FT                   EMGFYDRAENIRALLATNGNVNAAVERLLGSIGQ"
FT   mRNA            complement(join(<16179..18136,18194..>18383))
FT                   /gene="At2g17210"
FT   CDS_pept        complement(join(16179..18136,18194..18383))
FT                   /codon_start=1
FT                   /gene="At2g17210"
FT                   /product="putative selenium-binding protein"
FT                   /db_xref="GOA:Q9SII7"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII7"
FT                   /protein_id="AAD25139.1"
FT                   /translation="MGSHLCSKLQALSSKIKQASVSGKWREVVSGYSEIQRAGVQFNDP
FT                   FVFPIVFKACAKLSWLFQGNSIADFYMKCGDLCSGLREFDCMNSRDSVSWNVIVFGLLD
FT                   YGFEEEGLWWFSKLRVWGFEPNTSTLVLVIHACRSLWFDGEKIHGYVIRSGFCGISSVQ
FT                   NSILCMYADSDSLSARKLFDEMSERDVISWSVVIRSYVQSKEPVVGLKLFKEMVHEAKT
FT                   EPDCVTVTSVLKACTVMEDIDVGRSVHGFSIRRGFDLADVFVCNSLIDMYSKGFDVDSA
FT                   FRVFDETTCRNIVSWNSILAGFVHNQRYDEALEMFHLMVQEAVEVDEVTVVSLLRVCKF
FT                   FEQPLPCKSIHGVIIRRGYESNEVALSSLIDAYTSCSLVDDAGTVLDSMTYKDVVSCST
FT                   MISGLAHAGRSDEAISIFCHMRDTPNAITVISLLNACSVSADLRTSKWAHGIAIRRSLA
FT                   INDISVGTSIVDAYAKCGAIEMARRTFDQITEKNIISWTVIISAYAINGLPDKALALFD
FT                   EMKQKGYTPNAVTYLAALSACNHGGLVKKGLMIFKSMVEEDHKPSLQHYSCIVDMLSRA
FT                   GEIDTAVELIKNLPEDVKAGASAWGAILSGCRNRFKKLIITSEVVAEVLELEPLCSSGY
FT                   LLASSTFAAEKSWEDVAMMRRLVKERKVRVVAGYSMVREGNLAKRFLAGDKLSQSDSEL
FT                   NDVVQSLHRCMKLDDTAGPIN"
FT   mRNA            complement(join(<18435..19077,19154..19277,19359..19501,
FT                   19589..19724,19825..20159,20474..>20725))
FT                   /gene="At2g17220"
FT   CDS_pept        complement(join(18647..19077,19154..19277,19359..19501,
FT                   19589..19724,19825..20159,20474..20549))
FT                   /codon_start=1
FT                   /gene="At2g17220"
FT                   /product="putative protein kinase"
FT                   /db_xref="GOA:Q9SII6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII6"
FT                   /protein_id="AAD25140.2"
FT                   /translation="MGLCWGSPSDSPPTTTPSSTGNISSVGTFKSSNNTTTTGTSRGSN
FT                   ISSNSGFSVASGEDAYPDGQILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKG
FT                   WLEDKTPGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEE
FT                   LLLVYEYMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFK
FT                   ASNILLDGSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVY
FT                   GFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAF
FT                   RVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPSIRQQQGHYRPQ
FT                   QLSSFRPRQNVSRAH"
FT   repeat_region   complement(21395..21416)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(23226..23249)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(23950..24015)
FT                   /rpt_family="(CATAT)n"
FT   mRNA            complement(<25535..>26797)
FT                   /gene="At2g17230"
FT   CDS_pept        complement(25673..26764)
FT                   /codon_start=1
FT                   /gene="At2g17230"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:Q9SII5"
FT                   /db_xref="InterPro:IPR006766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII5"
FT                   /protein_id="AAD25141.1"
FT                   /translation="MSSPATTITFFFFFTLSSFFYITSSLQNNNNNKHTATVNSLNIPS
FT                   AAAEITLVNPKLPPRSLSLTSSKKFEGSSNLVHLRYHMGPVLSSSPINIYVIWYGQWSR
FT                   PHKSLIRDFLNSISDAKAPSPSVSEWWRTASLYTDQTGSNVSRSVLIAGEYSDSKYSHG
FT                   QHLTRLTIQEVIASAARSASFPVDHKNGMYLVLTSHDVTMQDFCRAVCGFHYFTFPSMV
FT                   GYTMPYAWVGQSGKQCPEVCAYPFALPGYMGHGGPGELRPPNGETGVDGMVSVIGHELA
FT                   EVVSNPLINAWYAGEDPTAPTEIGDLCEGLYGSGGGGGYIGQVMRDREGKTFNMNGKGG
FT                   RKFLVQWIWNPNLKACSGPNSVD"
FT   repeat_region   26976..26998
FT                   /rpt_family="AT_rich"
FT   repeat_region   27163..27186
FT                   /rpt_family="(TA)n"
FT   repeat_region   27418..27459
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(28177..28212)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(28913..29192,29589..29977)
FT                   /gene="At2g17240"
FT   CDS_pept        join(28959..29192,29589..29777)
FT                   /codon_start=1
FT                   /gene="At2g17240"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:Q9SII4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SII4"
FT                   /protein_id="AAD25142.1"
FT                   /translation="MASLCSARFLPSPSLDILSTKTKISSDSRSLGCSSSRVFAFSSVH
FT                   RSSSRRNRNQLQVVSMAPEEEKLTRRNPLDFPIEWERPKPGRRPDIFPKFSPMKTPLPP
FT                   PMPYDPPEEDEEEEEKKEEEEENPDQEEEEQPEKQQ"
FT   repeat_region   29688..29756
FT                   /rpt_family="(GAA)n"
FT   mRNA            join(<30354..30710,30800..30892,30970..31063,31277..31328,
FT                   31467..31567,31648..31709,31827..31867,32163..32337,
FT                   32725..32870,33379..33484,33624..>33767)
FT                   /gene="At2g17250"
FT   CDS_pept        join(30354..30710,30800..30892,30970..31063,31277..31328,
FT                   31467..31567,31648..31709,31827..31867,32163..32337,
FT                   32725..32870,33379..33484,33624..33767)
FT                   /codon_start=1
FT                   /gene="At2g17250"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:O22737"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR027193"
FT                   /db_xref="UniProtKB/TrEMBL:O22737"
FT                   /protein_id="AAM15399.1"
FT                   /translation="MASILSKKQKKNEKYTLKELKSLGHDLLTSRSHINNLPLLLTFVS
FT                   PESPPQFVVESLLSLQSFFTPLLSQLPPTSSSPSSTKTEDPEVVFKAWLRSKFDEFVKL
FT                   LLDVLVSQQSEDSLRGIVLGTLMEFVKLLNAGRFHSSIYHRLLDAIIHSEVDIEIFLDI
FT                   LTSKYFKYIDVRYVDNTSTDRTVIENNEAESDSKESLELSVRKIYQVLSQIPPPEKQAE
FT                   KSQHEMWSGSDESISEKPTDKKKKTEKGDSTLLSPATISKRMKLNDFLTKSYDIGGVVS
FT                   VMALSSLFILMTQHGLEYPFFYEKLYALLVPSVFVAKHRAKFLQEIVENADEANTEAGE
FT                   HNESQPKTIKKRKLGIDYFNNQESDPKKSGALSKFISSLETNLTIRSKTTEMKIEDFCS
FT                   GSYATIFGDEKGKASSFSVLQNGSNISVCGFRFSWVDVHYSTRGRHMLISKSNQLMN"
FT   repeat_region   complement(35013..35045)
FT                   /rpt_family="AT_rich"
FT   repeat_region   35116..35143
FT                   /rpt_family="AT_rich"
XX
SQ   Sequence 35515 BP; 11594 A; 6568 C; 6366 G; 10986 T; 1 other;
     aaactgaaac atggagtatg accttagcaa tgcatatcgt tgtttctagg agctgaatga        60
     actaagaatc cagttaatgc acctcagagc ttggagtgtt caagttactt gaactcctta       120
     gatcgacggc ctgcaaaaca gcagcgtctt tagactgttg tggcacataa acaaaacttc       180
     tcactgttat cacagacatt aatcaaagaa gattatggct gaatgactga caggaggaga       240
     catgatgcag aaagaaagat gtagaacaat caaagtacaa acgtatgcag aagatgttgt       300
     tggactctaa agaaaaccaa aaaacaaact ggacaaatgt gaggaattga ataatgagca       360
     aacagagaaa gccatccagt gaaagataca ttcaagcatg aggtttactg gttgtatggg       420
     tctaaacatg tgaggtaagc gttgcgggat ctatagagta gtttgaggta gaggcaaaac       480
     ctcaagagct ttacacatct tctcaagttc ttgccggtaa ttcatcttct gagttgttgt       540
     gacgatctca acaacaccca aacaagtccc actacctctt tcgaaaacag gaagggcaag       600
     tgaaccacga acatcacact tttgtgcttc tttgatgcgt ggatattcat ctcttctaaa       660
     gaaacgcaca tcaggagtcc actcaggaaa cttctgcaag aaaacacgac cgggaagacc       720
     cacaaaatct ttcataccct catcagccgg gaaattataa gtctctgaaa catgtctgta       780
     ttctgcaagg ctggagtatt cttggttgaa taaatgtggc tgagcccaag tagtaagaaa       840
     gctcttccct tcctgctgaa ttggcaccca tatctgaacc aagaagtcct tatcttgcac       900
     cgcctcgtta agaccactaa tagcttgtag tagcctctcc ttcacagatg aagacgggcc       960
     ttcacttgca cttggagcaa tccaccaact ttttcccacc tcagcttctt ctaggagaaa      1020
     cttttcagcc tgaggaaaca ttctctctgt ttcttcatta gagaaattat cttgagatgg      1080
     attctcacca aagcagagga aagggctatt gtcattcatg gcggtagaag ctgaaggaga      1140
     ttgttctgtc tgcttcaagc tcttactatc tgttgtctct agccaacatc catcaaacaa      1200
     gagttcatcc atgaaatcca aatccatggc agtgtcagcg aatgccccaa agctagaatt      1260
     aggtgaaaac ccaccatttc cttcgcctcc atcactacca ccatcatctt ccatgtctaa      1320
     agattcgttt ttatacctcc aacagatact accaaatcct caagttctca gagactgtgc      1380
     ttagctgttg tttactcaag aaccgaaact cataagggtc ttgaagatga atagagacaa      1440
     gacaaagtcc tctccttgga atgttaaaac ccaatctgaa aaagttgcag aaacattgtc      1500
     aaagacccac ccaagaataa gacaagagaa gaatcatatc atagagatgc tatataatct      1560
     atataagtag cttcgctttc aatgaagagt tgacttaaga aggtatccat caatcaaagt      1620
     agagtgccat caatttcaat tacaaaattc tcacctatgg acatggaaac gaaatcaaat      1680
     ctgattgtcc atgaaagggt aagattttca ccaaaagtta ctaactttat caagatttgt      1740
     ttgcacaaag aaacagaaaa agcttcactt tgggacctat acccaagaac acttagagaa      1800
     agcaccaaca aacaaaaaaa aaacattgag aagatgcaca gactggattt tactctgtct      1860
     aatgtaaaaa gtaattggtc tctctatttc ttcatacata taatggtaag caaaatcaaa      1920
     tctgagaata tatataaaca aaacaaaaac aaaacctgtg aaatttctta tcacaagaag      1980
     cttctctctt tcttgaatgg tgtgttcttt ttttccttct ttttcttctg gacacaagta      2040
     cttggtgaag gtgaatgatt aagattgttt tagtctctaa agatgtaatt atgagcttca      2100
     atattctttt tagagagcaa gtggacccgt gataagagca tccactgttc taatcacact      2160
     tacatacaac tttgtctgta cctgtaaatc tgtaataata aagaaagtaa acaaacagtc      2220
     gcttggtttc tcaaatttaa atcaatcttt tcttctgaaa gaaagatcaa agaaggaaac      2280
     aaaaaaaaaa aacaagtttc taagttttgg tttggagcct gatggttaaa tgttcttatt      2340
     taatcgtgtg attggtgtta ttctgacctc ctctttgttg cccctaatca taattaattc      2400
     gtataagatt attattatta ttactataac agttgtggtg attacgtatg cgtacacttt      2460
     gttttatttc ttcgtcggta ctttgtgttt ttttattcgg ggatgtttca ttggttagaa      2520
     cttggctgta tcaatcggat caagatcatt tcttagagaa gacatgtctt tcgtgttgaa      2580
     caggttcgtt cgttcatcaa tatagtttga cctttaatac tttattttcg atttctctta      2640
     tatgaatatt ctttctgaca tcagctcgag tctcaaagtt taaaacattt tgtatatagg      2700
     atggaatcta tatatgatcg atatataaat aattgcatta aaggcataat gattcacaca      2760
     attatggtaa tatttattct tacacatgaa attgctattt atgttccaaa atgtcgtcat      2820
     tttattaatt tcatgacaaa aattactgtc ataagttggg tgctaactag acaggttgtg      2880
     aacttcccaa tgttacacat tatctaaatc gatataaaaa caaacccaaa aaaaaaaagc      2940
     gaacagaaga aacaaatcat tcatcttagg tttcatcatt caaccaaatt taatgattaa      3000
     acttgaatat ttgtgtatat aatatattaa tatgtacatt gatatccaac gggtcgggct      3060
     tagacgctta gttaaatgat caaaacggcc ctcaatgatt tggggagcca tagtccgatc      3120
     cccattagcc gcgtccggga caatgacatg accaaaccaa aggtcatcaa actctttgaa      3180
     aatagttgaa tcctcgtgta aatcataaat aacgtatcaa taataatcaa aggtttatac      3240
     tttatactat aaatgcgcac gacgtctctt tctctctctc tctcttcctc tatttcttag      3300
     atttgtcatt tgttattcgt ctgaatacgg caggtcctat ctacacatgt aacaataatg      3360
     tcgtttaaaa ttagtgtttt taatctcact gccagtacta taagattttg atatcatata      3420
     agatcaatat cattgatcga tccgagacaa aagaaagaaa aactaaatta tgttcattaa      3480
     tcgttatgta tagcgtaagt cgtgtgatgt caaaccatct cgtgattgag tatgatgggt      3540
     acaaaagcta ggagaccaaa ccctgaggta aagtaattac tgattgtatg aacaattttt      3600
     gtgtgagcaa aaaaaaacct gtaaaatata tatatatgcc catgataaga tgatatcaca      3660
     tttttgtaat gaaaacggtg tgatttaact aaattttatg tccttatctt ggtgcataca      3720
     aggcgttttc aaagatacat ataataattt cccgtacaat cgaatagaag cattggatta      3780
     ttggaataat acatgtttta tcgtacggta acttaagtgc ttactcggtt ctgtttgata      3840
     aggtatacga aacaacattt tcaagcttat gccttcttaa tgatctaatt aagtatgctt      3900
     aactgttttt atttgcttaa tggatatgtt gaagtcaaag aacaagaggt aatcagttct      3960
     tgcttgtctc ttcatactat tcatatctga atgtgatgtt atataatata ttcttattgt      4020
     aggaatcgtg aaccctaaaa gtgtgacatt gatttggtac taaatatcat tgtgaatctg      4080
     ctaactggaa agcgaattcc tccaagccat gtaagccatt ctgtttcaaa ccatgtaagc      4140
     cattcatctt gactttgtga ctttaatcct tagagaatct gtctttttca attccttgca      4200
     acacaagtca catttctgct gagtaaatta gttgtgatat agtaatcctt aatttcttgc      4260
     cacacaagac acatattact gagttgttat cctcctattt ttaggctcct gtgaggagaa      4320
     acggaaagtt tgttactgag ctgatgaatc caaatctcaa gggaaagttc tcaacagaag      4380
     aagctttcct agttttcaaa ctcgcctctg aatgtttgca gtgcgaacat agaaaaagtc      4440
     tcatcacaaa agagcttgtt gcaacactta aagccttgca aactaaacca cacgtaagga      4500
     gctaggctta ctataaccat atgcattctt gatgatattt ctcgcactcg tgttataaaa      4560
     cctatcgttt tgcttgcaga ttccaaacat tcaaatgctt gaactggaaa agtagcacga      4620
     ggtgggagca tcttccagtc aacaacaaca gtttgaactg tttagcgttc ttaagtatgc      4680
     agattccaac ttcttcttaa gttataaaac cgatcttttg tttgcagatt ccaacttctg      4740
     aaatgacaaa gcagaatctg gaggcatcat cttcaagtca aactaaagca taagtaagaa      4800
     taggacttat tgttaccctt aatgaattct ttatgagttt tcgtactaaa aaacagatca      4860
     tcatcatctt gcttgcaggt tccatcttct aatatggaaa atttaagcag aagaatcatc      4920
     ttccacactg aatctgctag tagctttaac aaagcaacac ttctcgaagc aaagagatcc      4980
     aacaacatgc atggttaggg aagaagaatc ttgagtttat gttaaaaaat ataaaaaaga      5040
     agtgatatct tttacccttg ttatatatta aaaaaaatac gtatacattt ctctcttctt      5100
     tttgttaaag ggttcaaatg aatttatctc attaattaac aatatcacta gcaaaactat      5160
     aattctacta aaaaagtttt caaataatta accaaaaaaa atatcataca cctttgaaat      5220
     ccacttgtca caccaccatg caatttcaaa cttcctaaat atgaaaatat aattttgacc      5280
     cactagtgaa aaaacaagga aaatatataa caaaaaacta taataataac tagaagatga      5340
     agatcaacga taaagattgc gtaatcttga gtttagattt tagggataat agtctgttat      5400
     aaaaggttct ttcctttgtg taaactcact tgttagtgat aacaatctct ttctctttct      5460
     ctctcgcaaa gaacgctttc aatattctct ctgcttttgc cggcgaaaac gaaaccatgg      5520
     gtggttgttg cttctcgacg cctcttgata acaatcaaca acctccacaa cagccacaga      5580
     ttcctcccgg cgaacgcaag aacgacggat tcgtcaactg gcctgtcaca gagttcttcc      5640
     tctccgatat caccacggcg accaataact tcagttccga cgagatcata tcagagaacg      5700
     cagaagaatc ttccaatgtt gtctacaaag gttgtttatt agagaatctt ggcttcgtag      5760
     ctgtcaagag attcaagaat acgccttggg atgatcctga ctacttcacg gtaccttttc      5820
     tttgctttta aaggttatca aagtttgcaa cgttcatttg atctcttttg tttcttcagg      5880
     aagacgcaaa aacagctggg gagctaaagc acaagagact tgtcaagttg ttgggatatt      5940
     gctgcgagga agatgaagga cttcttgttg cagagtttat gccaaatgat actcttgcta      6000
     agcgtttatt ccagggtatg attccttctc ttctttcgtt ttcagatata gaattggtga      6060
     atatgagctt aagagtctgg attgttagtc gatctgttct atagatgtat gtgctctgtt      6120
     ttgaatcttg gcagagaggc tgcattgttg gtttttgtgg catgattgtg ggtgtagaat      6180
     ggtataaacg tatctgaaga tagagagagt gcattgttgt tggtttatgt gacatgctat      6240
     agaatggtgt aaatgtatct gcttgtagaa ttgattgaaa cagaacttat tagcattctc      6300
     tgtttgaggt ttcttttttc ttttgtgatg cacagagaag aacatggaat ggtcaatgag      6360
     gttgcgagtg gcgtatcata tagttgaagc attggattat tgcaattctg tacgttttga      6420
     cgagtacgat aatctaagtg cttacactgt tctgtttgat aaggtatgtt aaacaacatt      6480
     tttcatgcct atgccttgtc atgtgatcta aggatgctaa actgttttta ctggtgttga      6540
     aggatggtga tgcctgtctt tctagtttcg gcttggtgaa agagatcatc cgttacaatc      6600
     gaagagaagg aggtaaccaa ttcgctcttg tatcttcaga ctattcatat cagaatgtaa      6660
     tgttttatat tctcattgta gggaacgtga ggactgggaa tgtgacatac agatttggta      6720
     ctatccttgt gaatctgcta actggattgc aaatttctcc gagccatgta agtaattctg      6780
     ttcaagcttg actttgtgga atccttggtt tcttgcaaca caagttacat tttactgagt      6840
     ggttatttat cctctgtttc taggctcctg agatgatcaa tggaaaggat gtcactgagc      6900
     tcatggatcc aaatctgaag ggaaagttct ctacagaaga agctactata gttttaaaac      6960
     tcgcctctga atgtttgcag tggaagggtt atatagagaa tggcatcact aaaaagcttg      7020
     ttgcaacact taaagccttg caggctaaaa aagaagtaag gaggcttact gttacaataa      7080
     tttcatccct gaagattttt cgcattcatg ttataaaacc aaatcttttt gcttgtagat      7140
     ttcatcttct gaaatgcatg aagtaacaaa gcagcacgat gtggcatcat cttcgagtca      7200
     acaacaactt ccaccctgaa tctgctaata gcttcaacaa agtaactctt ctcgaagcaa      7260
     catttttagg gaagaagaat cttgattttc tcacttagtg tactgacact gtgaagaaac      7320
     accataatcc atgcatgata catatacatg tatgatcaaa caatataaac tttttacata      7380
     gggaaaaaga ttcaacgttt taaacttcat aaagctaatt tcttgaatat tggacattta      7440
     gtaaataact ctatttgcat ttcataaact aattaactta tatatagaat acaataccac      7500
     aatcctatac gttcatcata caaagtatca cacatatata cagagagagt tttttgttaa      7560
     ttaagagaaa gaaccaaata cccaataaat atataaaacc ttaagttatc atatatcaaa      7620
     gtcctaacct aagatccaag gaacaaccta acgttgtgtc tgaagatgtc gccgcaggaa      7680
     cattaagatc aatgcccctg acttggttct cttcctgatc tttctcccaa tgacatctca      7740
     tgtgacctcc taacgcttga ccactggaga acactctaga acagatgtta catcgatgat      7800
     tcatccccga gaccaacttc acactcttgc ccttatcttg atcaacgatc tcttgaggag      7860
     gtggaggagg aggatcttcg gttatgtttt tattggcgaa acatcctttg acgtctttat      7920
     gtgttgctct atgtccgcct aacgcttgat gtgacccaaa cactttctta caaccatcac      7980
     actcaaaccg ttcctcaact tcacttgaac gggttgggac atcaccatta gccatcatta      8040
     gtaaacagga ggctatgtta tgctcttcct cagatggatc ccaactcgag gatgatgacg      8100
     cagcgtttga gttgatccta cgtttgaagt tagaaggagg gttgatgcca cgccactgac      8160
     gttcagggtg acatctcatg tgtccaaaga gtgccttcag tgacccgaat tgtttaccac      8220
     attcagtaca tggtcgtgcg atttgtgaag catcagggtc cggttgcgtg accggtttag      8280
     gccttggaga agacgaagaa gaaccgactt cgttgttggt gagtttagta cgttttcttc      8340
     ttgggttttg attgtaacta ggaagagtta cattggagga agcaaatggg atatcggaat      8400
     tgggatcgga gtttgaagtg ttcgacatta ttattgagtc tcttactaga gagaagacag      8460
     aaaaactaaa agagaggaaa aaaaaaagta gaagagtggg agttatggtt ggttaagtag      8520
     aagaagaaca agttagtttt catcgacggt ttcttagcag ttacttctcc ctgttttgtc      8580
     ggatttacat ttcttttttt gttttcctca taagttttgt ttttctttca attattattg      8640
     tatttatctt tgttattcga atgaaaaact taacgctcaa tcacaaatta tcaacgtcac      8700
     tacagctata tttaataagt aaaatggaga taagaaaacg taaatgtaac cattccacat      8760
     ttcgaaatca acttctacag atgtacgagg taacaacttc aaatagaatc tgaaagataa      8820
     cagacgaccc aaagtatgta aaaaaggttg tggggattgg gtaaagagga aagaagatga      8880
     ccattgaaaa caaatagtgt atcgatgagc ggcttttcta tccacaagtt cgcgatccta      8940
     tcataaatgt agttatacga attccataaa ttagattact gaaagaaaac acattgttta      9000
     ttctataatt gagaagccag agtggagtga tatcagttca cgaacctgta tgttactggc      9060
     caatactccc caagagtcgt tctacagcag cgttaacgtt accattggtt gcaagcaaag      9120
     cccttatgtt ctctgctctg tcgtagaatc ccatttcttg caactgttgc aactgagtcg      9180
     caaatcgctc ttcaggagga actggaatca aatagacatg tttcagtgga accatctcaa      9240
     tagatatata agaaatcaaa gtatagcccc tagtgaatct aaccattggg ttggtttgtg      9300
     ccacttaggc cgccagcacc aaggctgcca aacatattca tcaataaatc tagtcctccg      9360
     ttattggctg tccctataaa tatttccata gtagtgattt actcaataag caacgtaatg      9420
     aatatacgat taaagtaaag caaaagaaca aaaaaaagca cactgtctaa gtgaactagt      9480
     tgaagccttc atacttcaat tacagataat atagtacctg tcgcagcacc agtttgcgta      9540
     ggatccctac aaagaagatg gattgggaac atgaatagag gttgatggaa atcaagatca      9600
     ctgatatcaa atgttaaagg aaagaaccaa aaaagaacga aaatttttat gctcctattc      9660
     aagtttattt caaggattaa aatactttac agccgttgat aaaggtcact aatgatcagc      9720
     ccagtaaaac atacaagagt tgctgcatta ctaatgattc aacccattta ttacttaata      9780
     taagatagtt caccaccgag agaattacct ggttagctag tgacactatt ttctaaacac      9840
     agatcaaccc aaaatcctat tatgatatat aaaggacatt acctactcaa ctaatgttcc      9900
     aactaaagaa aacagaaaag ggtatccaaa cttactggcc agccgtgttc ctattctgag      9960
     agaaaagtga ttgttgtaga gacatcattt gctaaaaaga ccaaaaaaca atagaaaaca     10020
     ttaggtcgga gaaatttgac tactgaatga tataaaaata attatctgga gagacaacat     10080
     gggcccaact aacctgcatc atctcgggag agctaaactg gcgaaggaaa tcagggttct     10140
     gcatcatttc cctcaactga ggattcatat ctagcatgct tcggagttgt gggttaagac     10200
     tcataagctg gaaatgaagg aaatattaaa atattaaaga cagcctcaca atagctacaa     10260
     tgtctaaaat tcagattact gaaggcgcta cctgattcat gtactgtgga ttggaaagta     10320
     cgctttgcat catctgcgac atagcggggt tttgcagtat ttggctcaat tgagaagcat     10380
     ctggagtcgc accaagaggt gagtccgctc ccagcatacc gagtccacca aggcctccaa     10440
     gcccaccaag accaccaagt ccagcatttg tccttccagg ggcagttgtc tggcctgtca     10500
     agtagcccca caatatgttc taaaatcttt agtgcattac gagtaacagt taaactagaa     10560
     acaaacagcc aagaaactta ttcatagaca aactagtcat aacaacaaac tgtgagaaca     10620
     tgaactcacc aattattact ataatcaata ctattcctga ccagtgtggt aaacataaac     10680
     tttcacttct taaaaacaag ccactcttgc ttttatattt aatatttcaa ccttaaacta     10740
     caagtaaaat cccatatgaa attaagagga tgagaataca gtttcttacc agccgtggca     10800
     ccccaaggat taggaagtgg atttgcatta ggtgtacccg tttcagcatt cggtgccgaa     10860
     atattattag aagtatcgct tccttgtgta gtaaccccct ggtttcccag aagagcagca     10920
     aatggattag agctcgtatt gtttccagca ttctcggaca tagtggtagc attcattaac     10980
     ggttcctgga cattttcata catacgccta agcatgttaa atccctcagg catagactca     11040
     atattactca tagccctatc agtatttctc atcatttcac gcataagctc tgggtttctc     11100
     gccgcttcta gagtttgacg aaggatgctt gggtcattga gcacatgacc aagctcagga     11160
     ttgcgatcta caagctcacg catttgaggg ttattcataa tcatactcct cataaattct     11220
     gggttgttca taagattctg gatggctgga gtattcatca tctctctaat catgttaggg     11280
     ttctgagcta gttgttgctg tgcctgctca agatcaggaa gaccagatcc aaataatcca     11340
     gccatagcat ttccaccacc caaaggatta aatccaaggc cagggaacaa agattcacct     11400
     cctccgaggt ttgagctatc atttgaacca accgcttgag gagcagtggt ttggtttcca     11460
     gcatttgcag cgggagcaga aggagaagaa ggcacaaaac ctcgaaccat atgaacggtg     11520
     tgatcagcct gcaaacctat atataaaatg gtccacagag aaaggaaaca ttgaggctca     11580
     tgatgcaaaa caataaaacg tggaaactat ccaacacaat catatcaaca acagccattg     11640
     atggagaaaa tatacatccc aagaagatac atgatcatga gaacattagg aactctaaga     11700
     atggtatgaa tcaattatcg tatcactaac tacatctcct tattcttccc atagaaggat     11760
     taagcataca tcaaaactca taaaatcatc catgcttctg taaaaaccta acataaatcc     11820
     aatgttccaa ccccctagaa accctatgag attttcagtc aaattaaagc aacggaacaa     11880
     cagaaatgaa acacgaaatg atcagaaaat taccatagct gaggagagtc tgatcgtctt     11940
     tgaggatacg tcccttgtaa atcaaacgct gctgatttgc cggcacatcg ctgttctgcg     12000
     caattaactc tttgaaagac tccaccgtgg aatcgaggct cgtcgtcaca ctaaatttcg     12060
     tgccattgga gcatctgacg ttcacggcaa cagctacgcc ttcagcagtc agcggctgcc     12120
     tcgaatctgc ttcaccaccc attctaattt cagatcctag ttcaacaaat cgcgaaattg     12180
     atcggagaat caaaagctct aaacctagaa gaaaaaatcg tagaagaaga tttgaggaga     12240
     ctcgaagctc taataagtcg gttctgaaga tttcttgagg aaagggatat aaattatttt     12300
     tggtcgaata acaaatgaga ctgcagaaaa ttaaagagtt atttggcccc gaacggccaa     12360
     ttaaatgaga atccagaaat gacttgcgct tcagagaacg tatcgacgac tcttactggg     12420
     taagattggg ccgggtcggg tctaaattga ggcatttggt atatagttca ggaaggaatt     12480
     ggctgtaact tgaatctaat tgaagatgat gaatcaacta attggatatt cctttgcaac     12540
     atgccacttc tctctttggg caatttggtt taacctttga accggatcag aaggaaccaa     12600
     aaatttaatg ggttcaattt cactttgatg tctataaaca tttacagatg ttgtatgttg     12660
     taacaacttg aaataagtta tcaaagataa acacccaaga tatataggtt taagggtagt     12720
     taaagacgaa gagtgaccac tgataacaaa taccgtattg atgcggcttt tctatcaaca     12780
     aagttcacga tcctatcata tataaatttt tatgaattcg atgaatatat cattactgaa     12840
     aaacacacat tcaagctgtt tattctataa ctgagaagcc agatggagag acatcagttc     12900
     atgaacctgt atgctactgt ccgatactcc ccaagagtcg ttctacagca gcgttaacgt     12960
     taccattggt tgcaagcaac gccctaatgt tctctgctct gtcatagaat cccatttcct     13020
     gcaactgttg caattgagta gcgtaccgct cttcaggagg aactggaatc aaacagacaa     13080
     gtttcagtgg aaccatcaca acagatgcgt aagctaaaaa aaatttgtag tctctaacca     13140
     ttggattggt tcgtgccact caggccgcca gcaccaagac tgccaaacat attcatcaat     13200
     aaatccagcc ccccgttatt tcctgtcccc atcagtattg tcattctact attaacttgt     13260
     atacgataca atatctgcta aaataaaaca tacatgaaag caaagagaac taaagagtag     13320
     ctgctatact acgtaacata actaaaccct ttatactact gtagaataaa tacatataat     13380
     atctttaaga gtacctgtgg cagcaccagt ttgccccgca tccctacaga gaagatagat     13440
     ttgggaacat gaatgcggat tgatgaaaat caaaatatgg agattaacac acatagctta     13500
     tgctaaaagg cataatcaaa aacaaacaaa atgttatgag ccctattcaa gtgtattcca     13560
     acgattaaaa tgctttattt atagcctctt tgatagatgt tactagtgat cagcccagta     13620
     aatcatacaa gagttgctgc attagtcatg gttcaatcct tttcttatta tagagatcgt     13680
     tcacaaccaa tctttttagc tagttacaac attgtctaaa cactaaacaa cccaaaaaac     13740
     aatatgtaaa ggacatgtaa atgctcaact ttgtttaagc aaatccaaac aacgaagggt     13800
     tttaacaaaa cttactggct ggctgtattt ctattctgag atagtgattg ctgtagagtc     13860
     atcatttgct gaagaccaaa aaacaataga aaacattagg tttaagaaac ttctttactt     13920
     tgtcccaaaa aaaaaaaaga aaagaaactt ctttacttga aaatagctta gatacaaaga     13980
     aatgtttctt ttgagagact accatgttaa aaattcatat gcatacagac aataggggac     14040
     aaactaacct gcatcatctc cggagaacta aactgacgaa ggaaatctgg gttctgcatc     14100
     atttccctca actgaggatt cgaatctagc atgcttcgga gttgtgggtt aagactcata     14160
     agctggaatc aagggaaaac aattaatata tgttcacaat ggtaaaaggc tcttaagttc     14220
     agatcattct aggcctacct gattcatgta ttgtggattg gaaaatacgc tttgcatcat     14280
     ctgcgatatg gctgggtttt gcaataactg gctcaattga gaagcatctg gagtcgcacc     14340
     aagaggtgaa tccgctccaa gcataccgag tccaccaagg cctccaaggc ttccaagacc     14400
     accaaggcca ccaagtccag ggctcctcgc atccccacca acatttgtcc ttccaggggc     14460
     agttgtctga cctgtcaagt agcccacaat atgttcaatt atatttagtg tattatgagt     14520
     aaatgttaaa ttagaaacaa taagccaaga aaatcatatg caaaaactac acataacaac     14580
     aaattgtggt aactacacta actcaccaat ttactataca caatattgtt cctgaagcag     14640
     agcagtgaac agtaacgtcc atttcttata aacaagccac tttttcattt ataaaatatt     14700
     actgcatcct tcaaaagaca aataaaatcg acaggagatt agaagatgaa aatgcagtta     14760
     cttaccacct gtagcacccc aaggattagg aagtggattt gcattcggaa tagtccccgt     14820
     tccagcattt ggtgtcgaag aattattaga agcatcactt ccttgcgtag tgaccccctg     14880
     gtttcccaac agagcagcaa atggattgga gcctgtattg tttccagcat tcccggacat     14940
     agtggtagca ttcattaacg gttcctggac attttcatac atacgcctaa gcatgttaaa     15000
     tccctcaggc atagactcaa tattactcat agccctatca gtattccgca tcatttcacg     15060
     cataagctct gggtttcttg ccgcttctag agtttgacga aggatgcttg ggtcattgag     15120
     cacatgacca agctcaggat tgcgatctac aagctcacgc atttgagggt tattcataat     15180
     catactcctc ataaactctg ggttgttcat aaggttctgg atggctggag tattcatcat     15240
     atctctaatc atgttagggt tttgagctag ttgttgctgt gtctgcacaa gatccggaag     15300
     accagctcca aataacccag acatagcatt tccaccaccc agaggattaa atccaagccc     15360
     agggaacaaa gattccccag gactcgctcc tcctagattc gagctattat ctgaaccaac     15420
     ccctcgagta acactaggtg cagtggtttg gcttgcggcc ggagcaggag gtggtgctga     15480
     agaaggtgca gagcctctaa ccatatgaat ggtgtgatca gcctgcaaac ctaggtataa     15540
     catgttccac agagaataga atccacaaga atttcaatca ataaggatct acgagaacaa     15600
     caaaagtacc cacacgaata aatcagaaac gatgaagatt accatagctg aggagagttt     15660
     gatcgtcctt gaggatacga cccttgtaaa tcaagcgctg ctgattagct ggaacatcgc     15720
     tgctctgagc caccaactct ttgaaagact ccaccgttga atcgagactc gtcttcacac     15780
     taaatttcgt gccattagag cacctgatgt tcacagccac agcttctcct tcaccactct     15840
     gcggctgact tgaatctccc tctccaccca tttctaattt cggatcctaa tacttaaaat     15900
     aatcgcagag ctcgcgaaat cgatcaggag ccctaaccct agaaaaattc gatagagatt     15960
     tagaagactc aaaagctctg agtcggttcg gtagattgct tgacgaaatg gatcgaagag     16020
     aacaaaacaa gaagacttct gcttcagaga acggatcgaa gggaccgggt cgggtcaaaa     16080
     acaaaacccg gttcgttcct tttctcaccc ggatccgaga atacatacgg catcgtataa     16140
     taatatcatt tatctgcttc gttgaggccc aaagggcttt agtttatcgg tcctgcagta     16200
     tcgtctaact tcatgcatct atgaagactc tgaacgacat catttaattc agaatcactc     16260
     tggcttaact tgtctccagc caaaaacctc tttgccaagt ttccttcacg aaccatgcta     16320
     taacccgcaa cgacccgaac ctttctctcc ttcaccaacc tcctcatcat tgctacatct     16380
     tcccatgatt tttctgcagc aaatgtgctt gacgcaagca agtaacctga agaacacaag     16440
     ggctcgagtt caagaacctc agctactacc tctgaggtaa tgatcaattt tttaaaacgg     16500
     tttctgcaac cgctaagaat cgctccccaa gcactagccc ctgctttaac atcttctgga     16560
     agattcttga taagttccac agccgtatca atctctccag ctcggctaag catgtctaca     16620
     atgcaagagt aatgttgcaa tgaaggtttg tgatcttctt ctaccattga tttgaagatc     16680
     atgagacctt tctttaccaa tcctccatga ttacaagctg ataaagctgc cagatatgtc     16740
     acagcgtttg gtgtgtaacc tttttgtttc atttcatcga acaatgctaa tgctttatcc     16800
     ggtagaccat taatagcata tgctgaaatg atcacggtcc aagagatgat gtttttctca     16860
     gtgatttgat cgaaagtcct tctcgccatt tctatggcac cacattttgc gtatgcgtca     16920
     acaatagagg taccaactga gatgtcattg atggctaagc ttctccggat agcaatccca     16980
     tgtgcccatt tggaagttct caagtccgct gaaactgagc atgcgttaag aagacttatg     17040
     acggtgatag cattgggcgt atccctcatg tgacagaaga ttgagattgc ttcatcggat     17100
     cggccagcat gggctaatcc agagatcatt gtgctacatg acaccacatc cttgtacgtc     17160
     atcgaatcaa gcacggttcc tgcatcatca acaagactgc agcttgtata cgcatcaatc     17220
     aaagaactca aagccacttc gtttgactca tatccacgcc gaattattac accatgtatt     17280
     gacttgcaag gcaatggctg ctcaaaaaac ttgcaaaccc ggagaagact cacgactgta     17340
     acttcatcca cttcgaccgc ctcttgcacc atcaaatgaa acatctcaag agcctcatcg     17400
     tacctttgat tatgtacaaa cccagccaaa atcgaattcc atgaaacaat gtttcgacaa     17460
     gtggtctcat caaatactct aaatgctgaa tcaacatcaa atccttttga atacatatca     17520
     ataagtgaat tgcaaacaaa cacatctgcc aaatcaaaac ctctccgtat cgaaaaccca     17580
     tgaactgatc ttccaacatc aatgtcctcc atcaccgtgc aagccttgag aacacttgtc     17640
     acagtcacac aatcaggctc tgttttcgcc tcatgaacca tctctttaaa caacttcaat     17700
     ccaacaacag gttccttgct ctgcacataa cttcggatta caacactcca agaaataaca     17760
     tctctttcag acatttcatc gaacagttta cgtgcactta aagaatcact atctgcgtac     17820
     atacacaaga tcgaattttg aacagacgaa atcccacaaa acccactacg gatcacatag     17880
     ccatgaatct tctctccatc gaaccataaa ctacgacacg catgaatcac aagaaccaat     17940
     gttgaagtat taggctcaaa accccaaact ctcaacttcg aaaaccacca taacccttct     18000
     tcttcaaaac cataatcgag aagcccaaaa acgataacat tccaagacac cgaatctctc     18060
     gaattcatac aatcaaattc tcgtaaccca gaacacaagt ctccacattt catatagaaa     18120
     tcagcaattg agttccctac agaaacaaaa gactcaaaac ctctctttaa cagacttgct     18180
     tgaatacatc taccttgaaa cagccatgag agcttagcac aagctttaaa aacaatgggg     18240
     aaaacgaaag gatcgttaaa ttgaactcca gctctctgta tctctgaata cccagagacc     18300
     acttcccgcc attttccact aacagaagct tgcttaatct tcgaagacaa agcttgtagc     18360
     tttgaacaca agtgtgatcc cattaccata cttcaaacca caactaaagt ttgaagcttt     18420
     aacaacaaaa ttgtgtgaac aatggcttat atattgatga ccattagtta aaccttttca     18480
     taatctggtt taaccgttta agtagttata ttacacacac caaacactac atactaatac     18540
     aggtacaaca tttgttttct ctttcatgta gtatacatac gaatgggttt tgataatctt     18600
     aacaaataca aaactaagaa aagaatctca gtgtcttcaa acaacactag tgagctcgag     18660
     acacgttttg tctaggacga aacgaagaga gttgttgcgg gcgataatgg ccttgttgtt     18720
     gacggatgga tggggaagct ctagtggtcc ttcgttctaa cggtttctca ttggcagctt     18780
     cgatgagttc gagcgattcc accacttctt tcatcgatgg acggtttttg ggttcgggtc     18840
     caaggcattt cagagccagt tgagctactc ggaaagcaga tttgaaaggg tattttcctt     18900
     ctagacgagg gtccattatg cttcttagct ttcttctttc ggatagatga ggtttgatcc     18960
     attcggttag attgtgttgc ccggtaggac gagtaggatc aagcgcatgt aaaccagtta     19020
     agatctcagc caaaacaacg ccaaacccgt aaacatcgct ctttacatac aagtgacctg     19080
     ttggaaccaa caaacatgtt cacagtttgt tgttggaaac caaaagaact aagaatacaa     19140
     aacattgtag tacctgtagc aacatactct ggagctgcgt aaccgtgtgt acccataacc     19200
     cgtgttgtga tgtgagattg actagcggaa ggtcctaatt tcgccaatcc aaaatctgat     19260
     atctttgcgt tatatgactg catcaagagc aaaccagttg aaatttcaca cttgatgatt     19320
     tgctacatca aatccataag caatctgtat gtacttaccc catcaagtag aatgtttgac     19380
     gctttgaagt ctcgataaat tacttgcttc tctgaagcgt gtaagaatgc taagccttta     19440
     gctgctccta ttgcaatctt aagccttatc tcccatgaga gtggctgaac ggcagacccc     19500
     tctgaagtaa tagaagcaat tacacatcga aacatcgaga tgtaaatgtg catataagca     19560
     aaagattctg attaaagaat gttcttactt cggaagagat gattctctaa gctccctttt     19620
     tgcatatact catacacaag aagcaactct tcaccttcca agcagtatcc caacagcttc     19680
     acgaggtttg gatgagaaac cctcccaaga aaattcactt cacactgcac aacaaccaac     19740
     aaagaatcta tccactcagc aaacaaaact tcactttgta tatcaaagtt agaaaactag     19800
     tttcccatag ttcactttac tcacttgcca ttcttcgaat ccttggaagc tttctgcatt     19860
     cagtttctta acagcaatca cagttccgtt gctttgtttc cctggagtct tgtcttcaag     19920
     ccagccttta aagactttcc caaatcctcc ctctccaaga acattctcag acctgaaatt     19980
     ccttgttgaa gctctaagtt ctgctaagct gaatatcctc aaattcggaa tgggaagtat     20040
     ctgaccatcg gggtaagcat cttcaccact tgccacagag aacccactat tgctagatat     20100
     gttacttccc cttgatgttc ctgtagtcgt cgtgttgttt gatgacttaa aagtccctac     20160
     ttcaattaca accacaagaa aacaaagtca agcccaaaac agagagtcac ataacagatc     20220
     acaaacagca ttaagtatga taatgaatct gattcaacaa aaacacaaga agaacagagt     20280
     cttttaatca aaaggtcaaa actttcatag aacccatacg agataacacc aaaagaagag     20340
     tcacaaacga tacaagaaga tgtaaaagcg taacctttat gcatcaaaca accaagtaca     20400
     gaaattgcaa cgtatcacgc aagtttaagc aaaacccaga tgggaaaatt cagtagatat     20460
     agataggaca aacctgaact gatgttacca gtagaggaag gtgttgttgt tggaggagaa     20520
     tcagatggag atccccaaca aagacccatc ccaacagaga gaaattaaaa gccaaacact     20580
     ttttgcttcc tttacaaata tataacacgt atatgtatgt cttaaacaat tctttgtcag     20640
     gattttacag aagtcaaatg gaaaaacaaa aaatggcgtg tgaagctaaa acagagtact     20700
     ttacaagaaa tgatacaata ttgatggata gagattggac aagtctcgtt taaattgggt     20760
     gtgaatgatt agaaaaaaaa gaaaaaaaat caagaaaaga taaaactttt tttatcttct     20820
     ccaattcgaa gaaatttctt ctgagagatt tatttattga atagagaatt ttgtggtgtg     20880
     agaagcagaa gcaagtggtt tggtgttatc atgggcattg agagaagaga gagagaagac     20940
     tgagtcataa aagaatggtg gtgcaaagat ttgaggaaga ataaggaaag agagaattat     21000
     agaggtttta aaggtcaaag tcaactataa agaaaaataa tttacatgag accaccaaat     21060
     aaagagaaaa caatcaaggc ccctacaatt atcctctgta ttttcttcat ttgaaaactt     21120
     tattttactt ttcaacaagt ctctatacgg ttggattata aatatgttta gattatagtt     21180
     ttaaataatt aatttcactt ttatactata atttaagata gcaaattaat atttactgtt     21240
     gttaaaataa ttgttcaaaa gctatatttt ttatcatgta aactcaatta atattcaggg     21300
     ttgcttacac agatataatt ttctataaaa ctaaatgata attaccattt tcaatcttgg     21360
     ttgatgattt tatgattgat atccatgtat tttctttata taaaatttaa aaaaatgaaa     21420
     gatggataaa tgtccaatta aataaaagta aatagctctt tttgtgttaa aaactattaa     21480
     tctgttttta gaattctttt tcacggcatt ttttggtaaa ttattgtgtc aaaatccaaa     21540
     actgaatatt ttggttacat acaaacaaaa caaaataaag aaataattgt caagttcatt     21600
     agacgtgatg ttggcgtatt aaatagtgga ttttgatgtg aatagaaaga tactcaagag     21660
     aaagatctca aaaaaaaatt gattcaccat tgaaaacttg agtcatcgat tatcacttga     21720
     attcataaat ggtactatag gagatggtga agatgagttc aggcgcgtca taaaccgtag     21780
     taatagtagt aaaaacgaga agaaaacatc gcaatgcaaa tggagacagt aaccaataaa     21840
     acgaagtgaa ggagtaaccc ctaaggttca agcagcttga ttttgatgat aattctacaa     21900
     acaccaacac aagattcaaa caattttatt actaacttgg agattttcca gaaaagttat     21960
     tattccaaac gtttgcaaat tgagattatt tttactactc taaagattca aacactttta     22020
     cttcattatg cctttttttt ttgttttctt cttgtagaac cctgcataat tcttcattca     22080
     ccaatcattt tctattatct ttatgttttc tcttatattc caatttttag ttgaatatct     22140
     ttctagctat atttatcgtt atgtaataac cttttcaaga acacaaagaa attgtacaat     22200
     ctttggagta ccatgtcctt caccctagct cacaaattag ttagtttttg aaacttttat     22260
     atataaacaa catatttcat caaacaagat atatagtcca ttttttatga agatatagtt     22320
     ttaaaatcaa caaatgagtg aaattagaat attaaatggt catagaaaaa gtaaaaattg     22380
     tagtctaata gttgattaag tgtttaattt tttcatctag taattttttt gtgtgattat     22440
     gtgtccaatt aaaaatgttt gtcgtgtgta tatagtgcag gtaaatctat tagtcgggga     22500
     ggcattgtcc ggtataaacc ttgtaaatta atgatctttg gaaagaacct ctaactaatt     22560
     tcaaaaataa acgaaaactt tgataacaaa accctaaact cattgaaatt atcaagcaga     22620
     ggcaaagaga aaaaagcaga tcagtaatct tacgataatt tatcttgtat aaaagaaata     22680
     ggaattatgg tttaaataaa cacttaattg gacacaaatt tgaaaagaat caggttttta     22740
     taattttgat cttttttgtt tttgtttaat ccattcgatt taggatttac tttgtaactc     22800
     tcccaggaag agtgcctata tatttagagt gcatgaaggt aaaattgtca atttgtaaag     22860
     agagggatat ctatctccat ataattaact ccaatttgtg aagaaatcat ttgtggagat     22920
     taatttttat tattattgat tcggaagtgt agaatggcgt accacaaaaa atatatccaa     22980
     aagaggtaga ttgagtacgt gtatacagta tgtagtattc ttgtaaatga acaacatacg     23040
     aaaagctggc caggaaaaat aataacatag aaaacaaacg tgttaagatt tttcaggatg     23100
     caaacaaatc atatgagcat cattaaaata atatgaacac gactacaata atataagcaa     23160
     ggaaaccatt tcacgcgtaa tgcgtcagtc aaagaaccat catcaatata gtttgtggat     23220
     ggaacaattt aaaataaata aaattaaaag ttgatgtgct cttgtgcatg tgttagaaga     23280
     aaaataaaac atatatctgt gtatagggag gaaacaaata attaaagttt tttttgtgtg     23340
     tatttttagt ctcatggtac atgtccaatt agcagtagta attatagatt aaaaatagat     23400
     aattcgccaa aacctttttc taagaaagaa atggcgttac cattaaatac aaggtattaa     23460
     tatatgggat tatttcatta ggaaataatt ttgtgcctca ngattttgta aatagtaaat     23520
     ttgattctga aaatgggatg tataattaac agcaactagt agattccttg aatattgatt     23580
     gaagtgtgtt ttttgaaaat tttgtaaaat ccaagacact agcatagtac catgccatgg     23640
     ccaaaaaagt ttacattttg gaagagattt atagttgttg aattttgaat ataaataggc     23700
     aaatgtttct ttcattagct agggttaaat agatctttta aaaggtttga tttgaacctg     23760
     acgtaaaaga gagtcttgaa tattctttaa caacttccat cgctgcataa ttgccgattg     23820
     agtcaaaacg aactgaagtt tgcttcgata tgtggaattg tggatcctta ccttcttcta     23880
     ggtcttcatg ttggtattac gtagtcatgc ttgctttggt gtgtgattgt gtaggtttgt     23940
     ttcatagatt gatatgatat atgaatatac gatatgctat ggtgatatga tgatatgaac     24000
     atgacatgct atgatgataa ctcgagataa ttaaacgttt ctataaattt tgtttcacat     24060
     atattatgag atagttatgt tgtttttaaa tgtgtattta ctctatacat tcgttaattt     24120
     aatatgttga acgagatggt gtgatccaaa ctgggctttg tttgatcttt aatgtaattt     24180
     ttgggccaac actagttccc atcatataaa atgtatcgac ctttttaata aagtcgatct     24240
     gtatgtaaaa tccacatatt tcgtgaagcc tgcgtgtgtt acggagttac gggctagcac     24300
     ccacggcggg atgggtgaga aaaatatcag cacgcttcga cccgctttta catgcgtgta     24360
     atcagtcata gactcgtacc taagaccgaa tcataaacat gaataatttg ccgaaaacat     24420
     gaattatcta cagtatccaa aaattatgag atagatagct aaatgaggtg aaaaaggcaa     24480
     agaaaaaaaa aggttgaggt aataaatgca gtttccattg acattggtaa tgattgtagt     24540
     tcaaaattgg ggtccttttc ttagctgtcg ttcacaaaca cactctcaat attgtcttca     24600
     gagtcatttt ccttaccttt attattacaa tgcaacacta atttttagta ttacatattt     24660
     gattggtagg agaaccaggg cctcatataa tgggagtaac ctagcatata aatattgttg     24720
     gtattaaaaa agaaaaaaaa acattcatgc tcataagttt attttttcat tttaaaatta     24780
     gacctaaaaa taaacctttt tatattaact agccaaaaat gttgtctgaa tggtcttaat     24840
     aatcttggac catccataaa aagaggcaat gacaaatcga accgctttct tatttatttg     24900
     tcaaatagaa agatgaaatt cggccttaaa ctatgcaaat atttgaaact cgaactttaa     24960
     aatattaacc aactttaata cacttattta aaactgtaag aggttgattc ataattccaa     25020
     taacaatagt atagtttaga gatgactccg atgtataaaa atttgtgttg ccaacgaata     25080
     agattaaaaa ttcgtgtagt taagaggtta tcaaacatag tacatgtaat tttagaccgt     25140
     tttttcatgt atagataatc cgacaactaa tctaattgca agtaactgat aaattaatta     25200
     agaatcttac ccttgtaaga gttttaagat tcgtttctca tttgtcagtt ctcaatccaa     25260
     cgaacttata atatcatttg tcttttccat aaatactgat gacaactaaa gttattgtta     25320
     tcgtacactt acatttattg aaacaccgat tatactagta ctatttaata atgcagaaaa     25380
     tgaagaaaaa atatctaaag aattttgaat tcaaactttt tcacttcccg aagtgtacat     25440
     taaaagctct taaacattac caatactgtt gaaataaaca aaaaagtgag tgtgaaaatc     25500
     aaagattcat tcaaattcac cacaaaaaca gtataaaagc attctttaaa ctttatatat     25560
     ataagaaatc ataaagtaaa ataatgttac acttctaaaa cctaacgagt tatttcatca     25620
     ttatctcagt gattaccaca aatcaccatc attaaccttc ttcttcgttt ttttagtcga     25680
     cagagttagg accagagcaa gctttcaaat tagggttcca aatccattga actaaaaact     25740
     ttcttcctcc tttaccattc atattaaaag tcttcccttc tctatctctc ataacttgac     25800
     caatataccc tcctcctccg ccgcttccgt acaatccctc acacaaatca ccgatctccg     25860
     tcggagccgt cggatcttct ccggcgtacc aagcattaat caacggattc gatacaactt     25920
     cagctaactc atgaccaatc acactaacca tcccatctac tccagtctct ccgttcggtg     25980
     gccggagctc tccgggacca ccgtgtccca tgtaacccgg taaagcaaat ggataagcac     26040
     aaacctcggg acattgtttt cccgattgac caacccaagc gtaaggcata gtgtaaccaa     26100
     ccatcgacgg gaaagtgaaa tagtgaaatc cacaaacggc gcggcaaaaa tcttgcatcg     26160
     tgacgtcgtg tgacgtcaga actagataca ttccgttttt atgatccacc ggaaaggaag     26220
     cggatctggc ggcggaggcg atgacttcct gaatcgtgag acgagtaagg tgttggccgt     26280
     gggagtattt agaatcggag tattctccgg cgattaaaac ggatctagag acgttggatc     26340
     cggtttgatc tgtgtagaga gaagcggtgc gccaccattc ggagacggag ggagaaggtg     26400
     ctttagcgtc ggagatagaa ttgaggaaat ctctgattag ggatttgtgt gggcgtgacc     26460
     attgtccgta ccagataacg tagatgttga tcggagaaga tgagaggact ggtcccatgt     26520
     ggtaacggag gtggactaga tttgaagatc cttcgaattt tttggaggat gtgagggaga     26580
     gactccgcgg cggaagcttt gggtttacta gcgtaatctc cgccgcggcg gaggggatat     26640
     ttaaggagtt aacggttgct gtgtgtttgt tgttgttgtt gttctggagt gaagaagtga     26700
     tgtagaagaa ggatgagaga gtgaagaaga aaaagaaggt gatagtagtc gccggagacg     26760
     acattgttaa tggttaagag tgagggtttt ggcaagtgaa gaagagattg agagatttga     26820
     tgattttaaa ggagaggaga aagaatgaga gggaaattgg ctgttgccag ctgcagtgag     26880
     cgtgggcttc acgcgctagc cttgttgttg tttgtctgtc ttcttctctt ggggatgaca     26940
     taaatttggg atgggatttc tcaatttttg agttctttaa aaaatataaa attataaagt     27000
     gatactataa tacagagttg aagaaattaa atttgtaaag attattacta tgatgtttat     27060
     taacttgaag cgaatttgtg gaaatgaaag tgataaattt tatattcgga tatagtgcat     27120
     ttttagtatg aaaatgggag aggggaattt ttataagtga aaatatatat atatatatat     27180
     atatattttt ttgaatatga gaaggttctg aggcaaagtt cgtaatcctt ccatgtccga     27240
     aaccataaca tgtaatatta gtttagttca aagcgtcatt cgaaccgacg acctctaagc     27300
     tttgcttaag gttttattat caaaatatta aaaaagctga tgtaaaaagt atttgaatat     27360
     agtttaacat tttattaaaa agaataacac acgcaatatt tgtactaatt agaagcgatt     27420
     ataaataaaa aaatgtacca tattttttta taaaaaattc tctatgaaaa tctgaaaaaa     27480
     acctgatttt gttataattt attaatgtaa aaacgtcatt attaaccata ttttaaaggc     27540
     tggaagcaaa tttgttagac aagtggtttc ttattatgat tagtcacgaa ttgggtaata     27600
     cgagatatgt aaccgaagta tttgctttcg atcgatattg aaatggatgg taatggatat     27660
     tgttacatct atttgattcg aatattttag ttctcgttga aaaatgataa tcattatttt     27720
     caatcttctt ttagctttga cagccgaaaa agaaatatct actactcttt tactcttatc     27780
     gaacttaaat atctaagtta aatgcatatg ttggctttct ttctctatgt tacttctttt     27840
     tgtcactgac tatatggaat taaaggcaaa gtttattgat ggagaaaata tcttacggtt     27900
     tttttattga gacttttgtg tcttaatgca tgtctttttc tttatttata catttgagtt     27960
     tttgttttct tccaaagcga aatcacatgt ttggcagtat ctttgctaag tacttagatt     28020
     tagagatatc agatttgtat ggaaaaaaca aataatcaac ttaaagagat ttagatttat     28080
     tttattatca tatgtttaag aatagtagaa ctaaaaactt tgaatcaagc taaaactcaa     28140
     aagttcttat tgttataact tattactatg aaattctatt aatatgtttt tcttttaaaa     28200
     ataaaaaata aagtgacaag tgacaacatt aatttggggc cgtagattta tgttggtaat     28260
     aaattggcct ttttgaatgg tggtccatca ttatctatgg ttatcttgct acattcgaat     28320
     cttaagacat gtataaaaaa tacacacacg aaaatgtgtg tagttaatca gaaattggca     28380
     cacgatttta gatgttactc tattgccaac tgtgtaagat gttgggataa gtaggccagc     28440
     tacttggttc cttgttagca cgaagcggtg atccaagttt tgttactgtg ccacacatac     28500
     actcgttagt cttatggact aattagctaa ctagtctaat tttcaagatt ttttttggaa     28560
     aatcactatg cacagaatgt ggtttacaaa ttttcacaat tagcatcata tattgtgcat     28620
     agtaacttta tttgttggtt gtgatatcga tattttatct acaaaattaa aaaaaaaaat     28680
     acgaagagtg gttaaaaatt ttaaagataa aaaaacgtaa gtcagaagaa gattttcaaa     28740
     acaataatgg tgaaggaaag tgattagaaa gaatgaacaa ggtggttagt cataggccct     28800
     agctattgtc cgcaaagctt agtatttatg ggccacccaa taaaagcctt taaaagccca     28860
     ctatcaaaac gcaaacgcag cagcataaaa ctttcttaga acctgtcacg ataattcttg     28920
     gttggtggat aatagattta gctccgtccc ggagaaccat ggcgtcgctt tgctctgcga     28980
     ggttccttcc ttctccatcg ctcgatattt tatctacgaa gacgaagata tcctccgact     29040
     cgcgctcgct tggttgctct tcgtcgcgtg tctttgcttt ctcttccgtt caccgttctt     29100
     cttcgcgtcg caatcggaat cagctgcaag ttgtgtctat ggctcctgag gaagaaaagc     29160
     tcactcgtcg taatcctctc gatttcccaa ttgtaagttc ccccgggtcg ggtcgggtct     29220
     tatttcggat cttttaattt ccagtttcac atttctattc gttgtggtaa tagctccgat     29280
     tgagaataaa taggttttgg tttagagttt gtgatttgtt ctacattttc tatgttcctg     29340
     ctgtttatga atctacatgt gttaactgtt aaatcaattt atacaagtgt agagaaaagc     29400
     tttgtattca tggctccaaa gtgatttggt agctcttcat gtgttttgtt tggattaggt     29460
     gggattagtg atcattgttt ctttatagaa tatgaatacc cgagaatcta cttagaatca     29520
     taatgctttc ccttgttatg ttctttacga gtctcgcgat gttaattatg ttgtgatcta     29580
     cttgttagga gtgggaaaga cctaaacctg ggaggaggcc tgacattttc cccaagttta     29640
     gccctatgaa gacaccattg ccaccaccga tgccttatga tcctccggaa gaggatgaag     29700
     aagaggaaga gaagaaagaa gaggaagaag aaaacccaga ccaagaagaa gaggaacaac     29760
     ccgagaagca gcaatagatt tttggttgga gataagaacg aatgaaacat cgagagatat     29820
     cgaagagcat tttttgtttc aacttttgta gtgttttgga ggagaagaag aagagtcaat     29880
     cttttctcac atttagttgc tagatttaat ctcatactcg tgttcgtgta ttatatctgt     29940
     gtaatgccac agtttcagaa gctatgttat cctttcgaaa ttcgaacctt ctttgtgtaa     30000
     gtagacagag ggtttaacta atctctcttt ctccttacac tttgtatgtt gaaatatagt     30060
     atcacaaaca ttctttagtg gttatctctg agtaaacgaa agtatcgggc caaatttgat     30120
     cttttacatg atttgagggg tatatccaaa attaacctta gttaaaaatg aaaaaacaaa     30180
     tgtttgggcc aaatctcgaa atgttacact acttggggtt taaacataat ataatgtttc     30240
     gtgagtttaa cacgaccacg ttttgtttgc aagttaggtt ttgttatgcc tctctcagct     30300
     aaacccttct tcttcttcca ccgtctccgc cacgaaccag agaaagctca acaatggcgt     30360
     caatcctctc aaagaagcag aagaagaacg aaaaatacac cttgaaagag ctcaaatcat     30420
     taggtcatga cttactcact tctcgatctc acatcaataa ccttcctctc cttctcacct     30480
     tcgtctcacc agaatctccg ccgcagttcg tcgttgaatc actcctctca ctccaatcct     30540
     ttttcactcc tctactctct cagcttcctc cgacttcttc gtctccttct tcaaccaaaa     30600
     cagaggaccc tgaagttgtg ttcaaagctt ggctcagatc aaaatttgac gaattcgtca     30660
     agcttttact cgatgttctt gtctctcaac aatcagaaga ttctctaagg gtaagatttt     30720
     tctatctatc ttctctgcgt tctcttgaag ttacatagct ttgttatttt ttgttaccta     30780
     atgtttttgg ttgatttagg gaattgtgtt gggaacatta atggaatttg taaagctttt     30840
     gaatgctgga aggtttcatt cttcaatcta ccacagatta cttgatgcta ttgtaagttt     30900
     agtctcagac ttcttcttta cgaaattgtt attgcaagtg cttgatgttc ttactattgt     30960
     tcactgtaga ttcactctga ggttgatatt gagatattct tggatatact tacttcaaag     31020
     tacttcaagt acattgatgt ccggtatgtt gataacactt cgagtttata tgttctttcg     31080
     cttgctatta tttggtcatt tgagatttga ctcgagatat cgattttgtg tcagctattt     31140
     tacatacatc agcatggaaa agtttgtgaa aacattggaa gcatcagtgt ctggtgcgtt     31200
     ttattctttc ttgacattct ctctttttaa tcgtcatgat gcataatgca agtttttatt     31260
     tttgtgttac tcttagctga tagaactgtg atcgaaaata atgaggctga gagtgattca     31320
     aaagaaaggt tagtatcagt aaatgtgtaa tctttctttg tatatcttat atttgttgtt     31380
     tttcttccaa gctgtttgaa tgtaatctta agctggtttt taaagttatt gtgttgttgg     31440
     tgatctataa aaattgtgaa ttgtagccta gaactctctg ttcgcaagat ctatcaagtt     31500
     ttatctcaaa tcccacctcc tgagaaacaa gctgagaagt ctcaacacga gatgtggagt     31560
     gggtcaggtg attgtttccg agattttcca attttgtgga aaggactccc tatgtgttta     31620
     gatttgctaa taagagttat tgtgcagatg aaagtattag tgagaagccg acagataaaa     31680
     agaagaaaac tgagaaagga gacagcactg taagtttcca gttgcaagtt tgctgaatat     31740
     actgaatccg taatctgtga ataggttttc ttcctggcat ggaattcctt acatttgcct     31800
     ctttatttat tctgttaaaa ctccagctcc tttctccggc aacaattagc aagaggatga     31860
     agttgaagtt cactaaagca tggatttcat ttctcagact gcctcttccc attgatgtgt     31920
     acaaggaggt aaacccattt acttttccaa ctaaccattt gtctggaata tggattggat     31980
     gaagaattac caatatatta tcttctgata accaggttct tgccagtatt cacctgacag     32040
     tcattcccca tctatctaat cctacaatgt tatggtgggc aaatttacca aagcttttat     32100
     catttctgta tatgtgattg tccttcaata agcgcttact tatgtttcac cgtactttgc     32160
     agcgactttt taacaaaatc gtacgacatt gggggtgttg tcagtgtgat ggctcttagc     32220
     agtctcttca tcctcatgac ccaacatggt ttggagtatc cgttctttta tgaaaaactg     32280
     tatgcgttac tggttccttc tgtctttgtg gcaaagcacc gagcaaaatt tcttcaggta     32340
     ttgccatatt tgagtaaccg atcaatgact gattacttta taatatgtta ttcttccctc     32400
     tatatctgaa acgctttctg cagcttcttg acgcatgcct gaagtcgtca atgcttccag     32460
     catatctggc agcttcattc acaaagaaac taagcagatt gtcactttcc attccccctg     32520
     cgggatcgtt ggtcataaca gctttgatct acaacctttt acgaagaaat cctacaatca     32580
     accatcttgt gcaggtacgg cctatctttg ttagtgcaaa gaacatatta acagatgaaa     32640
     atgacgtctg tataatacca ctcacaacta cgcaaaataa tgtatataaa agcatggact     32700
     tacaaagagg tcactcttgt tcaggaaatc gttgaaaatg ccgatgaagc caacacagag     32760
     gctggtgaac acaatgagag ccaaccaaag accatcaaaa agcgaaagct tggtattgac     32820
     tatttcaaca accaggagag tgatcccaag aaatctggag ccttaagtaa gtcgttaaca     32880
     ttctattccc agtctttttt atttttcctt tccatgcccc tagcacaaaa tcacacccct     32940
     atgtagaagc ttgattcatc caacaaaaaa caatgatgtg tatgctttca gatttcctga     33000
     tttgtacttt cataacagcg gctttgtagc ataattagat ttattagttt gataagaaat     33060
     taagaatgcc aaggttctct agattcatcg ataaattcaa aaagtaaagt tttaactgct     33120
     ttgaaagttc aagaacaatg tgttgttttg ccttctgtaa gttgttagct tgttaaataa     33180
     ctttgtaatc taactgatga atgatgatat tcgttttact ggaaacctac agaaagttct     33240
     ctttgggaga tcgacacttt gcgccatcat tactgtccac cagtttcacg gtatatttgc     33300
     tcaccaaaca attttatccg atttttttaa aatttttaca tttggtcatc tccttgatac     33360
     ctcttctcac ttttgtaggt ttatctcatc tctagaaact aatctaacca tcagatcgaa     33420
     aaccacggaa atgaaaattg aagatttttg ctctggttca tatgccacca tatttgggga     33480
     cgaggtaatg ttgctctggt tcatatgata tcaactcttt gttgagaaaa aatcagttga     33540
     ctttggtctt ccatttatag ttgggaaact gtaaccattt gctgaactaa ctgtggagat     33600
     ttgaaaaatt ggcagattcg gagaagggta aagcaagttc ctttagcgtt ctacaaaacg     33660
     gttccaacat ctctgtttgc ggattcagat tttcctgggt ggacgttcac tattccacaa     33720
     gaggaaggca catgctgatt tctaagagta accaactcat gaactaaaaa aactgcaggc     33780
     tattcgaaga tttgtgctac caaattttgt agttttgata ctgaatgtgt cacatacttg     33840
     attttgaggg aaaacaattt ttgatagaaa ttttcggccc atgaaaacga gtttccgtcc     33900
     aattcgtata tcggagtaag agatgggaat tgtgagaacc atgaaaacac ctggaaagaa     33960
     aaagtctaaa gaaaaggtag tacgcacatt ctagttttga aaatagttaa attgtttgac     34020
     atcatactta ggaaaatagt ttacatcttt aaagtattaa aatagtataa gatatattat     34080
     tttaaattct aatcttaaca ttcttaaatg atgatttttg ttttcattca taggcaaaat     34140
     atgagttttc gttcactaat tggagtgcat tgataaatga taataaattg gagttttcgt     34200
     tcacaacttt atatatatgg tccaaatttc agtggagact ccacacaaat tccaaattat     34260
     tcctttgcca ttcaactttg tttgtgcatc attccaaata ctactctcaa ttccctttcg     34320
     ttaatcattg cattctttta ttcgtgcgtt actaacacca ctacactatc tacgaacaac     34380
     accaattgtg cataatgtag ttggagtttt tctaaaaaaa ttatatatat agcaaattga     34440
     atatcatcaa aagtcactca aggaaatcat ctttaatcga tagatatgtt caagggttag     34500
     ttaaatatat gtacatatga gatgatataa ttaagaatgt atatatggaa agttgatatt     34560
     taggtgtaat aaaacgtgca aatcgaatat gcctatttta atcctgttgt tctgacatac     34620
     atttagtgta taattatttt gttagcatgc taaactagca tataacgcat tatcgaaata     34680
     atatcgttag cgaaatatgg atggggtttg ctctatggat gaaatgatgt agggtacaaa     34740
     ccaacttaat atgttaataa tatatttgac gatataaaca aattttctgt tattgaacca     34800
     atgattagat ttcaaagact gatatatatg cgaaaacgat aacattatta ttaaaaggta     34860
     acaaaaatat ttgcatgaag agcaaaaaag ttgacttgca actcaataat catgtaaaaa     34920
     agtacatgca ttagaatagt tagcagataa cgtattatca ggataacatg ataacaaaat     34980
     ctcggtaata cttattaggt taacatgata acaaaatatt tatataaata agtttataat     35040
     tatatcatgc taagtcattt tgtatcgcga taagttgtaa cttatgtgat atatttatat     35100
     ttaccgtctt aactcattta ttatattata tataaaaaat taacgattta gtataacgtg     35160
     caaaatatga atttcatcca ataatattaa tattatcact acatttaaat aaaattttag     35220
     ttaactcggt aatttgattg ttaaccaatt tgggataaaa aataaaagat aaaaaaatat     35280
     agggataatg atgtaatttt ctttagtaat gtactatgta aatagtgaca catttgtgtc     35340
     agttaatttt ctctgttatt ctatgtatac ttcttataaa taccttatgt tcaatcgttt     35400
     tgagtcaaga aaaaaaaaaa cagaaataaa aaaaaacatt tggtcaatca tctttactca     35460
     tttgggtgaa cagaacaaaa aaaagaaaag aaatcagtgt tttgacaatt cttct          35515
//

If you have problems or comments...

PBIL Back to PBIL home page