(data stored in ACNUC5340 zone)

EMBL: AC022457

ID   AC022457; SV 8; linear; genomic DNA; STD; PLN; 162339 BP.
XX
AC   AC022457;
XX
DT   04-FEB-2000 (Rel. 62, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 12)
XX
DE   Oryza sativa chromosome 10 BAC OSJNBa0006L06 genomic sequence, complete
DE   sequence.
XX
KW   HTG.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-162339
RA   Buell C.R., Yuan Q., Ouyang S., Moffat K.S., Hill J.N., Burr P.C.,
RA   Hsiao J., Zismann V., Pai G., Bowman C.L., Fujii C.Y., VanAken S.E.,
RA   Bowman C.L., Craven B., Utterback T.R., Khalak H., Feldblyum T.V.,
RA   Quackenbush J., White O., Salzberg S.L., Fraser C.M.;
RT   "Oryza sativa chromosome 10 BAC OSJNBa0006L06 genomic sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-162339
RA   Buell R.;
RT   ;
RL   Submitted (03-FEB-2000) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RP   1-162339
RA   Buell R.;
RT   ;
RL   Submitted (30-MAR-2001) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA, rbuell@tigr.org
XX
RN   [4]
RP   1-162339
RA   Buell R.;
RT   ;
RL   Submitted (10-APR-2001) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA, rbuell@tigr.org
XX
RN   [5]
RP   1-162339
RA   Buell R.;
RT   ;
RL   Submitted (28-APR-2001) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA, rbuell@tigr.org
XX
RN   [6]
RP   1-162339
RA   Buell R.;
RT   ;
RL   Submitted (04-MAY-2001) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA, rbuell@tigr.org
XX
RN   [7]
RP   1-162339
RA   Buell R.;
RT   ;
RL   Submitted (04-SEP-2002) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA, rbuell@tigr.org
XX
DR   MD5; 5022bfab8fd9257ad269f5d0fe8faf0f.
DR   ENA-CON; DP000086.
DR   ENA-CON; AP008216.
DR   RFAM; RF00885; MIR821.
XX
CC   On Sep 4, 2002 this sequence version replaced gi:13357269.
CC   Address all correspondence to:rice@tigr.org
CC   BAC clone OSJNBa0006L06 is from Oryza sativa chromosome 10
CC   The orientation of the sequence is from SP6 to T7 end of the BAC
CC   clone.
CC   Genes were identified by a combination of several methods: Gene
CC   prediction programs including genscan and Genscan+ (Chris Burge,
CC   http://CCR-081.mit.edu/GENSCAN.html), GeneMarkHMM (Mark Borodovsky,
CC   http://genemark.biology.gatech.edu/GeneMark/), Fgenesh
CC   (http://www.softberry.com/), and GeneSplicer (Mihaela Pertea and
CC   Steven Salzberg, contact mpertea@tigr.org), searches of the
CC   complete sequence against a peptide database and the plant EST
CC   database at TIGR (http://www.tigr.org/tdb/tgi.shtml). Annotated
CC   genes are named to indicate the level of evidence for their
CC   annotation. Genes with similarity to other proteins are named after
CC   the database hits. Genes without significant peptide similarity but
CC   with EST similarity are named as  unknown  proteins. Genes without
CC   protein or EST similarity, that are predicted by more than two gene
CC   prediction programs over most of their length are annotated as
CC   hypothetical  proteins. Genes encoding tRNAs are predicted by
CC   tRNAscan-SE (Sean Eddy, http://genome.wustl.edu/eddy/tRNAscan-SE/).
CC   Simple repeats are identified by repeatmasker (Arian Smit,
CC   http://ftp.genome.washington.edu/RM/RepeatMasker.html).
CC   There is a small sequence gap (less than 500 bp) between 2096 and
CC   2320. Closure effort for this BAC is still continuing.
CC   This BAC overlaps with rice BAC OSJNBa0071K18 (AC027038) and
CC   OSJNBa0079L16 (AC026815).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..162339
FT                   /organism="Oryza sativa Japonica Group"
FT                   /chromosome="10"
FT                   /map="R2825"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="genomic DNA"
FT                   /clone="OSJNBa0006L06"
FT                   /note="japonica cultivar-group"
FT                   /db_xref="taxon:39947"
FT   mRNA            complement(<325..>816)
FT                   /gene="OSJNBa0006L06.29"
FT   CDS_pept        complement(325..816)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.29"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV90"
FT                   /protein_id="AAK27826.1"
FT                   /translation="MGMKKRRRLLGDDDDDFALNEGLYMALECGALTAGHPDADRLVRA
FT                   WLAVSRRRHALVRRLVGLLEDSYGDGSDGDGSSWPWNRAAHRHCPLGVEKRRRVKSLLI
FT                   LVSWEIWKERNSRVFQSIETTPCGIIDRATEEIWLWRAGGAESIQSLMPDDRGSTTNNL
FT                   "
FT   repeat_region   complement(1638..1678)
FT                   /rpt_family="AT_rich"
FT   misc_feature    1880..1890
FT                   /note="represents low quality reads."
FT   repeat_region   complement(1909..1931)
FT                   /rpt_family="(G)n"
FT   repeat_region   1963..2025
FT                   /rpt_family="(CGG)n"
FT   misc_feature    2096..2320
FT                   /note="less than 500 bp sequence gap"
FT   repeat_region   2486..2561
FT                   /rpt_family="(CGG)n"
FT   repeat_region   2601..2639
FT                   /rpt_family="(CGG)n"
FT   repeat_region   2666..2781
FT                   /rpt_family="(CGG)n"
FT   mRNA            join(<5268..5967,6173..6336,7132..7317,7814..>8050)
FT                   /gene="OSJNBa0006L06.11"
FT   CDS_pept        join(5268..5967,6173..6336,7132..7317,7814..8050)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.11"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9AV89"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV89"
FT                   /protein_id="AAK27798.1"
FT                   /translation="MMCEMTKLPLVPFSHVQSRGGADVCGDSFPGGNNGLRGRQRCSGG
FT                   DHDALSTSAKATSDHLAASGCGDVHGHSLFFFAPPSLLPLRHRRGPSLVPGRQRCGGAR
FT                   GAPHRMPLLANGPTLWYQLDDDVAGLRELLAACPSLADEPAPWYSLARGTEPLTPLMVA
FT                   TAYGSVACLDVLLSPPYLVDPNRASASSLSTPLHLAAAGGATSTPTSVSRLLAAGTDND
FT                   NDEVEERQGEEGRARNLQKLSDNSGEFERGSVDLQMIRFEELLVFFFSFGFMGYFSLLL
FT                   LKPYQILGNKPKFSTLKGGDGMRDPSLMHMGGPHCTSSISDDHEELSSISGVFSMPSSR
FT                   PYNVPPLHAGASQIHLIKEKQQEQQIRRAQTPIRKTLACAETSRETPSFCLIASQGRHP
FT                   TLSVHSPLRVSDDELTSDNDRPLLQATAA"
FT   repeat_region   7344..7489
FT                   /rpt_family="Explorer_Os1 MITE element from gb:M80938 Oryza
FT                   sativa 16.9 kDa heat shock protein gene (999 to 1178) 180
FT                   nt"
FT   repeat_region   complement(7365..7392)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(8553..8643)
FT                   /rpt_family="(CGG)n"
FT   repeat_region   8921..9072
FT                   /rpt_family="(CGG)n"
FT   mRNA            join(10326..11060,11143..11353,11442..11552,11647..>12435)
FT                   /gene="OSJNBa0006L06.1"
FT   repeat_region   complement(10335..10370)
FT                   /rpt_family="AT_rich"
FT   CDS_pept        join(10564..11060,11143..11353,11442..11552,11647..12435)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.1"
FT                   /product="putative amylase"
FT                   /db_xref="GOA:Q9AV88"
FT                   /db_xref="InterPro:IPR001371"
FT                   /db_xref="InterPro:IPR001554"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AV88"
FT                   /protein_id="AAK27799.1"
FT                   /translation="MALNLAQSAAAAACFATAGDARRAASVVAMPSSSSSATTSLRMKR
FT                   QAACEPVACRAVARHVAAAAASSRRNGVPVFVMMPLDTVSKCGSALNRRKAVAASLAAL
FT                   KSAGVEGIMVDVWWGIVESEGPGRYNFDGYVELMEMARKTGLKVQAVMSFHQCGGNVGD
FT                   SVNIPLPRWVVEEMEKDNDLAYTDQWGRRNFEYISLGCDAMPVFKGRTPVECYTDFMRA
FT                   FRDHFASFLGDTIVEIQVGMGPAGELRYPSYPESNGTWRFPGIGAFQCNDRYMRSSLKA
FT                   AAEARGKPEWGHGGPTDAGGYNNWPEDTVFFRGDCGGWSTEYGEFFLSWYSQMLLEHGE
FT                   RVLSGATSVFGDGAGAKISVKVAGIHWHYGTRSHAPELTAGYYNTRHRDGYLPIARMLA
FT                   RHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQVAAAARAAGVGLAGENALPRYDGTAHD
FT                   QVVAAAADRAAEDRMVAFTYLRMGPDLFHPDNWRRFVAFVRRMSESGSPREAAESAAHG
FT                   VAQATGSLVHEAAVALRS"
FT   repeat_region   complement(12123..12163)
FT                   /rpt_family="GC_rich"
FT   mRNA            complement(join(<13871..14339,15075..>15388))
FT                   /gene="OSJNBa0006L06.3"
FT   CDS_pept        complement(join(14082..14339,15075..15311))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.3"
FT                   /product="60S ribosomal protein L21"
FT                   /db_xref="GOA:Q9AV87"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV87"
FT                   /protein_id="AAK27801.1"
FT                   /translation="MPAGHGLRARTRDLFARPFRKKGYIPLTTYLRTYKIGEHVDVKVN
FT                   GAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIRKRIHVRVEHVQPSRCTEE
FT                   FRLRKIKNDQLKADAKARGEVISTKRQPQGPKPGFMVEGATLETVTPIPYDVVNDLKGG
FT                   Y"
FT   repeat_region   15343..15364
FT                   /rpt_family="(CGG)n"
FT   mRNA            join(<16158..16289,16385..16474,16590..16667,16816..16890,
FT                   17123..17175,17830..17980,18204..18320,18429..18555,
FT                   18667..18770,18896..19031,19429..>19445)
FT                   /gene="OSJNBa0006L06.12"
FT   CDS_pept        join(16158..16289,16385..16474,16590..16667,16816..16890,
FT                   17123..17175,17830..17980,18204..18320,18429..18555,
FT                   18667..18770,18896..19031,19429..19445)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.12"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9AV86"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV86"
FT                   /protein_id="AAK27804.1"
FT                   /translation="MPLLLRCSPAASPPLLPRRRSGSLLSAAPPGRRPLLPAAAGRVVL
FT                   GCGLVTLDYLATVDAYPRPDDKIRSGELQVSGGGNAGNALTGAARLGLNTRLISKVAND
FT                   EIGGTVLSELKEAGIDISHVIISDGGNTTFVYVIIDKQTKTRTCIITSGYPPMIPSDLR
FT                   MSSLSAALQDVSLLYLDGYSDEMALAVAKQADQMKIPILVDAEPERTREELGGLLSLAS
FT                   YIVCNGKFPEKWTSVPSIPSALLEILLQYPRACFAVVTLGENGCMMLERGKDGENYETE
FT                   PVDIENVAESLRLKVDKDDILPTCVSSKFMRLTARGSGNIFARLLIGTAESIPASELVD
FT                   TTGCGDAFIGAVLHGRHQM"
FT   repeat_region   complement(16160..16276)
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(20613..20671)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(<20856..20896,21193..>21433)
FT                   /gene="OSJNBa0006L06.13"
FT   CDS_pept        join(20856..20896,21193..21433)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.13"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV85"
FT                   /protein_id="AAK27807.1"
FT                   /translation="MSRCGPRQQQVVGKWGGGPGRMALSYGARQTCYIVRGKVTATATA
FT                   AASAAEGSPENGRRVEFGAGDIVVFPKGTRCTWHIAAAVDMHYAFDPS"
FT   repeat_region   21265..21302
FT                   /rpt_family="(CGG)n"
FT   mRNA            complement(join(<22106..23577,23675..23761,24266..>24628))
FT                   /gene="OSJNBa0006L06.4"
FT   CDS_pept        complement(join(22366..23577,23675..23761,24266..24628))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.4"
FT                   /product="unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV84"
FT                   /protein_id="AAK27810.1"
FT                   /translation="MDVVDISSDEEGFAAAAVAVATTTKKASVDSLGWIADLLREEDER
FT                   ALSDEFDDLEVMSELSAPPVMAQQKGGKPDCGGEEDDDDCVVLDGDPDDVVAVAGEKGS
FT                   EGDGSSDELQIVAEKGPVACRDFPHSRHLCSNLPFSTTSHVKYCSMCHCFVCDTPAPCN
FT                   YWGKGTEIYDHCHATDKEKKWKAMRHTFKSKGLPTSHPEKRQNVVYPTTTSFVQQDTQC
FT                   EISLIQSHMTTYFPNQSHLANVVNQGLTQTRHTSVRVSPSVGRTVSATRTTPATRAGRG
FT                   MSNAPSIQIPQSRTRFKRVGATSPGIVTLNDNQFGSAAPNNTQLHQPSSPHASQPAQVA
FT                   PRTLFGTVQKNPPQRSLSAPIALQGQQDQSASSYQAASNGTHGTGPQFSRCISLTAQRT
FT                   QLLPEPALDVYSKSWQDIIDSLASDLEVPDYNMGAAESQQPDRTISQPLDSITFQGVGL
FT                   HSEPVVALANLMPCNGQNVANGMIGSNCLAQTTQILPHLNHQPSLVPNESHLNNSVSST
FT                   ADGLLMEAAHQRDTQGSDSLDLLFDFEFEDWDSAEP"
FT   repeat_region   complement(25355..25383)
FT                   /rpt_family="(A)n"
FT   repeat_region   complement(25838..25861)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(25978..26010)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(27526..27563)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(<27990..28081,28462..28482,28675..28785,29172..29264,
FT                   29349..29467,29997..>30124)
FT                   /gene="OSJNBa0006L06.2"
FT   CDS_pept        join(27990..28081,28462..28482,28675..28785,29172..29264,
FT                   29349..29467,29997..30124)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.2"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV83"
FT                   /protein_id="AAK27813.1"
FT                   /translation="MVHRFFSCTGATRPPAPENADITLVSGPSCWVLIYHTAYIEDDEG
FT                   IRKYFAAFHLLGSFPAAVIIDDFADFFSERSCQQRYGNARARDLAVVRILALCQNAVAH
FT                   ANTKLGVPGSCNLLLSDVHQGDTPRSMFIYKRWISSIYTIQGDGHGSYILKSISSSDCG
FT                   SREGRAAKYSIALQYLVLEHISNG"
FT   repeat_region   complement(30809..30829)
FT                   /rpt_family="AT_rich"
FT   mRNA            complement(<31347..>31814)
FT                   /gene="OSJNBa0006L06.28"
FT   CDS_pept        complement(31347..31814)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.28"
FT                   /product="putative ribosomal protein L11"
FT                   /db_xref="GOA:Q9AV82"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV82"
FT                   /protein_id="AAK27825.1"
FT                   /translation="MATTLKDAVARKPVLATIRLIVPAGAARPAPPVGPALGFYRLNLM
FT                   AFCKDFNARTQKYKAETPMQVTLTAYKDSTFEFVVKSPSVSWFLKKAAGIETASGRPGH
FT                   TVVSSLSLRHVYEIAKLKQSDPYCKHMSLEALCKSIIGTANSMGIEIVKDL"
FT   repeat_region   32555..32597
FT                   /rpt_family="(CGG)n"
FT   mRNA            complement(join(<33177..33561,33658..33728,33820..33871,
FT                   34106..34202,34281..34358,34455..34571,34689..34793,
FT                   35543..35617,35814..35873,35971..36066,36355..36471,
FT                   36659..36777,36866..37007,38721..38807,39369..39431,
FT                   39598..39669,39780..39865,39949..>39961))
FT                   /gene="OSJNBa0006L06.5"
FT   CDS_pept        complement(join(33428..33561,33658..33728,33820..33871,
FT                   34106..34202,34281..34358,34455..34571,34689..34793,
FT                   35543..35617,35814..35873,35971..36066,36355..36471,
FT                   36659..36777,36866..37007,38721..38807,39369..39431,
FT                   39598..39669,39780..39865,39949..39961))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.5"
FT                   /product="putative WD-repeat containing protein"
FT                   /db_xref="GOA:Q9AV81"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AV81"
FT                   /protein_id="AAK27816.1"
FT                   /translation="MICAISGEVPDEPVVSKKSGLLFERRLVERYIEDHGKCPVTKEEL
FT                   TMDDIVAVKTNKVVKPRQLQAASIPGLLGMFQNEWDAIMLSSFALEQQLHTARQELSHA
FT                   LYQHDAACRVIARLKKERDEARALLAQAERQIPASMAGAAPTAVVSNGKRAFEDEVGPD
FT                   GKKIRPGINPVMIDELTECNTMLSAHRKKRQVPPTLASIDAIERYTQISSHPLHKTNKP
FT                   GILSMDIHPSKDIIATGGIDTNAVLFDRPSGQILCTLTGHSKKITSLKFVPRDELFVTG
FT                   SADKTVKIWQGSEEGNYNCIHTLKDHTAEVEAVTVHATQKYFVTASKDNTWCFYDIPSG
FT                   SCLTQVGESSGQEGYTSASFHPDGLILGTGTTEAVVKIWDVKTQSNVAKFEGHVGPVTA
FT                   MSFSENGYFLATAALDGVKLWDLRKLRNFRTISPYDSDTPTNSVEFDFSGSYLAVGGSD
FT                   TRVYQVANVKLEWNLVKTLPDLSGTGKVTNVKFGTDAKYIAVGSMDRNLRIFGHPGEDD
FT                   QMDDAKPSEE"
FT   repeat_region   complement(34941..34969)
FT                   /rpt_family="AT_rich"
FT   repeat_region   40055..40090
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(40456..40482)
FT                   /rpt_family="AT_rich"
FT   mRNA            complement(join(<42440..42451,42836..43167,43430..>43550))
FT                   /gene="OSJNBa0006L06.14"
FT   CDS_pept        complement(join(42440..42451,42836..43167,43430..43550))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.14"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV80"
FT                   /protein_id="AAK27819.1"
FT                   /translation="MTAAKVDMGRRLSRITGQGKDGELQMFWTFSKLLLSLIAGEQHDD
FT                   TPHTAQASGEYGGTATACTSIYKLELPSPARCHDDADAAVAAIEPREAMNVDSKASYLI
FT                   QIKNPEQPPSSDGRGGDKIKPRGPRSSRDGTDRASSSISRTRIDRARIKI"
FT   repeat_region   44456..44475
FT                   /rpt_family="(CTAAG)n"
FT   repeat_region   complement(46072..46223)
FT                   /rpt_family="putative Tourist type MITE element"
FT   repeat_region   complement(46140..46344)
FT                   /rpt_family="Tourist-like MITE element from O.sativa DNA
FT                   for LRK2 gene gi|1263159|emb|X89226.1|OSLRK2GEN (1 to 540)
FT                   540 nt"
FT   repeat_region   complement(46154..46269)
FT                   /rpt_family="Tourist-like MITE element from O.sativa DNA
FT                   for LRK2 gene gi|1263159|emb|X89226.1|OSLRK2GEN (1 to 540)
FT                   540 nt"
FT   repeat_region   46154..46256
FT                   /rpt_family="Tourist_Ol1 MITE element from gb:U72728 Oryza
FT                   longistaminata receptor-like kinase protein (Xa21), family
FT                   member F, pseudogene sequence (1080 to 1236) 157 nt"
FT   repeat_region   complement(46468..46490)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(46550..46618)
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46554..46629
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-2
FT                   gi|4586622|dbj|AB010114.1|AB010114"
FT   repeat_region   46554..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46556..46641
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46556..46633
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   complement(46556..46627)
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46556..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   complement(46556..46626)
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46556..46624
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46556..46622
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46556..46620
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46556..46618
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46556..46616
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46556..46614
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46556..46612
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   complement(46556..46612)
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46556..46610
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46556..46608
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46556..46606
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46557..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   complement(46557..46626)
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-2
FT                   gi|4586622|dbj|AB010114.1|AB010114"
FT   repeat_region   46557..46624
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46559..46633
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46559..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46561..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46563..46632
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46563..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   complement(46563..46626)
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46565..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46567..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46569..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-3
FT                   gi|4586621|dbj|AB010113.1|AB010113"
FT   repeat_region   46571..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46573..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46575..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   46577..46626
FT                   /rpt_family="Oryza sativa gene, repeat sequence Micropon-4
FT                   gi|4586620|dbj|AB010112.1|AB010112"
FT   repeat_region   complement(48333..48378)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(50473..50504)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(<51231..51362,52107..52922,53010..53183,53326..53451,
FT                   53601..53946)
FT                   /gene="OSJNBa0006L06.6"
FT   CDS_pept        join(51231..51362,52107..52922,53010..53183,53326..53451,
FT                   53601..53702)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.6"
FT                   /product="putative flowering-time gene protein"
FT                   /db_xref="GOA:Q9AV79"
FT                   /db_xref="InterPro:IPR010402"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV79"
FT                   /protein_id="AAK27800.1"
FT                   /translation="MGRELFSSSNSHSVDEPLPSQYQFRAFLGARSIMLDDVDDEPFAD
FT                   GISSPIAQHIYDFCDDGNGGDLFAAVNAAAAAGSDMFTASSEDASASSSSTATAPIAGG
FT                   GDTLSPPLPSLDSTLSALLEQDEPPGADGELLLPIDDYAFSAVDETQPPPPPEHQQQQQ
FT                   FTQMPLPVMGGAAAEHPALQAQLSSTATELMQYAGFTDEVFAAALAAGAGAGAGGYMGL
FT                   DDPLCPQQQHSGAMLPAAAAAGEAFFSKDAHAAQAAFFAAAGGGGGSMVMSMMGMDEIG
FT                   EYQRMMECGGALLGATHAADGADMAFGNAAAAELQMGGGGSSPARLPATGTTETTSLED
FT                   TSFKTVRLSNEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDYC
FT                   EASRSIGSQNHEEYEQIGGVKGEDMLDSDALAHISGMSSYMYNHTVESWI"
FT   repeat_region   52150..52212
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(52243..52319)
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(52685..52707)
FT                   /rpt_family="GC_rich"
FT   repeat_region   complement(52754..52777)
FT                   /rpt_family="GC_rich"
FT   repeat_region   complement(53298..53319)
FT                   /rpt_family="AT_rich"
FT   mRNA            <56099..>56569
FT                   /gene="OSJNBa0006L06.24"
FT   CDS_pept        56099..56569
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.24"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV78"
FT                   /protein_id="AAK27815.1"
FT                   /translation="MARCRCLALLACFAIVPLETLRHHLALLPRTAMARRRRFALSACF
FT                   AIVPLESGEGRRCFSCRRAPSPHQGRAPPSPRTQVTAALVARRRSSARRQSWETSLSLS
FT                   CLKAVIAFPATELLRYRIEAKHRSSFAAASRPSTEVGKLTRSGWKTNGVTRF"
FT   mRNA            complement(join(<56913..57171,57273..57314,58472..58756,
FT                   58863..>58922))
FT                   /gene="OSJNBa0006L06.7"
FT   CDS_pept        complement(join(57089..57171,57273..57314,58472..58756,
FT                   58863..58875))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.7"
FT                   /product="60S ribosomal protein L17"
FT                   /db_xref="GOA:Q9AV77"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV77"
FT                   /protein_id="AAK27802.1"
FT                   /translation="MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGI
FT                   KGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGV
FT                   IVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV"
FT   repeat_region   58876..58903
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(59807..59874)
FT                   /rpt_family="AT_rich"
FT   repeat_region   61126..61184
FT                   /rpt_family="misc_repeat from gb:AB017914.1|AB017914 Oryza
FT                   sativa mRNA for L-zip+NBS+LRR (3414 to 3472) 59 nt"
FT   repeat_region   complement(61166..61215)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(61740..61760)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(62140..62252)
FT                   /rpt_family="(TAAAA)n"
FT   repeat_region   complement(62208..62258)
FT                   /rpt_family="(GAAAA)n"
FT   repeat_region   complement(63023..63204)
FT                   /rpt_family="(TAAAA)n"
FT   repeat_region   complement(63168..63356)
FT                   /rpt_family="(TAAAAA)n"
FT   repeat_region   complement(63227..63414)
FT                   /rpt_family="(TAAAA)n"
FT   repeat_region   complement(63902..63929)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(65284..65316)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(65830..65859)
FT                   /rpt_family="AT_rich"
FT   mRNA            <66289..>66558
FT                   /gene="OSJNBa0006L06.25"
FT   CDS_pept        66289..66558
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.25"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV76"
FT                   /protein_id="AAK27818.1"
FT                   /translation="MAFLDGLYGSRRRMATAKGAGVAGRRRSSSAVAAPRPVRQLYWKL
FT                   RSRLRSSSKRHAGGAAAARFGYDLQSYSRNFDDGVGLVVSGHRF"
FT   repeat_region   66330..66477
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(69695..69722)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(71134..71175)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(71599..71799)
FT                   /rpt_family="(CGG)n"
FT   repeat_region   72144..72181
FT                   /rpt_family="(GA)n"
FT   repeat_region   complement(73110..73148)
FT                   /rpt_family="AT_rich"
FT   mRNA            <73694..>73981
FT                   /gene="OSJNBa0006L06.26"
FT   CDS_pept        73694..73981
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.26"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV75"
FT                   /protein_id="AAK27821.1"
FT                   /translation="MAFLDGLYGGGGGRRRMATTAKGAGAGRRRSSAAVAAPRPVRQLY
FT                   WKLRSRLRSSSSKRHGGGGAAARFGYDLQSYSRNFDDGGLDRSSPASYRF"
FT   repeat_region   73717..73894
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(74241..74291)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(74805..74835)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(75256..75322)
FT                   /rpt_family="AT_rich"
FT   repeat_region   76764..76902
FT                   /rpt_family="putative Stowaway type MITE element"
FT   repeat_region   complement(76775..76910)
FT                   /rpt_family="putative Stowaway type MITE element"
FT   mRNA            join(<77201..77593,77653..78312,79218..79385,79579..>79599)
FT                   /gene="OSJNBa0006L06.15"
FT   CDS_pept        join(77201..77593,77653..78312,79218..79385,79579..79599)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.15"
FT                   /product="putative reverse transcriptase"
FT                   /db_xref="GOA:Q9AV74"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV74"
FT                   /protein_id="AAK27805.1"
FT                   /translation="MGFSAKWRDWVALILSASSSRVSLNGIEGERIDHRRGLRQGDPLS
FT                   PYLFILAMDPLHRLLKIATDEGHLSELADRSARFRCSLDADDAAIFIKPSRQDVDSLIL
FT                   ILNGFGGATSLQVNLQKSSVLPISCDAYLGMPLTVSRLRKVHLQYLIDRIKARLASWKK
FT                   KLLSAGGRRELVLSVLSSMPIYVMTALKIPKQIIQEIDKARRKFLWDGGDEFHGGKCKV
FT                   NWQRVCRPIKYGGLGVSNLTKMGRALHLRWLWYEWTFPDKPWIGMPTPCDEQDAELFAA
FT                   STTVTIGDSRKALFWESPWVSSSPLKTMAPNLYRHARRKKRTVANALQDNKWINDIRHN
FT                   LTSMLVTEFFKPEEDGRVVDGWRGEAAVGSGGDGAAGEATVPEAEVKVEELGVDAAGEE
FT                   SRRRGEVRVAIAMD"
FT   repeat_region   79203..79291
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(79834..79869)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(80261..80589,81717..81822,81953..82101,82861..83113,
FT                   83445..83554,83994..84080,84271..84357,84538..84675,
FT                   84790..>84861)
FT                   /gene="OSJNBa0006L06.8"
FT   CDS_pept        join(80482..80589,81717..81822,81953..82101,82861..83113,
FT                   83445..83554,83994..84080,84271..84357,84538..84675,
FT                   84790..84861)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.8"
FT                   /product="putative peroxin"
FT                   /db_xref="GOA:Q9AV73"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV73"
FT                   /protein_id="AAK27808.1"
FT                   /translation="MLFQVGGQGARPTFFEMSAAQQLPASLRAALSYSLGVFALRRPLL
FT                   HKVLDYEDEFFALLMAVLESHSLRTTDGSFSESLYGLRRRPVKVSVKRSSSGAESNDKA
FT                   YDSVLRKRQKVLSVVFLVVLPYFKSKLQSIYNKEREARLQASLWGQGDVRFDEADLVSD
FT                   QGETSQAQVEATTGEVSNMARIKKNFAALIGVCYPWIHATNEGLSFAYQLLYLLDGTAF
FT                   YSPALHALGLHVCRATGQELTMQRVLLNCMYTSLDYAQTGLIAAVFFFKMMEWWYQSAE
FT                   ERMSAPTVYPPPPPPPLPKVAKDGLPLPPDRTLCPLCCQKRNNPSVLSASGFVFCYSCI
FT                   FKSVSQHKRCPITLMPATVEQIRRLFHDL"
FT   repeat_region   85321..85465
FT                   /rpt_family="Wanderer_Ol1 MITE element from gb:U34601 Oryza
FT                   sativa wanderer mobile element linked to Xa21 (411 to 637)
FT                   227 nt"
FT   repeat_region   85326..85438
FT                   /rpt_family="Wanderer_Os1 MITE element from gb:L28995 Oryza
FT                   sativa 3-hydroxy-3-methylglutaryl coenzyme A reductase gene
FT                   (4476 to 4704) 229 nt"
FT   repeat_region   complement(85330..85428)
FT                   /rpt_family="Tourist_Ol2 MITE element from gb:U72727 Oryza
FT                   longistaminata receptor kinase-like protein, family member
FT                   A2, pseudogene sequence(5453 to 5694) 242 nt"
FT   repeat_region   complement(86101..86135)
FT                   /rpt_family="GC_rich"
FT   repeat_region   87300..87350
FT                   /rpt_family="(GGAGA)n"
FT   repeat_region   complement(87740..87768)
FT                   /rpt_family="(GGAGAA)n"
FT   mRNA            join(87745..88083,89053..89221,89351..89476,90330..90395,
FT                   90514..90806)
FT                   /gene="OSJNBa0006L06.9"
FT   repeat_region   87848..87952
FT                   /rpt_family="(CGG)n"
FT   CDS_pept        join(87875..88083,89053..89221,89351..89476,90330..90395,
FT                   90514..90564)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.9"
FT                   /product="cap-binding protein p28"
FT                   /db_xref="GOA:P48600"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR019770"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48600"
FT                   /protein_id="AAK27811.1"
FT                   /translation="MAEVEAAPIAAAETPEVAAAEGAAAAKAPHKLHRQWAFWYDIQSK
FT                   PKPGAAWGTSLRKAYTFDTVEEFWGLYDQIFRPSKVTVNADFHLFKAGVEPKWEDPECA
FT                   NGGKWTVPCSRKTTLENMWLETLMALIGEQFDESEEICGVVASVRQRGDKLALWTRTAS
FT                   NEAVQVNIGKKWKEIVDYNDKMVYSFHDDAKREKPSRGGRYNV"
FT   mRNA            join(<91634..91847,91949..92076,92192..92261,92349..92505,
FT                   92606..93218,93649..94125,94203..94796,94876..95226,
FT                   95325..96128)
FT                   /gene="OSJNBa0006L06.10"
FT   CDS_pept        join(91634..91847,91949..92076,92192..92261,92349..92505,
FT                   92606..93218,93649..94125,94203..94796,94876..95226,
FT                   95325..95912)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.10"
FT                   /product="putative cellulose synthase"
FT                   /db_xref="GOA:Q9AV71"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR005150"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027934"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AV71"
FT                   /protein_id="AAK27814.1"
FT                   /translation="MDTASVTGGEHKGKEKTCRVCGEEVAAREDGKPFVACAECGFPVC
FT                   KPCYEYERSEGTQCCPQCNTRYKRHKGCPRVEGDEDDGGDMDDFEEEFQIKSPTKQKPP
FT                   HEPVNFDVYSENGEQPAQKWRPGGPALSSFTGSVAGKDLEQEREMEGGMEWKDRIDKWK
FT                   TKQEKRGKLNRDDSDDDDDKNDDEYMLLAEARQPLWRKVPIPSSKINPYRIVIVLRLVV
FT                   LCFFLKFRITTPAMDAVPLWLASVICELWFALSWILDQLPKWSPVTRETYLDRLALRYE
FT                   RDGEPCRLAPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGASMLLF
FT                   DTLSETAEFARRWVPFCKKFTIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEE
FT                   FKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEGSELPR
FT                   LVYVSREKRPGYNHHKKAGAMNSLVRVSAVLTNAPFILNLDCDHYVNNSKAVREAMCFL
FT                   MDKQLGKKLCYVQFPQRFDGIDRHDRYANRNTVFFDINMKGLDGIQGPVYVGTGTVFNR
FT                   QALYGYDPPRPEKRPKMTCDCWPSWCCCCCCFGGGKRGKSHKNKKGGGGGEGGGLDEPR
FT                   RGLLGFYKKRSKKDKLGGGAASLAGGKKGYRKHQRGFELEEIEEGLEGYDELERSSLMS
FT                   QKSFEKRFGQSPVFIASTLVEDGGLPQGAAADPAALIKEAIHVISCGYEEKTEWGKEIG
FT                   WIYGSVTEDILTGFKMHCRGWKSVYCTPARAAFKGSAPINLSDRLHQVLRWALGSVEIF
FT                   MSRHCPLWYAYGGRLKWLERFAYTNTIVYPFTSIPLLAYCTIPAVCLLTGKFIIPTLNN
FT                   LASIWFIALFLSIIATGVLELRWSGVSIEDWWRNEQFWVIGGVSAHLFAVFQGLLKVLG
FT                   GVDTNFTVTSKAAADETDAFGELYLFKWTTLLVPPTTLIIINMVGIVAGVSDAVNNGYG
FT                   SWGPLFGKLFFSFWVILHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFI
FT                   PKPKGPVLKPCGVSC"
FT   repeat_region   92458..92496
FT                   /rpt_family="(CGA)n"
FT   repeat_region   complement(93338..93392)
FT                   /rpt_family="AT_rich"
FT   repeat_region   94407..94433
FT                   /rpt_family="(CGG)n"
FT   mRNA            complement(join(<96805..97229,99773..>102170))
FT                   /gene="OSJNBa0006L06.16"
FT   CDS_pept        complement(join(96805..97229,99773..102170))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.16"
FT                   /product="putative protein kinase"
FT                   /db_xref="GOA:Q9AV70"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV70"
FT                   /protein_id="AAK27817.1"
FT                   /translation="MPNLEHLNLSSNQFSGEIPASLAKLTKLQSVVLGSNLLHGGVPPV
FT                   IGNISGLRTLELSGNPLGGAIPTTLGKLRSLEHINVSLAGLESTIPDELSLCANLTVIG
FT                   LAGNKLTGKLPVALARLTRVREFNVSKNMLSGEVLPDYFTAWTNLEVFQADGNRFTGEI
FT                   PTAITMASRLEFLSLATNNLSGAIPPVIGTLANLKLLDLAENKLAGAIPRTIGNLTSLE
FT                   TLRLYTNKLTGRLPDELGDMAALQRLSVSSNMLEGELPAGLARLPRLVGLVAFDNLLSG
FT                   AIPPEFGRNGQLSIVSMANNRFSGELPRGVCASAPRLRWLGLDDNQFSGTVPACYRNLT
FT                   NLVRLRMARNKLAGDVSEILASHPDLYYLDLSGNSFDGELPEHWAQFKSLSFLHLSGNK
FT                   IAGAIPASYGAMSLQDLDLSSNRLAGEIPPELGSLPLTKLNLRRNALSGRVPATLGNAA
FT                   RMEMLDLSGNALDGGVPVELTKLAEMWYLNLSSNNLSGEVPPLLGKMRSLTTLDLSGNP
FT                   GLCGHDIAGLNSCSSNTTTGDGHSGKTRLVLAVTLSVAAALLVSMVAVVCAVSRKARRA
FT                   AVVVEKAETSASGGGGSSTAAAVQASIWSKDTTFSFGDILAATEHFNDAYCIGKGSFGT
FT                   VYRADLGGGRAVAVKRLDASETGDACWGVSERSFENEVRALTRVRHRNIVKLHGFCAMG
FT                   GYMYLVYELAERGSLGAVLYGGGGGGGCRFDWPARMRAIRGVAHALAYLHHDCSPPMIH
FT                   RDVSVNNVLLDPDYEPRVSDFGTARFLVPGRSTCDSIAGSYGYMAPELAYMRVTTKCDV
FT                   YSFGVVAMEMLMGKYPGGLISSLQHSPQSLSAEGHDGSGGGGGEEASASASRRLLLKDV
FT                   VDQRLDAPAGKLAGQVVFAFVVALSCVRTSPDARPTMRAVAQELAARRRPILDRPFEMI
FT                   KIGDLTNSHR"
FT   repeat_region   complement(97042..97087)
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(97670..97690)
FT                   /rpt_family="AT_rich"
FT   repeat_region   97815..97987
FT                   /rpt_family="(TAAAAA)n"
FT   repeat_region   98115..98238
FT                   /rpt_family="(TAAAAA)n"
FT   repeat_region   complement(98800..98820)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(99334..99375)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(100008..100029)
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(100374..100425)
FT                   /rpt_family="(CGG)n"
FT   repeat_region   102359..102433
FT                   /rpt_family="(CCGCG)n"
FT   repeat_region   complement(102483..102511)
FT                   /rpt_family="GC_rich"
FT   repeat_region   complement(102624..102644)
FT                   /rpt_family="GC_rich"
FT   repeat_region   complement(104790..104965)
FT                   /rpt_family="Tourist_Ol2 MITE element from gb:U72727 Oryza
FT                   longistaminata receptor kinase-like protein, family member
FT                   A2, pseudogene sequence(5453 to 5694) 242 nt"
FT   repeat_region   complement(104795..104925)
FT                   /rpt_family="Wanderer_Os4 MITE element from gb:X16509 Rice
FT                   alpha-amylase gene (1838 to 2042) 205 nt"
FT   repeat_region   104825..104925
FT                   /rpt_family="Wanderer_Os1 MITE element from gb:L28995 Oryza
FT                   sativa 3-hydroxy-3-methylglutaryl coenzyme A reductase gene
FT                   (4476 to 4704) 229 nt"
FT   repeat_region   104866..104971
FT                   /rpt_family="Wanderer_Ol1 MITE element from gb:U34601 Oryza
FT                   sativa wanderer mobile element linked to Xa21 (411 to 637)
FT                   227 nt"
FT   repeat_region   105048..116367
FT                   /rpt_family="Retrosat 1 Ty3-Gypsy_retroelement from
FT                   O.sativa indica GB:AF111709 10880nt"
FT   repeat_region   complement(105048..116367)
FT                   /rpt_family="Oryza sativa gypsy-type retrotransposon RIRE2
FT                   DNA gi|5902443|AB030283"
FT   repeat_region   complement(105048..105488)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   105048..105486
FT                   /rpt_family="Retrosat 1 Ty3-Gypsy_retroelement from
FT                   O.sativa indica GB:AF111709 10880nt"
FT   repeat_region   complement(105048..105486)
FT                   /rpt_family="Oryza sativa gypsy-type retrotransposon RIRE2
FT                   DNA gi|5902443|AB030283"
FT   repeat_region   complement(105074..105146)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(105301..105399)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(105402..105517)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(105605..105674)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   mRNA            join(<106497..106664,107057..107383,107470..107762,
FT                   107839..108197,108264..108463,108538..108727,
FT                   108790..108903,108977..>109428)
FT                   /gene="OSJNBa0006L06.17"
FT   CDS_pept        join(106497..106664,107057..107383,107470..107762,
FT                   107839..108197,108264..108463,108538..108727,
FT                   108790..108903,108977..109428)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.17"
FT                   /product="putative gypsy-type retrotransposon RIRE2
FT                   protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV69"
FT                   /protein_id="AAK27820.1"
FT                   /translation="MVEERESFESQWAPSDVTEDNLKEMVAHGVLPAKEIIGWRPAFGE
FT                   AFPTPDTHEIVDTWNSLPMGDEAAQAVELMERMIKLKEQGLQGEQITQHFIKCRLAPIK
FT                   ERSRTAFEFDGKHDPNREDPDSLDFKVMKERMYKIFSNAIVVSYSHLLPVVPFNAFNPP
FT                   PPEFALMKSDPPIAQRRSPRHQTGQGSGGPRIRSETQPSASDSVGQSDSRKRKLVLSDD
FT                   EADDTTRRPGDRETTKKLSKQATPKKKTSSRPAPKIRKSSRKPSDIDPSGKDSDPTSVD
FT                   ANSSKEIGTTAEDRPSDNQPATDNVESGDQPPIGNQSAEAEAGVNQEPPTRNQSDARPS
FT                   QEIPEVGAQADSLRSQDASNNQRSRSPLKASESTHPHPEIIMVDTLGPMISDEEEIPRI
FT                   QAAEDSRPPILVKWWDDNMQPQGTVINKQKEDEELCLLKKALGQATHIVNRIHLRNEAK
FT                   TETLERLVPHLGTLEATRSLLHETKELARKNEHDLRNRIAELQESNFELSGSSKVNVVQ
FT                   TAKISQLEKQIQILENDKAELARQRDLALKEVEDRKIKSQAQFDVLVSKIKKLEGARDE
FT                   VDNAAAPIVQAMFLNNNGPSALDASEIFDKLRVAPDIYFKNIKEAGSMGVSMALAMTKS
FT                   LYPRVDIDVIDGFADGTSEEAALDLISDAQKAADKIAADVVERFQDTDLRPTGPGNSDD
FT                   EKTETD"
FT   repeat_region   complement(106553..107020)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(107036..107375)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(108274..108468)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(108533..108730)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(108962..116369)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   mRNA            complement(join(<109758..110600,110700..111531,
FT                   111770..111935,112050..112893,112951..113793,
FT                   113864..114829,114893..115024,115162..115557,
FT                   115739..>115879))
FT                   /gene="OSJNBa0006L06.18"
FT   CDS_pept        complement(join(109758..110600,110700..111531,
FT                   111770..111935,112050..112893,112951..113793,
FT                   113864..114829,114893..115024,115162..115557,
FT                   115739..115879))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.18"
FT                   /product="putative gag-pol precursor"
FT                   /db_xref="GOA:Q9AV68"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR005162"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV68"
FT                   /protein_id="AAK27822.1"
FT                   /translation="MGFVSGIDDFAFPPGQAFRFGSLDFITNNFGKISLLDSDSDQSGR
FT                   DQPKHLPLGDLGELRHRPRSSLDPGRSALYSNLLGQSRRKNWMAPSAPPASVLDQPRSS
FT                   TTTTSATTTTTATSTTSTTAMRITTCPSSSAYSWLTTKRKNSAEPEKRTKIAHGKELNV
FT                   ADWRKCDSDRSENDYSQNAVAAITLLDTLLKEDALNQADHVVNILNQTKTMIAASVPAN
FT                   SPSLSITGTGSSRRSRGHDERSVHSPPERHRERRVERPRSPPHQRPVDLRDMINQHRAA
FT                   RGHRHSPNRYDDDVDRVATFTNDLRRVDWPVGFKPTGIEKYNGTTNPESWLTVYGIAIR
FT                   AAGGDSKAMANYLPVALADSARSWLHGLPRRTIGSWAELRDHFIANFQGTFERPGTQFD
FT                   LYNIVQKSGESLRDYIRRFSEQRNKISDITDDVIIAAFTKGIRHEDLVGKFGRKPPRTV
FT                   KQMFEKANEYAKAEDAITASKQSGTTWKPKKDAPTAGGSGSNNHKDRKHKPEELVATTS
FT                   PSYRQRPRVNTFDKIMNSQCPHHPNSNHTEIKAHQRRDDEDDAPTGFQDHRKELNHIFG
FT                   GPLAYESKRKQKLMEREINAVQPNTPQYLQWSETAIKFDRSDHPDRVVHPGWYPLVLDP
FT                   VVRNVKLRRTLIDGGSALNILFAKTLDDMQIPRTELKPSNAPFHGVIPGLSATPLGQIT
FT                   LPVTFGTRENFRTENVCFEVADFEIAYHAILRRPALAKFMAVPHYTYMMMKMSGPRGVI
FT                   SLRSDIKQAVTCDKESCEMAQTHETTLAREEIRLAATTASEGEVPATKLTKTEESDAKT
FT                   KKIPLDPSDPDKTANNKDIFAWKPSDMPGIPREVIEHSLHVKEDAKPIKQRLRRFAQDR
FT                   KDAIKEELTKLLAAGFIKEVLHPDWLANPVLVRKKTGQWRMCVDYIDLNKSCPKDPFGL
FT                   PRIDQVVDSTAGCELLSFLDCYSGYHQIRLKESDCLKTSFITPFGAYCYITMPFGLKNA
FT                   GATYQRMIQKCFSTQIGRNVEAYVDDVVVKTKQKDDLIADLEETFTSIRAFKMKLNPEK
FT                   CIFGVPSGKLLGFMVSQRGIQANPEKINAILNMKPPSSQKDVQKLTGCMAALSRFVSRL
FT                   VLASPHPQEPLLLYVSATSQVVSTVLVVEREEEGHIQKVQQPIYFVSEVLADSKTSGPS
FT                   AKKTCQRKRWNIGLCIFDGSKRLTGTGAGVVLISPTGERLSDVLWIHFSASHNVAEYEA
FT                   LLHGLRIAISLGIRRLIVRGDSQLVVNQVMKEWSCLDDNMTAYRQEVRKLEDKFDGLEL
FT                   THVLRHNNEAADRLANFGSKREAAPSDVFVEHLYEPTVPRKETTEAMDTQGVSMIEADW
FT                   REPLIKFLTKQELPQDKNEAERISRRSRLYIIHEAELYKKSPSGILQRCVSLEEGRQLL
FT                   KDIHSGICGNHAVARTIVGKAYRQGFFWPTAVSDADKIGLDMVGPFKRAVGGYTHLFVA
FT                   IDKFSKWIEAKPVITITADKVRDFFINIVHRFGVPNRIITDNGTQFTGGAFKDFCEDFG
FT                   IKICYASVAHPMSNGQVERANGMILQGIKARVFDRLRPYAGKWVDQLPSVLWSLRTTPS
FT                   RATGQSPFFLVYGAEAMLPSEVEFESLRFWNFNEEGYEEGRVDDINRLEEAREAALIQS
FT                   TRYLQGLRRYHNRNVRSRAFLVGDLVLRKIQKTQDRHKLSPLWEGPFIIAEVTRPGSYR
FT                   LKREDGTIINNSWNIEHLRQFYA"
FT   repeat_region   110490..110771
FT                   /rpt_family="retroelement from gi|5803242|AP000399 Oryza
FT                   sativa (75139 to 88038) 12900 nt"
FT   repeat_region   complement(115313..115388)
FT                   /rpt_family="(CGA)n"
FT   repeat_region   complement(115929..116372)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(115929..116368)
FT                   /rpt_family="Oryza sativa gypsy-type retrotransposon RIRE2
FT                   DNA gi|5902443|AB030283"
FT   repeat_region   115929..116101
FT                   /rpt_family="Retrosat 1 Ty3-Gypsy_retroelement from
FT                   O.sativa indica GB:AF111709 10880nt"
FT   repeat_region   116183..116370
FT                   /rpt_family="Retrosat 1 Ty3-Gypsy_retroelement from
FT                   O.sativa indica GB:AF111709 10880nt"
FT   repeat_region   complement(116364..116505)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   repeat_region   complement(116370..116505)
FT                   /rpt_family="Oryza sativa gypsy-type retrotransposon RIRE2
FT                   DNA gi|5902443|AB030283"
FT   repeat_region   116370..116453
FT                   /rpt_family="Retrosat 1 Ty3-Gypsy_retroelement from
FT                   O.sativa indica GB:AF111709 10880nt"
FT   repeat_region   116373..116505
FT                   /rpt_family="Retrosat 1 Ty3-Gypsy_retroelement from
FT                   O.sativa indica GB:AF111709 10880nt"
FT   repeat_region   complement(116373..116505)
FT                   /rpt_family="Oryza sativa gypsy-type retrotransposon RIRE2
FT                   DNA gi|5902443|AB030283"
FT   repeat_region   complement(116399..116510)
FT                   /rpt_family="retroelement from gi|6016845|AP000570 Oryza
FT                   sativa (82758 to 94014) 11257 nt"
FT   mRNA            complement(join(<120247..120405,120626..120753,
FT                   120921..>120945))
FT                   /gene="OSJNBa0006L06.19"
FT   CDS_pept        complement(join(120247..120405,120626..120753,
FT                   120921..120945))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.19"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV67"
FT                   /protein_id="AAK27824.1"
FT                   /translation="MANRLAATGYIQDMQVGMMGDIWKSASLKRKSKRYGVNFFKGFKA
FT                   TVNFLKLGRNPISLGKTTEMIGKKVEHCCRWIQEEEIAGIAESLQGGGSGAGSSGGSW"
FT   repeat_region   complement(123200..123245)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(123407..123834)
FT                   /rpt_family="Rice transposon Tnr3 DNA, complete sequence
FT                   gi|1256198|dbj|D63711.1|RICTNR3"
FT   repeat_region   complement(123812..123989)
FT                   /rpt_family="Rice transposon Tnr3 DNA, complete sequence
FT                   gi|1256198|dbj|D63711.1|RICTNR3"
FT   repeat_region   complement(124291..124454)
FT                   /rpt_family="(CGG)n"
FT   mRNA            complement(join(<127913..128496,128591..128974,
FT                   129075..>129210))
FT                   /gene="OSJNBa0006L06.20"
FT   CDS_pept        complement(join(127913..128496,128591..128974,
FT                   129075..129210))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.20"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR024752"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV66"
FT                   /protein_id="AAK27803.1"
FT                   /translation="MPSKGSSQMTMTNQRNLSDRRAQQPLSQVYVDVDSEHGTAERQEI
FT                   GTAKRARWSHQMKMFLIELLTDHDVPGFRTQNAWSKEAWTNIVCRLNTKFGTSFTTNQV
FT                   KQKEQDLKKDYRSVKDLLDQSGFGWDSDRMMVSAPQSVWDTFADRKNKDAIHWRDKSFP
FT                   YFDDLAPLYDGRYAEGRTRHGMDHYARKTKNAPAHSTQEANAVDTYQSPSPNSNAPGES
FT                   GLQFPFGEEVETANLDFSQHSPTPVHLTKVPPSSAQTPSEVPESRPGKKQKIKSVSPDD
FT                   GFHERYLKLKKEDIDRFAAIEEKKLEDPYSINKCITVLEGLHGLQIGDILVAADIFKGK
FT                   DNREVFLSFSSDALRLAWIRKEIAALE"
FT   repeat_region   complement(132224..132329)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(132642..132679)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(132696..132818)
FT                   /rpt_family="(TAAAAA)n"
FT   repeat_region   complement(132925..132965)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(137213..137243)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(138746..138798)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(140046..140077)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(140921..141028)
FT                   /rpt_family="Gaijin_Os1 MITE element from gb:X52623 Rice
FT                   4-CL gene for 4-coumarate-CoA ligase (1888 to 2027) 140 nt"
FT   repeat_region   complement(141340..141371)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(141439..141472)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(<141883..145156,145496..145584,145637..>146110)
FT                   /gene="OSJNBa0006L06.21"
FT   CDS_pept        join(141883..145156,145496..145584,145637..146110)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.21"
FT                   /product="putative protein kinase"
FT                   /db_xref="GOA:Q9AV65"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV65"
FT                   /protein_id="AAK27806.1"
FT                   /translation="MPRRHDALRLLLLVVVVAAADAATEADALLAWKAGLQDGAAALSG
FT                   WSRAAPVCAWRGVACDAAAGGARVTSLRLRGAGLGGGLDALDFAALPALAELDLNGNNF
FT                   TGAIPASISRLRSLASLDLGNNGFSDSIPPQLGDLSGLVDLRLYNNNLVGAIPHQLSRL
FT                   PKVAHFDLGANYLTDEDFAKFSPMPTVTFMSLYLNSFNGSFPEFILKSGNVTYLDLSQN
FT                   TLFGKIPDTLPEKLPNLRYLNLSINAFSGPIPASLGKLTKLQDLRMAANNLTGGVPEFL
FT                   GSMPQLRILELGDNQLGGPIPPVLGQLQMLQRLDIKNSGLSSTLPSQLGNLKNLIFFEL
FT                   SLNQLSGGLPPEFAGMRAMRYFGISTNNLTGEIPPVLFTSWPELISFQVQNNSLTGKIP
FT                   PELGKASKLNILYLFTNKFTGSIPAELGELENLTELDLSVNSLTGPIPSSFGNLKQLTK
FT                   LALFFNNLTGVIPPEIGNMTALQSLDVNTNSLHGELPATITALRSLQYLAVFDNHMSGT
FT                   IPADLGKGLALQHVSFTNNSFSGELPRHICDGFALDHLTANYNNFTGALPPCLKNCTAL
FT                   VRVRLEENHFTGDISEAFGVHPKLVYLDVSGNKLTGELSSAWGQCINLTLLHLDGNRIS
FT                   GGIPAAFGSMTSLKDLNLAGNNLTGGIPPVLGNIRVFNLNLSHNSFSGPIPASLSNNSK
FT                   LQKVDFSGNMLDGTIPVAISKLDALILLDLSKNRLSGEIPSELGNLAQLQILLDLSSNS
FT                   LSGAIPPNLEKLITLQRLNLSHNELSGSIPAGFSRMSSLESVDFSYNRLTGSIPSGNVF
FT                   QNASASAYVGNSGLCGDVQGLTPCDISSTGSSSGHHKRVVIATVVSVVGVVLLLAVVTC
FT                   IILLCRRRPREKKEVESNTNYSYESTIWEKEGKFTFFDIVNATDNFNETFCIGKGGFGS
FT                   VYRAELSSGQVVAVKRFHVADTGDIPDVNKKSFENEIKALTEVRHRNIVKLHGFCTSGD
FT                   YMYLVYEYLERGSLGKTLYGEEGKKKMDWGMRVKVVQGLAHALAYLHHDCNPAIVHRDI
FT                   TVNNILLESDFEPRLCDFGTAKLLGGASTNWTSVAGSYGYMAPGKNERKKLRSDLFKIV
FT                   LHIIVIHESTEVITICRTLKDCHWEKELLKFRQVRHRTINTYRLRLFLAEFAYTMRVTE
FT                   KCDVYSFGVVALEVMMGKHPGDLLTSLPAISSSEEDDLLLKDILDQRLDAPTGQLAEEV
FT                   VFIVRIALGCTRVNPESRPSMRSVAQEISAHTQAYLSEPFKLITISKLTDYQK"
FT   repeat_region   complement(142022..142087)
FT                   /rpt_family="GC_rich"
FT   mRNA            complement(join(<149813..150638,151010..>151791))
FT                   /gene="OSJNBa0006L06.22"
FT   CDS_pept        complement(join(149813..150638,151010..151791))
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.22"
FT                   /product="putative disease resistance protein"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV64"
FT                   /protein_id="AAK27809.1"
FT                   /translation="MAGVVHRFLLLLLFVAAAVMPASTNAAASSQTDALLAWKASLTDV
FT                   AALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGN
FT                   NFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLS
FT                   WLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLS
FT                   LNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNML
FT                   SMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPI
FT                   MGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQ
FT                   FMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFF
FT                   GNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNL
FT                   TSMKNKKLNISSGIITMA"
FT   repeat_region   complement(152361..152413)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(152434..152477)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(152506..152684)
FT                   /rpt_family="(TAAAAA)n"
FT   repeat_region   complement(154043..154084)
FT                   /rpt_family="AT_rich"
FT   mRNA            <154621..>155235
FT                   /gene="OSJNBa0006L06.27"
FT   CDS_pept        154621..155235
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.27"
FT                   /product="putative stachyose synthase"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV63"
FT                   /protein_id="AAK27823.1"
FT                   /translation="MAAAAKATASTASPPTSWRHGSGGGNGDGVDCFTVYFVEAQKLQL
FT                   LRRNESFELTLEPFTYELLLERRISFVPIGLANMLNVGGAVQGFQTVKKDDGGGGDVVA
FT                   EVAVKGAKEAYSSARLWAGARGEAAEERHGWSRAEDGELDVPATESGLGKDAADDLDGG
FT                   GSLGGGGLVVEVEGGLGALDGGHEEGVEGTFPSIRNFSPLF"
FT   repeat_region   154623..154716
FT                   /rpt_family="(CGG)n"
FT   repeat_region   complement(157951..157979)
FT                   /rpt_family="AT_rich"
FT   repeat_region   158075..158333
FT                   /rpt_family="putative Tourist type MITE element"
FT   repeat_region   158182..158293
FT                   /rpt_family="Tourist-like MITE element from O.sativa DNA
FT                   for LRK2 gene gi|1263159|emb|X89226.1|OSLRK2GEN (1 to 540)
FT                   540 nt"
FT   repeat_region   complement(158185..158345)
FT                   /rpt_family="Tourist_Ol1 MITE element from gb:U72728 Oryza
FT                   longistaminata receptor-like kinase protein (Xa21), family
FT                   member F, pseudogene sequence (1080 to 1236) 157 nt"
FT   repeat_region   158219..158334
FT                   /rpt_family="putative Tourist type MITE element"
FT   repeat_region   complement(158657..158716)
FT                   /rpt_family="(GGGAGA)n"
FT   repeat_region   complement(159669..159882)
FT                   /rpt_family="putative Tourist type MITE element"
FT   repeat_region   complement(159677..159817)
FT                   /rpt_family="putative Tourist type MITE element"
FT   repeat_region   159712..159852
FT                   /rpt_family="Tourist_Ol1 MITE element from gb:U72728 Oryza
FT                   longistaminata receptor-like kinase protein (Xa21), family
FT                   member F, pseudogene sequence (1080 to 1236) 157 nt"
FT   repeat_region   complement(159735..159845)
FT                   /rpt_family="Tourist-like MITE element from O.sativa DNA
FT                   for LRK2 gene gi|1263159|emb|X89226.1|OSLRK2GEN (1 to 540)
FT                   540 nt"
FT   mRNA            complement(<161014..>162339)
FT                   /gene="OSJNBa0006L06.23"
FT   CDS_pept        complement(161014..>162339)
FT                   /codon_start=1
FT                   /gene="OSJNBa0006L06.23"
FT                   /product="putative disease resistance protein, 5'-partial"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV62"
FT                   /protein_id="AAK27812.2"
FT                   /translation="KLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIP
FT                   QAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSL
FT                   ISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNF
FT                   SGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRI
FT                   NTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSR
FT                   SIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTL
FT                   TDPSIYSNNSGLCGLPLNISCTNYALASDERYCRTCEDQYLSYFVMAGVVFGSWLWFGM
FT                   LFSIGNLRYAVFCFVDDIQRKVMQKVSCINQLLSRGNTAQYL"
XX
SQ   Sequence 162339 BP; 45047 A; 36072 C; 35403 G; 45592 T; 225 other;
     aagcttgctt gagcagttgg gtcggggtga taggcagctg tggctgcagc caagaagcct        60
     tggcggatgg tggtagcggc gcaagaattg atgctggaat ctgccgagag aaggtgggca       120
     tccgcttgga ggatgcggcg catggcttgg tggaaatctt ttttttaaac cccaacgagg       180
     tgtatttgta ttaaataagg gggaaacact gtacaatagc caaaaggcta ggacttacaa       240
     aggaaaaaaa aaggaagaga gttgggggcg ggggacgggg gagcgtccac tagaagaacg       300
     tgtggagagg caaaaaaaaa ttaactacag attatttgtt gtgctaccac ggtcatctgg       360
     cattaaagat tgaatgctct ctgccccgcc agctcgccag agccagattt cctcagtcgc       420
     ccgatcgatg attccgcatg gtgttgtctc gatgctttga aacactcggc tattcctctc       480
     cttccagatt tcccaggaga ccaggattag gagtgatttg actctccttc ttttctcgac       540
     accgagagga cagtgacgat gagccgcgcg gttccacggc cacgacgagc cgtctccatc       600
     actgccatcg ccgtatgagt cttcaagcag cccgacgagc ctgcggacga gtgcatggcg       660
     gcggcgggat acggcgagcc aggcgcggac gaggcggtcg gcgtcggggt ggccagcggt       720
     gagagctccg cactcgagcg ccatgtagag gccttcgttg agggcgaagt cgtcgtcgtc       780
     gtccccgagt aatctcctcc tcttcttcat gcccatgtcc gccgggaccg cggtggcggc       840
     gacgaggagg tcggcgccgg cgacgaacag gtagcgcacg gcctaccact ccctcaagtc       900
     ggggaacaag cggacgagga aggccttcat gccgtcgagc ggccgcgccg caagctcctg       960
     cgtggtcgcc tggggatcgg gcatcgcgga ggaggagggg gtgagagtgt tgatgacgat      1020
     gttggagacc aacccgagga ggcctaagca gaggcggcgg cggcgtggtg gtggctgatc      1080
     cgctggaacg cctttgggta gaaggcctcg atcttgcgca gcaaatgcga tttgcaagca      1140
     gatttttcat cgggcgacgg gtacccacca acacagcatg gctcgtatat ccggagatcc      1200
     ggcagcgagc tggacgccag cgccatcgtc cgccggcggc gtccagcgag aggggcggcg      1260
     gcggcggcga gtggaaaccg gatagaagac gagtatttac cgactacgcc gcgcggctct      1320
     gatttttatt tttactagca aaagtgcccg tgcgttgcac cgggtgatta cggagtgtgt      1380
     atattgacca aaattgttgt ttggtttagc aaaagtgccc gtgcgttgca ctgggaagcg      1440
     cacagatcag taaaaatatg caaattaatt aaaacacaaa ttcactgaaa tatttggtat      1500
     ttttaagtag gtatgtgtat aattaaataa atttacaagt aaagcaagtg cgagaaataa      1560
     aatgacattg ttaaatttaa ttttattaaa ctctccatga ttagttacgc tatttggaat      1620
     tttcagaact taattgctaa ttttaataat acaaatatta tttaataatt atttaattgg      1680
     aaaaagaaag aaaatccttc cttttaggtt tgcttagaaa taaacacatt taataactat      1740
     aattgtaaat gcttctgaaa aaattaagca ctaaaaatga acttctctgt ttttttttcg      1800
     gcctgaggga cctaatatag acttatttcc ggcccgaggg acccaaaata gacttatttc      1860
     cgtcccttcc ggtcggccca cgcgttatca aaaccctaac cctccacacc cctccccccc      1920
     cccccccccc caacttattc tcctccctct cccaccgcga gtcggcgagc ggcggcggcg      1980
     gcggcggtcg gaccggcgat ctcgcggccg aggcgaggcg gcggcatacc tgccctaccg      2040
     cgggcagcga ctggtggcgg gggaggcggg cgactggtgg gaggggggga gggggnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2280
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn cggcggtgcg acggcggatc      2340
     tgccgcgaga gggaggctag agggccgccg cttcccctcc ccctcacatc cggcgcgccg      2400
     ccccatctcc ccatccctac cagccggcgg cttcccccgc caccggcgcc gcttcccttc      2460
     ccatctccct cctttctcgc cggctcggcg cggcaacggc ggggttcggc ggagacggcg      2520
     ccgtcccaac ggcggcgacg acggcgtccg cggcggccgc gctccctctc cccctctcct      2580
     tcccgtctcg tcggcttggc gcagcgacgg cggggtgcgg cggagacggc ggcgacggcc      2640
     gtccctcccc ctctctctct ctccccgtcg gcctcgacgg cgacggcgcc ctcccaacgg      2700
     ctgcgatggc gtcggcttca tccgcgtgcg gatccggcag cggcggctcc ctccggcggc      2760
     ggtggtggcg tcggcggccg cccttttttt tttttttggc aattttttcc atggctattg      2820
     ctaaccgaat aggattgtgc atggacaaaa gatggacgaa aattagatgt tacaaccgca      2880
     aaaatacgaa tatttatatt agttatatag attatagatt tttagtttta gaaacttggg      2940
     ctcggcctgc tttggaaatt aagaagtcca accacgatcc gaaccaccaa atttttttaa      3000
     ggaaaacatg caatttaact cccagttgat cttttgttta taataatatc tcaaatagat      3060
     gtgcacgcct gaagtttctc tatgaagaac agaagataat tcatgcaaat attttatcaa      3120
     tgcactaata atgctagtca gatttctata tatctgtata atagctagca tcatcgtttt      3180
     caccttttcc taattgtagc ttatgcgtag tgaatttcca atacatgaat ctacaatctg      3240
     catagcaata tttacgtatt cacagtcgtt aaattttcgt taaattccaa ttttcgttaa      3300
     attccgatta agcgtatgta taccaattaa tcatttggtg gtaccctctc cgtcgaacat      3360
     gtgcattcgt ctcttcacaa tactagctta atttgtatcc ctctacccta tgtcgaccca      3420
     caaagtatta aaaccaatga gaaatgactc cgctgagagt attgacgcca gtgccatcgt      3480
     cgtccggcga agtccagcga gaggggattc gattggatcg gaagcaattt agcaaagcgg      3540
     cggcggcggc ggcaattttt acttttgttt ttcgtttcga ggaaggaacc aggaaaaact      3600
     tgggttcggc ctgctagtcc aaccacgatc tgaaccaaca aaatagggaa aaattctaat      3660
     ttgactccct taaataggtc ggtagaacgt agaggtcgag atgggggaca aggcttcaga      3720
     ttttgacatt accaaaactt aataggttaa caaaacaaat attatattgc tattcaaacc      3780
     ttaacaaaat ttggtacttt cagaaacttc ctcttataca aaccctaccg aattttaata      3840
     aggttacaaa ctaaacgcat ccaacactac caaaatttgg taacaccaaa atgtgccaac      3900
     ttttggcggt gccaaatttt ggcaaggttg atattttgac accaaaccaa acaagcttca      3960
     attagatgct atagatgaaa tggatcattg ggatccggtt tgacgtcgaa aacgaggcgg      4020
     cgctcggctc caggcgatgc caaacagagc aaagtggcgt gggcgcagag ctcggcgtgg      4080
     ttcgggccgc atgatagcca gcggagaact tggcggatct tgaagggtgg cagaacgacg      4140
     cccaaggatc gtgttccgcc gggtcttgac agcaagattg gctttggatt gctggcggag      4200
     tgtatgcacg ttaggtgctt gatcgacgct ccgccatggc tccaggaagg agggagcgaa      4260
     gcaaggcatc aaggtgtggt tgtggaggtg ggtagtggca tgaaacggcg gcggcggcgt      4320
     gccgtggttg gcgcccggct ggtaaaggtt ggatcgaagt tgggctatgg tgagaggtta      4380
     tggatttggg ccgtgcattc aggctcactg gccggggcag acattgtgtc gaacaccttg      4440
     tgggtatgaa cagtgtagtt ttcgcatttt ccagaaaatt ttcagataat tgattagata      4500
     gaatggaagg gtttttttag aactcatgaa tggcagggtt tactgcccaa gacaatgtct      4560
     cttggttgtt gtcaatcggt acaccacaga gcacagagaa atctgatgac aaaaggacga      4620
     caccccatat aatgctgttt ggaatatatt tactgagcag cagataactt caaactgatc      4680
     aaaggagaca ctcgtatatg ctgatgggga taagatgtac ggaaagacga tatatatcca      4740
     gcacacataa ttcaaccaac caaacagaag atcaaaaaag agaagatttg ggaaatacca      4800
     ttgcaaagat acgtgagttg taaaatatca tcgtacgtga gaatgacata tggggcctgt      4860
     acccacattt cagtgacaca tgatgtattt tctaactctg tgatttttgt gatggtacta      4920
     ggcaaattag cccatcaaaa aattagctaa agtgtggcac aaaagtatgt caaatgataa      4980
     caatgttagt atagcatcca aatttttgaa ggcaaacaca cggttcagaa cttcaaacga      5040
     gcgagaaaaa ggggggacaa tttctcacaa caagtgaact tcgaaaacga tcaaaattcc      5100
     atgcactaaa ggatagtaaa tgatgagaaa tttaacgata tgccactcaa tagaagtggc      5160
     tttaacaaaa tgccatcctc tagaatgacc ttataaaaat accactcaat agatgtggct      5220
     ctttaacata atgtcacttt aggctgtttg gaagctttta atcagaaatg atgtgtgaaa      5280
     tgacaaaatt acccctagtt cctttctcac atgtccagag tagaggaggg gccgatgtct      5340
     gtggggactc cttccccggt ggcaacaatg gtttgcgtgg gcggcaacgc tgtagtgggg      5400
     gcgaccacga cgccctctcc acaagcgcca aggccacctc cgaccacctc gctgcatctg      5460
     gttgcggcga cgtccatggc cactccctct tcttcttcgc tccaccctcg cttctacctc      5520
     tccgccatcg acgaggaccg tccctggtac caggccgaca acgatgcggc ggggctcgag      5580
     gagctcctca ccgcatgccc ctcctcgcta acgggcccac gctgtggtac cagctcgacg      5640
     acgacgtggc agggctcagg gagctcctcg ccgcgtgccc ctccctcgcc gacgagcccg      5700
     cgccatggta ctccttggct cgcggcacgg aaccgctaac cccgctcatg gtcgccaccg      5760
     cgtacggctc agtggcttgc ctcgacgtgc tcctctcgcc gccctacctc gtggacccca      5820
     accgcgcctc ggcctcatcg ctctccaccc cactccacct cgccgccgcg ggaggggcta      5880
     cctctacccc cacatcggtt tcccgcctcc tcgccgctgg caccgacaat gacaacgacg      5940
     aggtcgaaga gcgacaaggt gaggaaggtg aggaagaggc atttcggtca tttcacgagc      6000
     gtagtctgga aaaaaaatat aaaaaaaagc atcaaaacag cccaaaagtg gcattctatt      6060
     aaagagccac ctctatggag tggcattttt ataaggtcgt tctatatgat ggcattttgt      6120
     taaagccacc tctattgagt ggcttattgt taaatttctt gtaaatgatt agggagagct      6180
     cgaaatctgc aaaaattatc ggataattcg ggtgaatttg agaggggcag tgtggattta      6240
     caaatgatcc gatttgaaga gctacttgtt ttttttttct cctttggatt tatgggctat      6300
     ttcagtttgt tgctacttaa accttaccaa attttggtat ggcaataaac taaacacact      6360
     tcaaccatta ctactttacc aaaatttgat aattatagaa gctttctctc ttaaaactct      6420
     accaaatttt gataaatgca tcaaagcaaa caaagcttat agtattatac tatcaaaatt      6480
     tggtaatgct aaaatgtata taaatttgat attaccaatt tagtatggtt gatttgggaa      6540
     ataaagcgaa caagccctcg tgtgaccacc tgtgtgcgct ggagagatct ggaccgtccg      6600
     tttgatgctg gccgttggat ctgagccgtc ggaggcctcg tggattagga tatcatcagt      6660
     gttgttgtct tgtgggttgg acagtagact gctgataaga ccgggaatct ggagtcagaa      6720
     aacttttcgt ccagaaatca acactggatt tttggctttg ctctcactcg ttgagcttcg      6780
     ttggatggtt agtactactt cggtactaac gggttacttt gatcttaagg tcttcttttt      6840
     tggcccaatc aatcactgaa aatagagtta taaaaaataa ctaaaaattg ctttcttcaa      6900
     tatcagtcct ttaaaccacc tcaaatactc tttccttaaa agaaaaaact agtacttaca      6960
     attgcaccac agtgtagtcc aatttcaaca tttcggggag tttctctcgg ctgacactat      7020
     ttcgtccgaa atttacatag attttcttta ttttttaata tagtcaagct attcaaattt      7080
     gataaatatt tgattgctta ttgtaatatt ttgaaccgaa tttttttaaa gggaaataaa      7140
     ccgaaatttt caactctgaa gggaggtgat gggatgcgcg acccttctct catgcacatg      7200
     ggtggccctc actgcacgag ctcaatttca gatgatcatg aggagctaag ctcgatttct      7260
     ggcgttttca gcatgcctag ctcaagacca tacaacgtcc ctcccctgca cgcgggggta      7320
     agattaacag cctcatttct tcgctaatgc ttatgcttat caactaattt ttaaattttt      7380
     aactttaaat ttgatgttaa ttttgagttt tttttatcga agtttatttt tcagtcttta      7440
     attttaaatc gctaagaaca cgtatgtaaa atttctattc acaaattatc tttcatttat      7500
     aaatatgccg tttgtcttat tccatcaata agccgaacaa cgggggcctc aggctcaaag      7560
     caggtagcta gaacacacgc tgtactgtgc atttctgtaa atcatttttt tttacgaaag      7620
     aattttttcc atcttttagc tgaagtacct aaacaagtag agattccaat ttcacccatt      7680
     aattacgacg agataaatac aaccatttat gatttatcta cgtagatacc atacgccctc      7740
     ttgaagcaaa gcaatggcgt gaggcagcag cccgggtttg cttcctgaag caatcctctc      7800
     tgccgtaaac caggcgtctc aaatacacct gatcaaagaa aaacaacaag aacaacaaat      7860
     caggagagcc caaactccaa tccggaagac gctagcgtgc gcggaaacat cgcgtgagac      7920
     gccaagcttt tgcctaattg cctcccaggg gaggcatcca acgctgtccg tccattctcc      7980
     cctccgcgtt tctgatgacg aactgactag cgacaatgat cgccctctgc tacaggctac      8040
     agcagcttaa gcacggtgat catcgaggac accctagtaa tcaatcagtc agccatacac      8100
     ggctaatcaa tcagccaaag acataggact tgttttgttt gctaccatgc caaaatatta      8160
     ataatgccaa accataggta aatttgatag tgccaaatat tttagcaatt tatgtgtctt      8220
     attggtatat tttgatagca aactaaacac tagccaaact actattcaaa ataccaacga      8280
     tttagtgaga atttagacta ttcaccatca aattcacgtg cctcaacttt tttaccaccc      8340
     aatcggcata cccgctataa tatgtcatta ggactgttaa ttagtccatt tggtaccact      8400
     ttcatgtttt tttttactgt gtttctcatt tcttaatttc atttgtatat ttttttcaag      8460
     atttgtggac gtttttgccc ctgggcccac ctgtcataac caaagagaga tatttctctc      8520
     tggatcgatc gatccctcca gtctcatccg ttcgccgcca accccgccgc cgccactcac      8580
     ctcagcttgc cgcctcacca ccgagcgccg cccccaaacg ccgcgccatc accccgccgc      8640
     cgcatcatca cccaggcctg gcgccgctgc ccaggccaag cgcctccccc gtgcctggag      8700
     ccgccgccca ggccgagcag ctcccccgtg cacaaacaca attagtaaat gacattgggc      8760
     acaaacacta tatattgatt aaacaaggtt agtttctcag ttcagaagat ttagtgaagc      8820
     gaccaaggtg gcaggtaaag ctctcacatg gtggaagcag tggtagagcc agatgagctg      8880
     cacgtctgga ggcggcacca gcatcggcgc ctccccttcc gcggggtggt ggcacggcgc      8940
     tcgggggcgg cgacctgggg gcggcgctcg gtggtggccg ggcatgggcg agtggcgacg      9000
     gcggctagct gcggcggcat tgggcggcgg agtgggggtg ctcggcggcg gggttggcgg      9060
     tgcccggcgg cgaggttggt gctcacggtg acgagactgg agggatcgat cgatctagag      9120
     agaaatatct ctctttggtt ctgacgggtg ggcctagggg caaaaacgtc cacaaatctt      9180
     gaaaaaatat gcaaatggaa ttaagaaatg agaaacacag taaaaaacct gaaagtggta      9240
     ccaaatagac taattagcag tcctaatgat atattataaa ggggtatgcg gattgggtgg      9300
     taaaaaaagt taaggcacgc gaatttaatg gtaaatagtc tatattctcc cgatttagta      9360
     gaccacattt tggcatcaaa ccaaaataga ccctctccca gaatttgtaa atggctttgt      9420
     ggttcgtgat atcactgaac ctgctgggtg aataaagtaa aaaaaaaaac ccataaattg      9480
     gccttctgca agatctcgtc gtcttgccca aactatagcc ttcgatcttt ccatcaggac      9540
     cgcatggggg gagagcaggg gcaagtatga aatggagttc agattcagat tctagaacag      9600
     tctgaacatg cgacgacgac gatggcgatg tatctgaaca atctggtcct ctccctctcc      9660
     tcccgggcgg gcttccacgc ggctgagttt caggctccca atctgcagct cctcccagaa      9720
     ccttactctg attgattggt tcatcgtttc catggctcca atgaatgcaa cgtgttgttc      9780
     agattttctg aatcttgttc tcaatccgga gtacgtgctg tagcagcagc aatctgtccc      9840
     tgatctgaga attttagaca ctcgtagatt cgctgatcaa tcattccgtt cccttcgagt      9900
     ggtctagatt gagcttaatc atcctgctac tcgaatcaaa tcttcagcaa gtgagagcta      9960
     gataattcag aagaaatcaa catattcttc gcgaaaaaaa gaaataaccg atgaaaccac     10020
     ggtaattagg ttcttcgaat caccgggaga gtaggaaaaa acgagctaaa atcccacata     10080
     ggaggaaacg gttaaaaacg gccactccgc gtctccgccg cgagactagc tctcgccagt     10140
     ccacgtagcc caatccacaa ccgccacgtg ctccgacaat cccgcccgtc catcgccgcg     10200
     gccccggcct catctcgacc actcgtttcc tcccttcaca ccagccacgt ggcactctct     10260
     cgagagctcc cgcccgccta tataaacttg ttcgcgctcg gctcctcctc ctcatcgacc     10320
     tccaccccac attgaataat tatttttaat aattttagtt tttttttttt ggctttagat     10380
     atattcccaa tccccaacct cccaataatc cgatctctcc cagttctgtt cggatcaagg     10440
     ctgtgtcgat cgcaaaaaag aaaaaaaaaa caatttcctt ttggggtggt tcatctgttg     10500
     atcacttctt tgtttcccgc gttttgttgg ggattcgatt ttcgggttaa gattttctac     10560
     acgatggcct tgaacttggc tcagagcgcc gcggcggcag cgtgcttcgc gaccgccggt     10620
     gatgcgcggc gagctgcttc ggtggtcgcc atgccgtcgt cgtcgtcgtc ggccacgacg     10680
     agcctgagga tgaagaggca ggcggcgtgc gagccggtgg cgtgccgggc ggtggccagg     10740
     cacgtggcgg cggcggcggc gagcagcagg aggaacggcg tgccggtgtt cgtgatgatg     10800
     ccgctggaca cggtgagcaa gtgcgggagc gcgctgaacc ggaggaaggc ggtggcggcg     10860
     agcctggcgg cgctgaagag cgccggcgtg gaggggatca tggtggacgt gtggtggggc     10920
     atcgtggaga gcgagggccc cggccggtac aacttcgacg gctacgtgga gctcatggag     10980
     atggcccgca agaccggcct caaggtccag gccgtcatgt ccttccacca gtgcggcggc     11040
     aacgtcggcg actccgtcaa gtacgcatct ctcgtctcct tcctcgatca tctatctcat     11100
     ccttctcctc taacctcttc ttgttgttgg tgtggcgtgc agcatcccgc tcccgaggtg     11160
     ggtggtggag gagatggaga aggacaacga cctcgcctac accgaccaat ggggacgccg     11220
     caacttcgag tacatctccc tcggctgcga cgccatgccc gtcttcaagg gccgcacgcc     11280
     cgtcgagtgc tacaccgact tcatgcgcgc cttccgcgac cacttcgcct ccttcctcgg     11340
     cgacaccatc gtcgtaagta ggaggaagga ctcttttgat atcgttgccg tttcgccggc     11400
     ggcgacgacg acgctgatca tccgtgcgtc tccttgtgca ggaaatccaa gtcggcatgg     11460
     gccccgccgg cgagcttcgg tacccgtcct acccggagag caacggcacc tggaggttcc     11520
     ccggcatcgg cgccttccaa tgcaacgaca gggtaactaa tctccgacga gcaaaaactc     11580
     catttgggtc gtcatggatt cgagaaaaac tcttatctgg ataaattttg acgtcctgtg     11640
     gtgcagtaca tgcgtagcag cctgaaggcg gcggcggagg cgaggggcaa gccggagtgg     11700
     ggccacggcg ggccgacgga cgccggcggc tacaacaact ggccggaaga cacggtgttc     11760
     ttccgcggcg actgcggcgg gtggagcacc gagtacggcg agttcttcct gtcgtggtat     11820
     tcgcagatgc tgctggagca cggcgagcgc gtgctgtcgg gcgcgacgtc cgtgttcggc     11880
     gacggcgccg gcgccaagat ctcggtcaag gtggccggca tccactggca ctacggcacg     11940
     cggtcgcacg cgccggagct cacggcgggg tactacaaca cgcggcaccg cgacggctac     12000
     ctcccgatcg cgcgcatgct ggcgcgccac ggcgccgtgc tcaacttcac ctgcgtggag     12060
     atgcgcgacc acgagcagcc gcaggaggcg cagtgcatgc ccgaggcgct cgtcaggcag     12120
     gtggccgccg cggcgcgcgc ggcgggcgtc gggctcgccg gggagaacgc gctgccgcgg     12180
     tacgacggca cggcgcacga ccaggtggtc gccgccgccg ccgaccgcgc ggcggaggac     12240
     cggatggtcg ccttcaccta cctccggatg gggcccgacc tcttccaccc ggacaactgg     12300
     cgccggttcg tcgccttcgt ccgccgcatg tccgagtctg gctcgccgcg ggaggccgcc     12360
     gagagcgccg cgcacggcgt cgcgcaggcc accggctcgc tcgtgcacga ggccgcggtc     12420
     gcgctccgga gctagcacgg tcagacgctc atatacaccg tcgcctcgag gtcggattcc     12480
     gatgtgggat cattcgatct cccttttttt tttcttcttt ttgccatttt gtacagcctt     12540
     ttggggagct ttggatttgt gctttttgtc tcgggaggaa aaccgctctg gaggtcgaag     12600
     agagcgtcat tttcctcccg ttgaagatca cgaatcattt acgttagaga tgatgtaatt     12660
     aagcagggag gggaggggaa cacacacaca ctggcactca aaagttgttg tcacgcttgg     12720
     ggaatatatc catttccagc caaaaaaaaa acgcagaaat gcgttgtgtt cttgcgctct     12780
     ggttcgttgc tgctgtgggt cagattcagc tggtgaaaaa actacagtac tactgaaact     12840
     gaaactacta gagcctagag ggagattaag ctaagttaat tgcacgagta attactccac     12900
     ggttgtgttt agggtctacg tcggcagatt ttgctttctg gtagatccct aaccttatgt     12960
     ttgttgggaa ttttataaag gagctaagtt tgcctattga tttgcaatct acacatatct     13020
     cttgtgtcac aaaacattgg tgccttcacg tctttggtct cccctctaaa aacttgcctg     13080
     gcgaatttca catgaacttc acacgaagtc gttcatttct tgcaagaagt agggaaaaga     13140
     atcactgcta caaatggtgt gaagtaattc atttcttgca agaaatagga aaatttccct     13200
     gctccaaact aaagagttta caagaagtag ggaaaagaat cactgctaca aatggtgtga     13260
     agtaattcat ttcttgcaag aaataggaaa atttccctgc tccaaacgat aagagtttac     13320
     aagcgtcgac cttgagcgga ttactatctt tggcatgcta gtttgtggaa actgaaagga     13380
     ttctgcaact tacagtgtgg gactccagta atatgacgca gcaagttggc aaaatggcaa     13440
     taattcagtg attactaatg tccagctgcc aagcacactg acagtcccat catatcctaa     13500
     catcaaacaa gttttggata atatgaacaa catgagttcc ttcaagcccc atatcctaac     13560
     atcaaacatg tattggataa tatgaaccac ataagacgga aatccatcaa ggaagcaaag     13620
     caacaagcct agaaacaaac aaggtaagga gataaaatca cggcaagatg atctccaaga     13680
     cacgtaatcg agccaatcaa ctagacaggc aggttgacac ttgcaaccaa agataatatt     13740
     cacattcatg tatcatgatc ccaaagtcaa gacaagatgt ttgatcggca cccataacat     13800
     catgaaatcc catcaaacgt aaatagggtt atatgcatcg caaaattcta ctacaagaca     13860
     ccaagaagtt caacagagca tatcttcatt cttaaaagca aatagtagca cagtataaag     13920
     cattctgcaa aactcagcac agtgatctgc gacgaataat tttttgacag gaaccacaca     13980
     gaacaaaggt ccagactaat aatgctcaga gcgagcaaac ttctactcat tagagtgaca     14040
     gggatataga attggtagcg caggcagata gattgaaaat cctagtaacc acccttgaga     14100
     tcattgacca catcgtacgg gatgggggtg acagtctcca gtgttgcacc ctcaaccatg     14160
     aagccgggct taggaccctg cggctgcctc ttcgtgctga tgacctcacc acgagccttg     14220
     gcatctgcct tgagctggtc gttcttgatc ttcctcaggc ggaactcctc agtgcacctg     14280
     gatggctgca catgctccac acggacatgg atcctcttcc tgataatgcg gttcccaacc     14340
     taccaagaga ttaacaaaca atcagtaaaa cagatacatg atttcaaaaa ttaaataatc     14400
     ccgaagacta catatccaca tgactgaaca ttacacatgc cgacagctaa ctacatatct     14460
     atccaattta tctacaccaa cagaatgtgt ttagacggta gcatgttata tgattgaaac     14520
     atataactac acatgcacac aggattaaat gaacaatcag aagtatatct ttaaatgcac     14580
     ttctcataac tacatcataa aaccaaacgg ttaaactttc cacataaccg ataacaatac     14640
     aatcgacgta aacttgagga ttgatttgcc actatcctac ttggacgaat ggaaacctag     14700
     aaatgaaatg aaccaaagcc acaatcacaa tagctctact tcagtacaca acattctcaa     14760
     tacatttaaa gagaaaacaa aatccaaata ctaaagcaca aagtaaaatc gcacaaatgt     14820
     taccagtaaa tataaccagt aaaccatcta gactacacta tttatcagat cttacacaac     14880
     catgcaagag tatgcaatgg cttcccattc ctgcaactgc aaaaatgaaa tttcatattg     14940
     gcacaactaa actacatgat tccaaagtca cttggggcaa aaacatgaca ccaagtcact     15000
     taagcgacac aaccacagat ctatgacaaa gaggcggcgc cgccgccggg gtgtttgggg     15060
     atcgggggtt atacctgctt gttgatctcg acgccgatgg cgcgcttggt gacgttccag     15120
     acgcggccgg tgcggccgtg gtagaacttg tgcggcatcc ccttgtgcac ggcgccgttc     15180
     accttgacgt cgacgtgctc gccgatcttg taggtgcgga ggtaggtggt gagcgggatg     15240
     taccccttct tcctgaacgg ccgcgcgaac aggtcgcgcg tccgcgcacg cagcccgtgg     15300
     cccgccggca tcctggcggc tcctcctcct gcttcccttc gcgcggcggc ggcggcggcg     15360
     gcgggtgaag aggtggggtg agcgtgtgtg cggcgctagg gttcgcgagg gtttggagat     15420
     agtgctgcat tttatagttg cggtttaggc ttaggtttgc gtcttgccgt ggcggagttg     15480
     ggctgggctc gcaatgtggg ccttttatgg tccatgaaac aaagtctata gtacatcccg     15540
     aattaaggcc catgagctgt tcgtcttcgt ctggctctca gccattcttt ctgtgcgatc     15600
     caaatgaggg gcttttctgc agaataaagt tgcaaatgtg agggctcttc tttcctttct     15660
     ttgtgtgttt ttaagttata aagtgaactt gagggtgtga aagaaatata tttgcatttt     15720
     tttgttgctg tactggcatc attgttagct caatcctact tgaaattaaa aaggcaagag     15780
     tcccaaaaaa ttttcgacat atgtgttcag tttttctaag aaccatgcat gtctaagata     15840
     ggtctgcaaa cttcactgat aagaacatca gttcttggga tttggatgcc ggtaaataaa     15900
     aattacaggc actgaaagtt tcggaaattc tttctttgag atggaattct cccctctttg     15960
     aggtgaaagt ttctaaactt tttcttcaac tcgaaaatgt ctgaactgat cgagcaatcc     16020
     atggaaatgg aatgacgcaa tcagaggtga cgacgcgaca atgacaacgg gagccatcca     16080
     tgatccatcc aactacccac caaacaactc tcgtcggctc caccggcagc agcgagcggt     16140
     aatcactcgc tctcaccatg ccgctcctcc tccgctgctc gccggcggcg tcaccgcctc     16200
     tgctcccgcg ccgccgcagc ggctccctcc tctccgctgc gccgccgggg cgccggccgc     16260
     tgctccccgc cgccgcaggc cgcgtcgtgg tgagctactg tgatttgcgc cctctgctct     16320
     cccgctgcct ttggttggtc tgacctgacc tgactcctgg cgtgaggtgt tcttcttctt     16380
     gcagctgggt tgcgggctgg tgacgctgga ctacctcgcc acggtggacg cgtacccgcg     16440
     gcccgacgac aagatccgca gcggcgagct gcaggtgaca caccacacca aaccaaaccc     16500
     cccacttctt tagttcttca ccaagaaaca tggggaaaag attgacgttt cgctcctggc     16560
     gatttcttgg tgtttcgcca ttgttgcagg tgtctggagg tggcaacgcc gggaacgcgc     16620
     tgacaggagc cgcccgcctg ggcctcaaca cgaggctcat ctccaaggta aattgaattt     16680
     agagtcattt tgaaattagc atttacagtg cagcatttac tgaattgtca aattgagtca     16740
     tctatttgta cagcattgcc tagttacaag tacaaccctg ctgaagtgct gatgttctct     16800
     tttttttttc atcaggtggc aaacgatgaa attggaggaa ccgttctttc ggagcttaag     16860
     gaagctggga ttgatatatc tcatgttata gtaaggcttg gtttacaaat atataatttc     16920
     tgcatctttg ttcatcaagc gctgcaatgc aagtaatcat gtgtacatcg agaaggtagt     16980
     aaggtacaat aaattggtaa ccaaaatgtc aaggattaac aaaagaaaga tgcacagtga     17040
     aagatattgg ggtactatca atgcactgga ctttcttcca tgttatctta tacctcattg     17100
     ttttgatgat tctgctttgc agatttctga tggtggaaac acaacatttg tatatgtcat     17160
     tattgataag caaacgtaag aatatttctt ttgcatcatt acgataagag aactagtttg     17220
     tatcttcatg tagcaataca tgtaaatgga acaattaaag gcatgctcct aggttgtaat     17280
     gataagcatt tctgaaatat tccaaatgaa ttttctggtc accttgcaca ctcaatcagg     17340
     tacatttcga atgaagttca accaattttt agttttgtta cacctattta tattagagta     17400
     acctgactta cctttttata tataaaaaca aggtgctttt ataaatcatg gttctcactt     17460
     cattataaac ttccctttcg gcgcgtacac cgttcgctca gttattctaa aggactgggc     17520
     atctagatca gataaaggaa aaaaatgcat ggaaataggg catatatgca tttagtagat     17580
     acatgtaaat aaggataaaa attttaccct ccaactgacc ctttatactt gaccattttg     17640
     atgtttggtc actacttttt tgttttgctg gttactgaac atcctttata tggttgaagc     17700
     tgttaagctt gtctaagcaa tatggttatt tagccacact tactcaatta ttgctttttt     17760
     acaataacac tttctggcat catagcaagt ttctgtgcat attcatagaa gggccattta     17820
     catttgcaga aaaactcgta cgtgtataat cacatcaggg taccctccaa tgatacctag     17880
     tgacttgaga atgtcaagtt tgtcagctgc actgcaagac gtaagcttac tatacttaga     17940
     tggatattca gatgagatgg ccttggcagt tgctaagcag gtaagttcgt ttggagtgtg     18000
     caacattaat ccattcatgt atcatgtaat gctttcacca tgtagtctag gttgtccaat     18060
     cttcatacat cttagtagtt agtactgtct aggtaaattt caataatgta aatgaccttt     18120
     gttttacagt aacagtatca taaacctgta gagaattaga tcatattttg atttgttgct     18180
     tgattaaaac cagaaatgta caggctgatc agatgaagat tcctattttg gttgatgccg     18240
     aaccagaaag aacaagggaa gaattgggag gtttgctcag cctagcaagt tacatagtct     18300
     gtaatgggaa atttccagag gtttgtgata cattttgaca ggcatgaatg gttttaaaag     18360
     gcatgcttta gtaaagctgc attagttttt tttcccactc actatttaca gtgactcttt     18420
     acctacagaa atggacatca gtcccatcta ttccctctgc actactagaa atccttctgc     18480
     aatatcctcg tgcatgcttc gcagttgtaa cccttggaga aaatggatgc atgatgcttg     18540
     agaggggcaa agatggttag ttttgatctt gtccagacaa ttttaattac atgctggata     18600
     aagtttgtgt ataagttttg cctttgtgac ttcaacctat ttatctgcag ttccactctt     18660
     aaataggtga aaattatgaa actgagccag tagatataga gaatgtcgct gagtccttaa     18720
     ggctgaaagt agataaagat gatatcctgc caacttgtgt atcatctaag gtatgagata     18780
     tttctggcaa tcaaaatcgt ttacattgtt atgtcatcag aaatgtgagt aatttgatga     18840
     ctgctttgga tctcttttac tgctttacct aacctttttc cattttactt tctagttcat     18900
     gagacttact gcaagagggt ctgggaatat atttgcaagg ctgctcatag gaacagcaga     18960
     aagtattcca gcttcagagc ttgttgatac aactggttgt ggtgatgcat tcataggagc     19020
     agtacttcat ggtgagccat taacttcttc cagaataact atttactttc ttcattatgt     19080
     ctccctgagg agacgggaat tcgacataaa cagttattaa gattactact tctttgctca     19140
     agaatatgat tcttatatat atgatgctat tcaagtattt ttgttttaac taaatattaa     19200
     aatccagtta gctatcgcct atcattaatt atttattgtg acctcaatgt ttcctctatt     19260
     gaatatactt aggactatcc acagagatgc ctccagaaaa gatgctgcct tttgcttgcc     19320
     aagtggtata acaacttcct tcatttacag aaatgaaaca aaaatactac tagttttttt     19380
     gttcttcact tcttaccttg attgggatat ttcctgttca tgcttcaggc aggcatcaaa     19440
     tgtagagcaa tcggcgcacg atctggccta ccatggcaat ccgatccacg cctgactaag     19500
     tacctgtgtt agaccttgtc gaaattgcga gggacaaaaa aaagattgtc attgaataaa     19560
     tgatccatgt ttctactttc aaaaaaaaaa aagatccatg cttcagctat tgttcaaaag     19620
     tcgacaggtt gggacatggt gatctctttg taacatagag tcatagacta ccaggtcaag     19680
     gattggactt gtgatttctt cccttggagc tatcatttga agttctagag cattatgttt     19740
     ggtttaacaa aaccaatcag aaacaaaagt cttcagctcc ctgctgaatt taaggacttt     19800
     cagttgaatg aatgggttga ataaccgttg tcaaagttca gatttttcat agcaaaggtt     19860
     aacaactaca aaaatcgaga aaattggcat aataccatcg tcaaaacagg tttcgcccaa     19920
     ataccactat gcagttggga ttcgccaaaa tatcattctc aattgagggg cttcgccgaa     19980
     acaccatttt cttccaattc tctctttcct ttcatctttg ctgaccaaaa tgcccctagt     20040
     tgaattaatt caagtaaagc aaatatgtag attacagaca aagtacatat cgtccaaata     20100
     tcttgacatg caatatattt ttttctttac accaaattac agagtataag acactatctc     20160
     cacagcataa ataaaaaaat aattacgtat tttttatgag agtttccgtt gatagtgtct     20220
     ttttttttat gttatggata taatacgatg catactgtgt aagaaaaaaa tagcatgtaa     20280
     aaatatttta gcgtatttac tttataatct acgtattttg atatacttaa attgattcaa     20340
     ctagggccat tttggtcaat aatgatgaga ggaaagagag aattggaaga aaatggcata     20400
     tgggtgaagc ccctcaattg agaatggtat tttggtgaat cccaattgca tagtggtatt     20460
     tgggcgaaac ccctttttga tgatggtaaa atgtcaattt tctcgttttt tttaatgtat     20520
     gacattgttg acttttgacg taatgtttaa ccatttgtct tactaaaaat tatatgaatg     20580
     ttatttattt tgttagcaca tattttatca tcaaataaaa tataatctta acttatactt     20640
     ttatatattt atactaaatt ttcaaataaa acaaatggcc aaatgctatg cgaaaaatca     20700
     acggcatcag catcatacac atttatttat gcccagtgct gcgtcgccac gtcatcagcc     20760
     agctggcagc cggtcaacgt ggctgaccaa gcgccacctg caggctgcgg ccgacatgtc     20820
     ctctgccacc gccgccgccg gcggccgctg ccgacatgtc gaggtgcggt ccacgacagc     20880
     agcaagtcgt cggaaagtat gctactatgt cttgtttccg gcaagagatt gcaacttctc     20940
     cgagagacct ggcgaatcca aaccactgca tcgtccattg tccatggctt cgagctcgtc     21000
     gccgccgccg ccgtgcacgg tggccgccgg cggcggcatc gccgtcgaga ggagcccgcc     21060
     ggagtctcgc ctgtcagagc tcggcgccag gtcctggccc aagtataaat ctccctccga     21120
     tacatcatac gcgtatttta tacggtgtac aaaatacacg tattgtaccg tatatatgta     21180
     cttgtgttgt aggtggggcg gtggtccggg gaggatggcg ctgagctacg gcgcgcggca     21240
     gacgtgctac atcgtgagag ggaaggtgac ggcgacggcg acggcggcgg cgtcggcggc     21300
     ggagggctcg ccggagaatg ggcggcgcgt cgagttcggc gccggcgaca tcgtcgtctt     21360
     ccccaagggc acacggtgca cctggcacat cgccgccgcc gtggacatgc actacgcctt     21420
     cgacccttcc tgacaagtgg ggccaccaaa gaaattatta tcccctctac atgctgattt     21480
     tattactgac tcttaacaaa aggaattgtg tactctccct gtggttaact ggtcataaat     21540
     ggagtatttg agtttagaat gagattcgat tacactttta aaactttggc catcggtttt     21600
     acatttaaat aagtttatga tattatggca gtacttttca aagtaactaa taagtattgg     21660
     agaaaaatta ttgacggtca caatttcaaa tttttgactt aattttatca aatatttata     21720
     gccggagtaa ctcatgtcat ataaatgaca aatctctacg ataagaggaa aaggaaagat     21780
     ttttacctca atggaggtag aacaacgcaa gcattggttt cttcctcctt gccttggtat     21840
     tctgcatagc caactcagct atttgtaaca caaatttcac attgcaagga aagcttaagg     21900
     cttttcaaga gcagatcact ctttgccatt atcaagcaaa aactatacat tgcttcgctg     21960
     gatcagcagt tactagagcc aatccacacc agtgctcaga agattttgct tcagtgctat     22020
     gctacctgaa acatgcattc tggcaattgg attatggagt tatggaccat agatatagga     22080
     ttatggagtt atggcccata gatatatgat caacaacagt ttgggaattg aacttcatcc     22140
     ctaaaacttc agagcgataa ctgctaatct aaggcctaga aggcctgtat agccgctact     22200
     gtaaacaagc acccatggaa ggaaaaaaaa aacatttcta ccactgaacc tacagaatgt     22260
     acaaggaaca tctcttcctc ttcctaggaa ggaagctaac gaaccagctt gtcggtgacg     22320
     ccagatttta ttgtccttgg ggttcagaaa tgcggaggtt gtttgtcagg gctctgctga     22380
     atcccaatcc tcaaactcaa agtcaaatag aagatctaga gaatccgatc cttgcgtgtc     22440
     tctctgatga gcagcttcca ttagtaatcc gtccgcagtg gaacttactg aattattaag     22500
     atgggattca ttgggaacaa ggctaggctg gtgattgagg tgaggcaaaa tttgtgttgt     22560
     ttgtgcaaga caattgctgc ctatcatgcc attggccaca ttctgcccat tacaaggcat     22620
     caagttcgcc aatgccacaa caggctcact gtgaagacct accccctgga atgtaatgga     22680
     atcaagaggt tgagaaatag tcctgtctgg ctgctgagac tctgcagcgc ccatattgta     22740
     atctggtacc tccagatcag atgccagact atcaattatg tcttgccagc ttttgctgta     22800
     aacatccaat gctggttcag gcagtaattg tgttctctga gccgtaagag aaatgcaccg     22860
     agaaaattgt ggtcctgtac cgtgtgttcc gtttgaggca gcctgatagg acgacgccga     22920
     ctgatcttgt tgcccttgaa gcgctattgg ggcacttagc gatctctgag ggggattttt     22980
     ctgaacagta ccaaacaatg ttcttggtgc aacttgagct ggctgggatg catgtggcga     23040
     ggatggctgg tgcaactggg tattgttcgg agcagcagaa ccaaactggt tatcatttag     23100
     agttactatg cctggagaag tagcccctac tcgtttgaat cttgtgcgtg attgaggaat     23160
     ctgaatgctg ggagcattgc tcatacctct tccagccctt gttgcaggag ttgttcttgt     23220
     tgcactgaca gttctcccta cactcggtga gactcttact gatgtatgtc ttgtttgagt     23280
     taacccctgg ttcacaacat tcgcaagatg actttggttg ggaaagtaag tagtcatatg     23340
     cgattgtatg agtgaaattt cgcactgtgt atcttgctgt acaaatgacg ttgttgttgg     23400
     gtatacgaca ttctggcgct tttctggatg agatgttggc agacctttgc tcttgaatgt     23460
     atgtctcatt gctttccact ttttttcctt atctgtagca tgacaatgat cataaatctc     23520
     ggtgccctta ccccaataat tgcatggggc tggagtgtca catacaaaac agtggcactg     23580
     catttgaaaa gcgaacatgg aaatcgtgtc aaaacaaaat ctataagctg ctcctctagt     23640
     agattcactg gagggaaaat tatttcttac ttaccatgct acaatacttc acatgagaag     23700
     tggtgctgaa gggcaagtta gaacataaat ggcgggaatg agggaagtcc ctgcatgcta     23760
     cctgtggata aatagacaac tactagttaa ggaaaataac aaaagaaatg aatgctacta     23820
     catgtccact ccacactgtg gtttctgtta aaaagctagc atgaaattta tcatttcgtt     23880
     attacaagtg acatgaacta gaggtacatg tattcataga caaataggca agtacagatg     23940
     gggaaagaaa cacatgcact taaatcaaac cacttccacg ctatccaatg tatttgaatc     24000
     tgaattccac atcactgaac aaaggagatc aaactaaact atgcaatgag taaataagcc     24060
     ttcaaatgaa atcagaacaa tatagtaatt caaagttcag atcataacaa aatgacttat     24120
     tacgaacagt ttcccccaat tacgagaaca tttcatctct atatacatag cctacaaaca     24180
     taacaattga gctgctccta tttcatgcac agaatgcaat aaatacagat caaaatttta     24240
     gtaataagca attaagccaa aataccgggc ctttctctgc gacgatctgc aattcatccg     24300
     agctgccatc tccctcactc cctttctccc ccgcgacagc gacaacatca tcaggatccc     24360
     catccagcac cacgcaatca tcgtcgtctt cctcgccgcc gcaatcgggc ttgcccccct     24420
     tctgctgcgc catcaccggc ggcgccgaca gctcactcat cacctccaga tcatcgaact     24480
     catccgacaa agccctctca tcctcctctc taagaaggtc cgcaatccac ccgagggagt     24540
     cgacggacgc cttcttggtc gtcgtcgcca ccgccaccgc cgccgcggcg aagccctcct     24600
     cgtcggagct gatgtccacc acatccatcg ctgaccccat ccgctcggat tccgatcgga     24660
     ttagcaagaa ccggatccga gaaaccctcc ccggcccagg atgtcgccgg ccgccacgga     24720
     tccaggacga gaggcggctc ccaagaaact ccaccaagaa cacgccttgc ccatcaaacg     24780
     cgcagcgcga tcttgcgctc caccagccgc cgccggaaaa gatcgaattc tggcgcgatt     24840
     tggggggtga ggaaagcgaa gcagctgcct gcaagccaag aaatcgtgat gagggagaag     24900
     agcacgaaat catcatcaga agtgaagaaa aaaatagaaa aaaaaaaggg gattaaaccg     24960
     cgcgcgagtg gaagccaagt cagactccaa atgctctccc gattaaagcg gcgcgaagac     25020
     tcgcaacaaa gaagaagaaa aaaaaaagtc tcgagcaaaa tcgccaaccg aatcggcagc     25080
     aggaggaaga gaagagaaga gaagcgagca accaacctca cctcaagaag aagccctctt     25140
     ctccgccatg gccttttctt cttcttgctc tcgcgtcagg agcagaaagc agggggagaa     25200
     gctaactgct cctggagggt ggagtactgg agtatagaga gaagaaagaa gaaaataccg     25260
     agagaaatta atttctcgcg ctcaaaaacg tggattttat acgtcgtcgt gcttggtttt     25320
     ccgatgggcg aaaagccgtt gctttgcttt gctctttttt ttttcttttt ttcttttttt     25380
     tttaccgagt ggaaatggca tcgtgcattc gtgctcttag agggtttagg gtttccgggt     25440
     ttagagggtt ggattcattt ccgggatgag cagatggatc cgctttgact tggcctaatc     25500
     tcaaagtctc ggtgctaaac tgctaatgag tggatattgg atattaggat gaatatcatc     25560
     cgagaatcca atataaaaga tggtgtagtt gcataatcaa ttaggagcag ttagaatata     25620
     gaaagagtaa agtccatcac cggtccaccg ttgtatcatc tcggtcccta aactagcaaa     25680
     tcgactgttc aggttctcaa acttgttcga cagtattatc ctggtcccta aatttgcaga     25740
     tcactcgttt aaatactcta acttattcag ttgtgtcacc ccagtcccta aacttgtatt     25800
     tgaatatcat ctgggtcaaa tagaactgtc taaaaacttt atatttaaaa ataatttata     25860
     actttttcat gtgaattcta atgaagataa actttatatc aaacttacag tcctcgacgc     25920
     gatctacaac tttgtagttg atttttttta ttttaagtca ttttttgtcc caaaatgtaa     25980
     ttttaaaatt aaaatttcaa aatatataaa catgcaacaa tattttggga ccctaaacag     26040
     ttttaattca aaaacttttc aactataaag ttgtaggtca cgtctagagc tacaattttg     26100
     atataaagat tgtcttcatt agagttcaca tgaaaaagtt atgaattatt ttttgatata     26160
     aaatttttag accgtcctgt ttagggaccg gggtaacaca actgaacaag ttggaggacc     26220
     taaacgagtg atctgtaagt ttagggactg ggatgataca gtcgaacaag tctgaggatc     26280
     tgaatggtcg attttacgag tttagggacc gggatgacac agcggtacaa gtttagggac     26340
     cggtgatgga ctttactcat ctagaaatgt aggctgctgg ttgtactaat agagaaggat     26400
     cgacaagttt ttgagggtaa gaaatttata ttaatacaat acttcatctg ttctaaaatc     26460
     tatttttttt tgtaatctca tccgtagtag taagattgtt gaatttgtta ttaagttgtt     26520
     atattttaaa aacgaaggga gtagaattta tgcttaagta gaaaatattt tgatagattt     26580
     atgaaatgac ataatgatta ggattcaaca taagaacata tattttttta agaaaccata     26640
     agaacatatt tgagagggat ataatcggtg gagaaaatac tctaaatagc gcttgaagta     26700
     tttatatttt agtgtaaatt ttaaatgcca gaagtgttca tattttagaa tggaaggagt     26760
     agtgatgaaa attccgtgag ctcatagttt gggcaccaac catagtaaaa aggatcatat     26820
     tcggcaacca tagtagcata tcattggttg taggcttgta gcggcagcca ctctactgct     26880
     tttttatgtt tttagttatt tttttcatcc ttagtagctt ttataagcat ccggtctctt     26940
     tttaactcaa cacaaaacgt ataatatgtt ggccgatgag gctcatccta aatgaggaaa     27000
     atatatgatg caaactatac atatatacat atattgtaaa tccgaaaact acttctagat     27060
     atgtaaatgg gtgtttaaga tttatccata ttatcttgag taaatctttt tactcttaga     27120
     tttaatcgta gagagtaaaa attttagtcg agatgacctg agcaaatcaa acgcaattag     27180
     atctataata tataaatttt tagactttca tttgtgtatc ttatcttaat ttttagatct     27240
     gtaaaatata tttttctcaa atgggttata gagctataga gaagtaacca atacgtaaag     27300
     tatttacttt attcctttat tacttttaag tgaacgtgtc attcttttac ttcaatggtt     27360
     ttagttttat tttcattttt tagcatatac aaaagaatta ttagagtggt ttataattca     27420
     cagcttagac tttggtcaat aagacaaaca tgtagtgttg gtatttcctc cgttccataa     27480
     tataagggat tttgactttt tgcttatatt gtttgaccat tcgtcttatt taaaaacatt     27540
     tagaattatt atttatttta tttgtgactt actttattat ccaaaatact ttaagcacaa     27600
     tttttctttt ttatatttgc acaaattttt agaataagac gagtggtcaa atagtgtaag     27660
     aaaaagtcaa aatcccttat attatatgac ggaggaagca cataataatg atgttcattt     27720
     caaaagtcaa tagtttgtgc caaatcaatt aaacacatgc tcggattatc tttttttaaa     27780
     aaaaatttaa gcaccgctgc caattttctt tgcatttttt taaaaaaaaa tcgtgaggaa     27840
     gaaaaaaaaa aactcctcag cctttgcctt ggtgccggcc gccgcagtgg cattctgccg     27900
     aacacctcgc cggcgccgcc gtctcccccg tatcccggcg acaacccccc ccccccccct     27960
     ctccccaacc cccggggtcc acgggcacaa tggtgcacag gttcttctcc tgcacgggcg     28020
     ccacccggcc gccggcgccc gagaacgctg acatcaccct cgtctcgggc ccttcgtgct     28080
     ggtacgcgtc tcgtactctc gtctcacagc tccttttcca ccatgaatca aaccgaagct     28140
     gtttgtcgaa tcccgtgcgt tccgtgtccc atccccgatg ctgcggcttg gctcactccg     28200
     ctcttgctcc gatttcgccg cctctcctgg tgctagaaca gcgggaagac gtcgcttctc     28260
     ttccagttcg cgataaaccg cgcgacggag agtggacgag gcgtggtgtt catctgcagg     28320
     aaggggagac tggagaatag ccccccgttc ttgtcccagg tgagcgattg ttctctactc     28380
     gtgctctgga atcttgggtt acaaaatctc acctgctcct catttgtgaa gctaaatctt     28440
     actcttattt ctttctttca gggtattgat ctatcacaca gcgtgcttca gagaatccat     28500
     atcaagtatg agatctctct agttacattt tatttactat tgatgatttg tgagatttgc     28560
     atgctattgt cagctaagca tatggtctgt gatcgtattg aaatgcctat ttgtgttact     28620
     tcatgacaaa aagatgggga tttatgctct aatttatgta ctccgtgctt gtagatacat     28680
     tgaagatgat gagggcatca gaaagtactt cgcggcattt catctgcttg gcagcttccc     28740
     tgctgcagta attattgatg attttgcaga tttcttctca gaaaggtgtg tttttaattt     28800
     tgtcttgtcg tcctgcttga tcattctaga tttttttttt tttggtctca ataatctcag     28860
     ctgagaattc tgggcacctg tagttgtgat aatgatgatc caagtcctta cgtgcagaat     28920
     gtttggtgta gacttctgtt aggtctgtat gctccattat gatatggcta ttagttgttc     28980
     tactgaatga tgcattagac cacctgctgc acaaatttat tttagggatt ttctgatctt     29040
     tctgagaaaa ctaggtttga tctacatcat caaagcgaga actttataca ctatagtaat     29100
     tgacttgaat tatgtatggt gtgcattccc aatttttggt atgactagtt ctgacaatac     29160
     tgaaactata ggagctgtca gcaaagatat ggaaatgcta gggctcggga tctagcagtg     29220
     gttcgcatat tagctctgtg tcaaaatgct gttgcgcatg caaagtgagt gataaattca     29280
     atgccagatc tttaaacttc tgcatgttcc tatgttcctg agaataaaca tctcaatctc     29340
     tatcctagca caaagctcgg agtccctggg tcttgtaatc tcttgctctc tgatgttcat     29400
     caaggtgaca ccccaagatc catgttcatt tacaagaggt ggataagttc aatatataca     29460
     atccaaggta aatcttacaa gatatctgat gtacagtgcc ggttgtcatt ttattgttca     29520
     cccatatttt gttaagtaaa ccttttgttt ctattgctat tcatcggctc tttgtttcac     29580
     attaacagag aacatcttgt gcttgcatat aattcttttt agtttggaca tttactcgtt     29640
     gcattttata tccatctttg aaatcttatt tgatgaggta ccctcttggt tcattcactg     29700
     tagtaacaaa atatatagat gagataccct cttggtttca ttcactgcac ttacatagat     29760
     ggcatgacag tcaagatact tctcatttta gtttgtatcc gtcttagaaa gttttgtttg     29820
     atgagactgc tatgaatacc aactaaattg tccaaaactg taaatgactg attcacttta     29880
     tttgtttcat ttctttgtgc tatgtcagtt tctagtctat gatagttcat ggctatcaat     29940
     ctaaatcttt ttgtttcttc ccgttatgtt tgcacgattt aatttggctt ccttaggtga     30000
     tgggcatgga tcctacatac tcaagagcat tagcagttca gattgtgggt ccagggaagg     30060
     aagagcagcc aagtactcaa tagcactgca atatcttgtg cttgaacata tcagcaatgg     30120
     atagatcata ttttctactg tttggtccca gtacccaaac atgtacaatc ataaccttgg     30180
     agaagcagaa aaaaagactg ttccagctag tttggtatgc acgaagagta tcaatttcaa     30240
     ctggcacaaa tgtgttcatt gtaaacgaga actgcatcct taattgaatg tatgtctatt     30300
     tatgaattag agccaacccg aaaacaagcc gctactgggt gaatagattc tgttcttcta     30360
     gttcattttt atctcagata aagggcagtc agattaatgt atacgaattt gaacttctgg     30420
     ggaatacatt cgtttgatct cccagtgaat gttttctacc aagtaatttt tgctcgattt     30480
     ccttttttta gaaaataaca gaaagtaatt ttgttcggtc ttcaactcac taggtgaaca     30540
     aaaagtaaat ttgttcgatt tccttttcaa aaaagaacaa aaagtaattt ttgcacggtt     30600
     tctcttcaac tcatatgaac aaaaattaaa tttgcttggt ttctcttgaa ctcacttgga     30660
     cagcaagatg acttttcaaa gaagaacaaa aagtaatttt tgctcggttt ctcttcaact     30720
     cacatgaaca aaaaataaat ttgctcggtt tctcttaaac tcacttggac agcaagatga     30780
     acaatgaatg taggttgtag aatggaggat tttttttaaa aaaaaaaaag aaagaaaaac     30840
     ctggaaaaac ccgacaacct actcattgag ttctttgtag taaaacagcg tgaagatttg     30900
     gattaaagtt gaaactgcaa gcacatcata atgggcagtg gaaggcaagc tagatgaatc     30960
     ttatgaccag atttccggaa gaatcacaga ttaactggaa aactatcctg cttatatgag     31020
     caaatgctgc attacaggtt gttcactcaa aggttcaccc agacttgatg agtccatcat     31080
     cagagaaatc tattattttc attgtaccat caccacattg aacaaattga catcggtgag     31140
     aacgatttgt gggaactaca tgtttcagat cagaattgca gagagaaaaa aggctgtgct     31200
     gaaggcaatt tcagaggcat ggaactctca agatctctgc tcaataaacc aggacacaat     31260
     ttacttcccc aactaaaaat tagtaataca caaaatcatt aagcaactca ccaactcccc     31320
     tcatgacaaa gatggggcca agcagctcat agatctttaa caatctcaat gcccatggag     31380
     ttggctgtgc caatgattga cttgcacagc gcctcgagtg acatgtgctt gcagtaggga     31440
     tcagattgct tcaatttcgc gatctcgtag acatggcgaa gtgaaaggga tgacactaca     31500
     gtgtgccctg gacggccgct ggctgtctca atcccggcgg ccttcttgag gaaccatgag     31560
     acagatggtg acttgactac aaactcgaat gtgctgtcct tgtaggcagt taaggtaacc     31620
     tgcataggag tttctgcctt atacttctga gtcctggcat tgaaatcctt gcagaacgcc     31680
     atcaggttca gcctgtagaa acctagcgct ggaccaactg gtggcgcagg gcgggcggca     31740
     ccagctggaa cgataaggcg gattgttgcc aacacaggct tccgtgcaac tgcatctttc     31800
     agagtggttg ccatgccgta ggcttatgaa gatctgaacc gaaacaagac cctccatcaa     31860
     aaccattaat gttcaacaaa aaccagcagg aaataacatg aaagagaagt cagagaaata     31920
     tttgttgata actcgaacgc aacatcagac ttctattata caagggagtt tattgttggc     31980
     attctcctag agaacttctc tattattgaa tgaaaaaact tgtcattaat ttacacagct     32040
     tctaatgcct ctcaggagtt aaaacttcag aaaggagtac tttcatcgtc tcctgtcacc     32100
     tctatgctgc attatacaag ggacttcact atagaaaggt aaatcagcac cgaaaccctg     32160
     aaaatgatga gctgtttgaa agaaagaaag ctacaaacta tccttatttt agcacttcaa     32220
     ttatatattc atatcaattc tcttaaggca cagcggtttc agagttcctt accaatctct     32280
     ctcttaagga catagcggtt tcaaccatac ccatttccac aagaatcaca tattatcact     32340
     tcaatctatt tgatacggag cacagaagga aaaacatcac agaaaaaaaa gcgcaatcaa     32400
     ccaacccgat cccctccaca ccctctacgc cctaaaccac cagagtaact agaaccaacg     32460
     aggagagagg gagagcacca cgagctaatc cgacctaggt gaagacggga aggggggctg     32520
     ctatgtgaga ggggagggag tggtacctcc ggtacgacgg cggcggcggc ggcgctccgg     32580
     gacggcggcg gcggaggatc ctccgggatg gatcgaatcg acttgttgtg tgtctgtgag     32640
     tgggatggct gcgcctctct ctttgttagg gttttagttg aggcccacac gaggcccatt     32700
     actgatccac tcgacaattt cagcccatgc cagaacatat ttcatccacc atccgattta     32760
     tatccaacgg ccatagtttg atctttgaat taaaatttga tcacatataa ggatttacct     32820
     tcctggccca catttcattg agcttgttat gaccccacat gttagtggca cgggagagtc     32880
     ctcattattc ttttgtttga aattgaggat ttaccctcct tgcccacatt tcagtgagct     32940
     tatgtgacca cgcttgtcgg tggcacggaa aggtcctcaa tatacttagt ctgccttgat     33000
     gtactgttca aggtaattcg gatgctgcca gatttctcag attagacgac taattagtta     33060
     accatcaaac cattccttaa tatcgcgcca gcaactttga gaaatgaata aacgagcgtt     33120
     agtgcatgga cattacgtaa ccacaaattt aaacacattc tagatttcat tggcatgtcc     33180
     gcaagtcgag cacttcagca ttgtattcat ctccaaaaca aaccgtatcc tcattaggta     33240
     gtaaggccta caaatacaat aacaatgtca aatttgttta catcgaccaa agcccaccaa     33300
     attgctcctg caaggaactt ctcgtctccc gttgttatgt gcctccaatc tcagccagct     33360
     catccaccgt caaaacacac aaacagggag caatttacgc aggccaaatg aagtacaatt     33420
     ggtttcatca ctcttccgat ggctttgcgt cgtccatttg atcatcttct cccggatgcc     33480
     caaatatccg taggttacga tccatagaac ctacggcaat gtacttcgca tcggtgccaa     33540
     acttgacgtt tgtcactttc cctgagaaaa gtgtacgcca cagaaaccaa attagttaag     33600
     tgcaagcaca gatgccaatc acgaaccgag aatgtgggcc ataagaaagg gacgaacctg     33660
     tgcctgacaa atctggtaag gtcttgacaa gattccattc aagcttaaca tttgctactt     33720
     ggtaaaccct gaaggccaaa cagaggaggt atcaaatata aaagtttacg gtataacatt     33780
     tgcaccaaaa ggtcagactt gcaggttttg agaaaatacc ttgtatctga accaccaaca     33840
     gctagataac ttccgctaaa gtcaaattcc actgtaagat aaacaaaaaa acattcatgc     33900
     atcatatgat taatggaact ccagtacaaa taacaaaaat ggaatgagat gtccttccag     33960
     ctacaatcaa aatcctagaa agcaagatat atctagggtg aatgatcaac ataatctcgc     34020
     ttgttggcta tatctataca cacatcgaag cacatgcacc attcacaatt tactgtgagt     34080
     gtggagcatg cgcaaagttc cttaccagaa tttgttggcg tgtctgagtc ataaggtgat     34140
     atcgtcctaa agtttcttaa ttttcgaaga tcccaaagct tgactccatc gagagcagca     34200
     gtctgtacag tgatgataca tatatcagaa taaaaaagaa attcaacatt ttgcagattg     34260
     cactatggag agattcatac cgcaaggaag taaccatttt cagagaagga catagcagtc     34320
     actggtccaa catgcccctc aaactttgca acatttgact agagaaaaaa gatgattgtt     34380
     agcaaggtat ttcaagagca gacatgcatg aacacctgaa aaaagaactt gaatgagttg     34440
     ccggagtatc acacctgcgt cttcacatcc caaattttga caacagcttc agtggtccct     34500
     gtccccagga taagaccatc tgggtggaaa gatgcagatg tatatccctc ttgtcctgaa     34560
     gactcgccaa cctgagtaaa gaaaaggtat tcattaactc ataaacatct tgggagctaa     34620
     cagacaaagc atgtataagt acatggatga atgggagcag gttacatgag aaagataatg     34680
     gagtaaacct gtgtgaggca agatcctgat ggaatatcgt agaagcacca agtattatcc     34740
     ttggaagcag tcacaaagta cttctgagtc gcatggactg taacagcttc aacctgacag     34800
     atttttgtaa aacaaataag tttgaaacaa tagaatttga attgaaacat tttatattac     34860
     caattgaaat attacaatat aaaatatggt aaaagttgcc ctgtttgatt tatattactg     34920
     agttattacc atggattatc tatataaatt aaatattttt aaaaataaac tcaataaata     34980
     gcttaaaata agttatctaa gaaatgcagc aaaagaaatt tttttgagaa gatgtatttt     35040
     ccaaagtata tagcaaataa tccatttcaa taatccagtg cagagaataa tctgtaaaga     35100
     acaagggcct taagggcaat gatggggcat gttcacatgt tttgtaactg tgaagagggc     35160
     ctttaaggac aatggtgggg cattttcaca tgttttgtaa ctgtgaaaca tgaatggacc     35220
     agagtagcta acggtacaaa tgataaagaa aatttgatga aagaactgca tttgcagtat     35280
     gacttgagtt ttgagtatca tagctcaaca tgccaaaatg tgttataatc atatttgtga     35340
     caaatccttg atagatagaa atttcataaa tattttcaat tttactgtaa cagaaattta     35400
     gaagccacag aaaggaaata tgactgtatg catgcaagaa gaataccagc tatccagcaa     35460
     tctgtaattc caatatccaa aaacataaaa tggcaaagaa tgtgaagtta ttttgcagaa     35520
     gaatatccac gcaattgcta acctcggcag tgtgatcttt caatgtatgg atgcaattgt     35580
     aatttccctc ctcgcttcct tgccaaattt taacagtctg cataatttgc aaacaactca     35640
     gagaagaata aacagcacaa cctaatcatc agatagtcgg accagtgact gcaaacatgc     35700
     tcaacctaat caagtactgc aggaaatgat gcaatcaatt ttactagcaa aatcaaaact     35760
     tgattattgc atcaaattta tgtgactaat taatctatca gagaatggca taccttatct     35820
     gctgatccag ttacaaagag ctcatcccga ggaacaaatt tcaaactggt tatctatata     35880
     tatgaaggtt ccaatgttaa cataaatttt agagatagat taaaaatcaa ttgagtgcat     35940
     ctaaatcatc aaaataaaat gagggaaaac cttctttgag tgaccagtaa gtgtgcacaa     36000
     gatttgaccg gatggcctgt caaaaagcac tgcgtttgta tcaatgccac cagttgcaat     36060
     aatgtcctgt taatccagaa taagaacaaa gtaaaataat aagtatttaa atcaccgttt     36120
     gccatcaaat tatcaacatt aaatccaaga cgaatcaaac agataacaaa ataaaacaaa     36180
     ctacatgtga accaagcttt tcaggagagc atcatgttgc aggtacaaat agaagtatta     36240
     gtgatataat tattcaatta atgtgaaatc ttacacctaa ttgaactgaa aaggataaga     36300
     ccacagagta tatgatattc aaagcaaggt acactaaaaa cataaaagac agacctttga     36360
     aggatgaata tccatagata agatgcctgg tttgtttgtc ttgtgaagtg gatgactgga     36420
     gatctgggta tatctctcaa ttgcatcaat tgatgccaaa gttggaggaa cctgtgagaa     36480
     aatgtagaga actgttatct catttcaaaa gtaaggtgta aagatggcaa caaacactga     36540
     gaaataatgt cctggcgaga tgagctagca ttcttgagat aatcttaact attggataaa     36600
     aacattaatg catgttttag accttgtttg tagcataact atgaatacag atatgtacct     36660
     gtcgtttctt acgatgcgca gagagcatgg tattacactc tgttagttca tcaatcatca     36720
     cagggttgat accaggacga atcttcttcc cgtctggtcc aacttcatct tcaaatgctg     36780
     aatccaacaa tgcagaacta tgagaaggct gaaattatat gtagaaattt acttcaacaa     36840
     cttcaaacag tcagaaagta ggtacctctt ttcccgttgg agacaacagc tgtaggtgca     36900
     gctcctgcca tcgatgcagg aatctgtctc tcagcttgag ccaaaagtgc tctggcttca     36960
     tctcgttctt tctttaatct agctataaca cggcaggcag catcatgctg gaaaagggac     37020
     ataaaacaac taaacagatc agattacagg ataatgaatg ttcttaaaag caaaagtgtt     37080
     aactaaaaga gcatttcatt aaaacggtat tcagcattta acccataata gagctgttta     37140
     atcaagcgct gaaaaaaaaa tgtagctgta aagacaagca atgccttaac aaagcttggt     37200
     acttcagacc ttttcctcaa taacttacaa gtagtttttt aacatatcaa cttgcagtaa     37260
     taatacttca ttggccctgt ttggatccaa gggatatttt ttagccctcc ctccaatagc     37320
     ccaaatagcc caaaaagatc caaaagggtg agctatttga gggctatttg gaaataaccc     37380
     acccaaaaaa aactatccca cccaaggggt gctaattggg gctatttcgg gtgggggccc     37440
     actgaaaaag tgtcttctct ctatctctct ccatgggaag ctacattaaa ggccaaatag     37500
     ctctcaaaat aaccctttga tccaaacaac ttagggctat tttattggag ggctatttcc     37560
     ttgtgctaaa aaatagctct caaaataact tttggctagt tctccaaaca gggctattgt     37620
     tttcaagctc aaaccagact gcctagagca aaaaaacaac ctaaatatca ccagttatat     37680
     ggtatgcaca agaacccaga acagcatcac acatttctag actggtcagt gaatgattga     37740
     ttttataagc attttttctt cagcttatga aaatataaat tgcagtacaa ctcgaacagg     37800
     agcaggaaca aggatagata tttaacagtc aacttaacaa tgcccgtaca aaactagtgg     37860
     tcatttgcag attagcgaac tttagttaga tgggtaaaca gatcagggct aacattgttg     37920
     cccacttcac cacaggatta gtgccaggaa ataagccaac aactatacct tgtacatatg     37980
     cacaacaaga agcatagaag gaaaaataat ctgtaaatca tcattagcca tcttcggtac     38040
     tataagtgaa aaggcacaag caccagcagg ataaaaaaaa gacaaatgtc aaatacaaaa     38100
     aaagaagaag aagaaagacg atactccctc cgtcccaaaa tataaggttt tctagagctt     38160
     ttgagggaga ttaagaaagt aggtggaatt taatgaggta tggctgtaat tagtggatat     38220
     gaggaagtat gtggagatat taaatgagag atggttgtgt gattggttga gatgaaggaa     38280
     taggtgaagt tgctatattt tggatggagg gggtagttta tcaagagtca aaagagtgac     38340
     tcaagattgg gaatcaacag tgctgattac agggataaat tcatctagaa tcaagagtca     38400
     agtagcattt ctaaataaaa attcgaattt ttattatgta aggacgttca acatcctact     38460
     gcatctgctc taaccataca caaatacaaa atggccacca gagttcctaa aagagagcac     38520
     tgttccatag caatctaaca tgccccaaca atagacctat ggaaaagctc aaaatcctct     38580
     gagcagatcc ttcatcagct aaagctgcta gcatatgtag aactataata acattcatag     38640
     tttgtcaaaa gaaaagggaa gattttgtac ttaacatgat acaatatgta atagaaattc     38700
     tgcataggta aaagacatac ctgatatagc gcatgactaa gttcttgtct tgctgtatga     38760
     agctgctgct ccaaagcaaa actagaaagc atgatagcat cccactcctg taaaagccat     38820
     ggtattgttc tagtgagagc tagggtgaat catgatgggt tctcacaaga catttttagt     38880
     tccatgatta tttgtggcaa aatcaaggca ctgtactata ttactcttcc taatagttac     38940
     atgagatcat ttaaactgag ggcgatgcaa attttaggaa acaaagacca gaaatttaac     39000
     tctaccacag aatctctgaa tctgctttaa acataaccaa tgagcaggca gtttgccaag     39060
     ctccaattat gaagattagt ttactccctc tagtaacctg actatgcttg gaaacagcgc     39120
     attaagttct gtcaaactgg ctggtgtgca atggagaaag acacttaaca ctgaatcatt     39180
     cccaattatt atgcaacgtg tttatcttta attcaaacat cagataaaaa gtactttcag     39240
     gtacagtttt aaattaacaa actatacatt taataaacaa aacaatgtga gaactattat     39300
     caaagaaaaa gaatcagatc ttcactgtct ataacacaga taactatgaa gttagtggaa     39360
     ccacttacat tttggaacat ccccaggagt ccgggaatgc ttgcagcctg caattgtctg     39420
     ggcttcacaa cctgcaaata gtataacatg attgaggcct tgaggattat gcaagttttt     39480
     cagctaaaag gtatagcacc atcagttact tgtacaaaac ataggtaaat ccacgccaca     39540
     cgctgctgaa gcctgccact ccacaataat tttctcagca ttccagcgaa gccttacctt     39600
     gttggtcttc accgccacga tgtcgtccat ggtgagctcc tccttggtga ctgggcactt     39660
     cccatggtcc tgcgccatgg ccacgaccat gaccaccaca agaaacatca gctcaaagca     39720
     cgacacacaa atgcgacgcg agatctaaac ccacggaagc tataataacc ctaaccgacc     39780
     tcgatgtagc gctcgacgag ccgccgctcg aagagaagcc cggacttctt cgacaccacc     39840
     ggctcatccg gcacctcgcc ggagacttca caacaggcgg aggccacaaa tcagcgcacg     39900
     cacggagaga acagctaggg tttcggagag acagtgagag aagcttactt gcgcagatca     39960
     tggctgcggc ggcggcggcg acggagagtg gaggagggga ttagcgcgcg cgcgcgcacc     40020
     gaggctgctc ctcccaggca gctctctctc tctccggcag tggtggtggc ggcggcgccg     40080
     gcggcggcgg gggggagcgg agcaggttta gccggctagg gttttaatcc gaagcggggg     40140
     cgaaaatctc gtcgcttgtg cggctcctcc ttccgccgtg gtccactcgc ggtgcctgaa     40200
     atcggtcgcg caagttgaac cgtttccatt gggtgattgg gctttaactg cgtgggccgg     40260
     ctaagtttgg tgggccgcat tttgggtcct ggaaaatact tcgtgggcta tagatgttgt     40320
     aggcttgtga aatatctggc cgaacacggc tacgtaggcg gtacctacga taccgtttct     40380
     cagcttctcc cctcctctac cccacgcacg gttctcaatt tgctaaagac agttgatttt     40440
     cagcgctttg atgtgaaaat taatttttaa tatatatatt ttcactacaa tcaagctagg     40500
     ggtaaaaaaa ataaatgaaa taccaaggct tatcagtttt tatcatgaaa caaacaaata     40560
     aaactcacac tttaattgat aagtttatgt taaatatcat aagaatgatt gataggtttg     40620
     taaaaatatt gtggaaatga tgtgaggggt gatgattgga tttatactat acataatgat     40680
     ttgtagaatt aaatagattg tagatgatgt tgcatgcttg aatgagattg agtatgtaat     40740
     tattgctagt gggtgataat gtggcatggt tgcatattaa gcattagagt tagtgggttg     40800
     taactttata gagagtatag attgtgtttt ttcaaaaaaa aatctatgga aaaattatta     40860
     aaatactaat acttagttaa ttatgtacta atgagtcaca tcgttttata tatgagaggg     40920
     attagttttc atcccaaact accgaacaca gccaaaaatc ttcaaggagt atcatcgtac     40980
     aggcttgaag ggaatcctat cttactataa agttatcccc cactaactcc ataaccttaa     41040
     catgcaaaga tgccacatca tcatctacta attaacaaga tgccacatca tcatccacta     41100
     acaatcatca catttaaaca tcatgcaaat atgctatatc tttatagttt ttataattta     41160
     agagcttttc aaatacaaaa atgttaaatt atcatccaac ataattcaca taatgtttca     41220
     atgtatatat ttattatgtt ttatgatata ggtatatagt tcatcctcac ttagtgctta     41280
     aatgattaat ctatggtcca aattatcttc tccttttttc ctctaattaa gtcatatcac     41340
     atcaattgtt tttagccttt agataattaa tctactgtcc aaactatctc catatttttc     41400
     ttcttccata aagtcatacc accttacttt ttacgtttga atcaccattc tacatactat     41460
     ttaaatttaa attatcataa accacattaa ttcacttaat ctgatgttat atagctattt     41520
     tacacgttat tttttttatt gttatcatac taaattctcg cagaaatgca cggagtttca     41580
     cctagtgatg gtaataaacg ggacaccatg catctcgcct ccctgcatct cgccctgtcg     41640
     atgtgcatcg acacctcaca gcatgaccca cccctaaagg cacaaagtcg caactgatcc     41700
     tgtgcatcca tgttgacatg tacacggccc ctctctcaca gctgaaacct gaaccgcatc     41760
     gccatcctga tatctaggct tcacgagatg tagtgccttt tggagctaaa gtccaaccaa     41820
     acagtttcag ctctatataa agcggagcta gatggaacat tctcaataaa acaaaacgag     41880
     atgtgaaact ggatttaagc tgctctatga atttactctg tacccaacca tttaagctaa     41940
     attttagagt tgaaacttta tcaaatagac ccgtagtgct ccgtatgggc ctgtttagca     42000
     ggggtggagc tggagctcag ccaaacagtt tcagcttccc taggtggagc tctctcacaa     42060
     aatgaactag agttgttgag ctgggtttag gcagctccac aactccactc cagacccaac     42120
     tcctagagct aaatttaaga gttgaagctg taccaaacag gtccacatat tttccgctcg     42180
     attttgctat atctcacacg aaagattttt tcttatctct cactcgattt tctcactcaa     42240
     atttacagtg cattttcttg taagttacag tgtaatttat gaaacttaca ctgtaacttt     42300
     tgtaagttac actgtaattt ttgaatcttc gcatgtaaat tttaaatttt gtattggatt     42360
     tggtcttttt cttgaggata tggtaattta gtgtccatta tggtgtttct taattgcttt     42420
     ttgcttttta ttatatctat cagattttaa tctaaagatt aaaaatctgt gtgatacgat     42480
     tataaaaata tttcgaaaga tgcataggta ctcccttttc cgctcccgcc tacgcacgct     42540
     cgcgcgggcc ggcgcacggc cttgagccga catgagtaca cgatcgggcc gtgccatata     42600
     tatggccccg gcccccatcc ggccgtgcgc gtgtgcgcgc gcgcgattcc accatgtttt     42660
     gcgcgagaaa aacacaccgc atcaacagct cgcgcgcaca cacggctccg gaaaaaattt     42720
     tggtggagac cggatgcaag ccccttcttc tgcagccctg ctctggatta ttgacgcgtg     42780
     gatgatgtat cgatcggact atcggacggg gcgctccgct cggctccagg ctcacccgag     42840
     cccgatctat gcgcgtgcgg ctgatggagc tcgaggctcg atccgtccca tcccggcttg     42900
     atctgggccc gcgcggcttg atcttgtcac cgccacgacc atcggaggat ggcggctgct     42960
     cggggttctt gatctggatg aggtaggacg ccttcgaatc cacgttcatg gcctcccgcg     43020
     gctcgatggc ggcgacagcg gcgtcggcat catcgtgaca acgggccggc gaggggagct     43080
     cgagcttgta gatggatgtg cacgcggtgg ccgtaccacc gtactcgccg ctagcctgtg     43140
     ctgtgtgcgg tgtgtcgtcg tgttgttctg aaaatcaaaa ttcaaaacaa cgatgtcaga     43200
     ctacatcata gcatcggcat gcacatctga cactgacacc aatcaattta tgattttgag     43260
     ccacaatttg gtttacatca attatcttcg aatgtggtga cgagctcgac gtatccccac     43320
     tccccagtag ggccggcagc agtcgcgcag gctcatcttc atcttcccca atccccatca     43380
     agaattcaag aacagccgga gcagcggctg ctcctcgatc gatgttcacc tcctgcaatc     43440
     aacgacagca gcagcttcga aaatgtccaa aacatctgta attctccatc tttcccttgg     43500
     ccagtaatac gagacaacct ccttcccatg tccaccttcg cggccgtcat ggcttcttgt     43560
     gtccattgac ccattcttgc catagtccgg cgcatgcttc tcctcgacgc cgccgacggt     43620
     gacaagctgc acatctaacg ctacttggta gagcagcggt ggtagcctgg taggcggtgg     43680
     caacccggtg tggaggcaga aagcgacaac gactccctca atatggaggt tgaacgagga     43740
     ttgacggcga acgggcaggc ggcgtcctcc tgctcatgag ccgctcacgc tcagatcgag     43800
     ccgggacgga tcaagcgcca tcagccgcat gcgcatagat cgggctcggg tgagcctgga     43860
     gccgagcgga gcgccccgtc cgatcaatac atcatccacg cgtcaataat ccagagctgg     43920
     gctgtagaag acggggcttg catccggtct ccaccaaatt atccttagct acccggcctc     43980
     tctacgtgga agaaatccgg gaatcgcgcg cgaggatgat cgacgtagcg gtgtgtgccg     44040
     gtgttgcggc aaagcggcga cagtcagatc ccccggtttg gcctatgcac attccatagc     44100
     tagtggtaaa gctaacacta ctcctgcact ttcgatctca gacaccatac tttcgatcgc     44160
     cttctatacg tttcggcagg cgacagcaaa cacaggttcg acgtatgcct tactgcatta     44220
     aacatgctac tatacgcaat ggtaaaaagc tagtgtagtc ggcagctggc ccacggcgat     44280
     ttggcctatt gacgaacgga tacaagattc ctatcagagg tatatatgta tctacctagc     44340
     tacttgcaaa agggtactag ctagcgtgca tggcgttgtg aagaacgttg tgaagaatca     44400
     cgattgatgg atgtgtgttg tgcacgggcc gtgcaatgca tggctagcta tggcaaagct     44460
     aagctaagct aagctggaag ataagccctc atgggggtga caagaggggg aggaagctgc     44520
     ttttggggga ctgatgggca ttagttctgt ctggtaggct aaggtatagc tttatctgtt     44580
     cgatctcatg gactaatgta atatcctttg ggtgctaatt gttgttgtgt tgctgacagg     44640
     attgattttt aatcttggac attacacgcc gccatcgcat ccatctcgcg cgtacgtggt     44700
     tcctttgatc cttaatcctt tcctcacttg caggtgtgta cagtacacct gcaattaatg     44760
     gtttaatttg ttcctagtgt gaagaaatgg attagcttaa tttgagatcg tacagttgat     44820
     tcacgcttcc ttcgatccgg gttatgatct ctaacacaca tatgcttgta atataactca     44880
     ttattgcttg aaaatataac tcattagtgt gttgaactca tgtatattat gcagtgcagg     44940
     tctcctacac catatagcat ggtactctcc tactcatggc taaatttagc tggagatgct     45000
     tggctaggta gacaaaaggg ccgaggcttt tctacccagg atcccaacaa atatatctcc     45060
     ccgagatcgc cagtaatctc acggcggtga ccgcacgaaa cgcccgcccg gccggatgcc     45120
     gcaacgatgc attcgcatct cagctactcg atcgtctact ctgcccggcc gcggctacct     45180
     agcttagcta gcttaattag ctaccgatcc gagagacgac gtacgagtag ggagcgcgtg     45240
     cggcggctta tgcctagtac tacactactg gtatcgcgta ggagtattcg cgtaggtgat     45300
     cgacgtgacg agacgcgggc ggccgaccgg attcccccac tggagcagcg gcatgtcgat     45360
     cgatcgtcgt gggcgctgga tcatatcgct cgcgctcatc gatcggcacg cacggttaga     45420
     ctctgctata tgtacgtgag ccggtgatgg tgaaaacggt ggtgaatcgg ggggctccgc     45480
     tcggtacata ccatttggtg attagattat gcatcgatct ctctctctct ctctcgatcg     45540
     atcgaattct cgatggattg acacctgcct aatcagcacg ttgatctagt tctttggcag     45600
     attttgcacc gccttaggtg tcgaacacta atgcatagta ctctgatatt tatgatacta     45660
     gtactctata ataaaactgg ctatatgtaa tggtattagg tagtatacaa ctttccacaa     45720
     ttttttgaaa aaatactttc aaatatctat actctttact acttaaaatg ttataatagt     45780
     gggtgtcctt tcccacatca tcactaccat tgatatgtgg gtcccctaat ctgtactatt     45840
     acaccatctt tatgagtcat ctcctatttt actattggat ctcctcaaat ttcaaaatca     45900
     cctacttgtt aataagaaaa atcatcatat tacttggtaa ataaatgcta attaattgat     45960
     ctaatgaggt agaaactgat tttgttttcc attgtaacgc acaagcctct aagctagcaa     46020
     ctataggtgg tgtttggatt tagggactaa aactttagtc cctgtcacat cggatatttg     46080
     gacactaatt tagagtatta aacatatact acttacaaaa ctaattacat aaatgagaac     46140
     taattcgcgt gacaattttt taagcctaaa taatccataa ttagcacatg tttactatag     46200
     catcacatag gctaatcatg gattaattat gctcaataga ttcgtctcgt gaattagttc     46260
     agggttatga aataggtttt gtcaatagtc tacgtttaat actcctaatt agtgtctaaa     46320
     catccgatgt gacatggact aaaattttta gtcccatcca aacagcccca tagtatgagc     46380
     aattggatag agtgactttc tcaaattaca gtaaggtaca aaaactaaaa gccctatcat     46440
     ttgtccttcc gcttacaagc cattatcaaa tttaaatttt aaattttaat cttgaagttg     46500
     attttggaag atttttttaa ttgtagttta tttttcagca ttagctttta gtgtcatata     46560
     tatatatata tatatatata tatatatata tatatatata tatatatata tatatatata     46620
     tatataacaa attattttta tcactcataa gccattacgg cttataatca acatatgcca     46680
     aacgacatgg ctgataagtg caagatgggt gatggcacat gcctaacaaa ttagggcaat     46740
     gtttatttca atccatgcca atgtgttaca atatatttta ggaccttctt atttcaattt     46800
     ttcgaagttt ctatctcctg tctccacttg ttcagctaaa acttagctta ttttccttgg     46860
     ctctgataag ggtttgatga taatcattgt catataaaag agttgtattt tactatgata     46920
     atgtggatgc acgctgtgga cgttgaagat acgattttct ttccgctgta taatcatgca     46980
     attcttcttc ctgggcttag caccaccacc gttatcgact ggtgagcttc cttggtatag     47040
     ctccggtcgt tgttagccat gggcaactac tactcattca atatcaatgc atagctagag     47100
     agaggagcgt tagattgatc gcttgctctc ctactctaga tagagagcca ctggcatgcg     47160
     aattgagcaa agagcattgg cggtggagtc ccctcccaac gaatggcgaa attcctagcg     47220
     tcaattgaaa agatgggtct agcccttatc tattatgcta ttttggtcaa taattcaata     47280
     gacattgctt aaagtgaaat ttacttttgt atattgacat attcttaaca gaagacctca     47340
     ttttttttag catcgacact gttccatggg aacttgagaa aaggggttta gaattgatga     47400
     attttcctag ttgaccaatt tttttattgg agtgatacct catcacctgt tggaacttgg     47460
     aagaggtaac ccgtgcatga tcagtagatg caaccaccga gacgatcgaa atcggcttca     47520
     tccaacatgc aaccaaccaa attgaatctc gtttaatcct agcccaattg atctaaccaa     47580
     ctaagcaacc tctcttgcat ggttgcgttc atctaatcag gtcaagccta gcatggataa     47640
     gacatacgcg ctagaatagg agtgcataca cctaaacacg ccttttattg ttcttactac     47700
     aaaaaagaga tgtgtttaca gtgtacatgt gcctctactc tacaaaatag gaatgaccat     47760
     gacattttta tgttacttac aaggtactag acatatctcc cactaaaagg gttcattagt     47820
     gctttttctt tagattagag actaccccac atgtcactca caacctattg aagtgttgtg     47880
     tttgactcca tgtccatttt agtttgggta gagcggaatg caacaatttc tcacatcaag     47940
     ctcaagacga cactagtgat ctatcactaa gtaaggaaga atcacatttg tgtcaagttg     48000
     ttggtttaaa agccatagaa aaacgaacga aggaaaaaaa gttacgcgta aaacttatat     48060
     ctatgttatt agtggtttaa aattaaagct aaaaatagaa tagatgaaaa ataacctaaa     48120
     attacctcta aaattaagtt ctaaaatata aattttagtt gcggctgata agccaacaag     48180
     caaaaaagta tatgagaact tattcttaga gaaagagctt cgagcttaat ggtacatggt     48240
     gtctcagaga caggagcata tctccgaggt gttgtacgtt ggtggcttta agctctcaaa     48300
     ggcacatgct ctaagtttat tgtatgtgaa gcaaataatt attaaaattt ttaaattgaa     48360
     aaatatatac tttatattgt gttgcaaatc cttcgacgta caatcaaggt caaattcgat     48420
     ctgcatatga agaaaaatag caacattgac tataaaaagt gcattttgca ttggcacttg     48480
     tatttaccat ttctgttttt gcttatttag atcagatttg atcacgcatg tttgtggaaa     48540
     gattataaca caataaacca tggtttatga atttcttccg aaactatatt tgttgtgttg     48600
     tgcgtgccaa aagaaaaagg agcgtgtgat ctcggcttaa aatccatttc ctgtatatta     48660
     ttctagagga catagtcaac tctccgcact cgatccttcc taacttctgt caccaaaatt     48720
     cagccaggga tccgacaata gacagagcag gtcatgcaaa gttgcaaact gtcaccaaaa     48780
     gaaagaaaaa ccagtactgc aactacacat ctcagtgtgt gcagggttgg cctgaatcag     48840
     aatcagataa gcatttgctt cctcatatca taccacacca tcctttcatt agcagaaaca     48900
     gattcctaga tctccactat cactattccc cattagcagc agtgtgaaaa aaacccagtt     48960
     gagttttcgt gtacgtactg ttcaccgtca gggacagaac attttttttc acaagctgtg     49020
     cagctagctt agagatagat tcagagatgc caaagatggt acctagcctg gggggcgtct     49080
     agggctaaat ctctatagcc atgtacgccc acaacacaca cacacaactt tggttattct     49140
     catatgatct atatatactc aaatggttcc ttctgaatgg cttgcagact tcagagactt     49200
     cactcagagt actactccta cacacctgaa ttccatacac catttcttct cagccctttc     49260
     acccaattca gtcatataca tatttctcat agactataga tacataaaat tttcagctag     49320
     acagtagtga tcatttctgc agtgatcagt agagatgatg atgatgtttc aagatcagga     49380
     tttcatcggc atgctgcctt ctgccattgt aactcttcta acttctctct tttaactcct     49440
     ttgcatgcca gttttacata cacacacaca caaaaaataa aatctgcata catgcataaa     49500
     taatcagagt gtgtttgtta acttggatac tagtatttct acttcaatta tatataacga     49560
     cgaaccgatg atcactacgt tgaacatgat caaatggaga tcgatatgca tatgcactgt     49620
     gggattagat agaggtgcat cttcgcctga cagtctgaca gacatgcatt cgatcagtct     49680
     ggaatcagaa tagtttcaat tctttcgtca ggcatccatc tgcttggcgt cgccgcggcg     49740
     actttgcttc acagcatgga tgactgcatg tctgcatgca agagttgtgt gctattcctg     49800
     caagtgagac ctgagtttct tgctattctt atccattttt tttttcagtt acatgaagtg     49860
     ttctttttgt acggaatgac caggttgttc ttttagatag agaacaactt catgcatgca     49920
     aacagttatt gatcaatcat cattttacag ccccaatttg ccacataaga gcatatacat     49980
     ctctggcagg catgcatgta cttggctgct tttttccatg acgtttggca tccagttctc     50040
     ctgaaatatc tataaacgca catccaaagc ttagttagat atgtgaccaa ccttgcatgt     50100
     atgcagaggt ctctaaagta atagtgtgtc ttttcgcttt ccgcctttta gttccggatt     50160
     catgaagcaa tgataagtta atatgtatca tatttgacaa gaaaatttta aaaaaggggg     50220
     tcaaaatttc acccgggata gacaccgttt gaaccattga atcagcatat caaattagag     50280
     ataagcacat caataacata ttcaaagcaa ttctcattgt acctacaaga atcaactact     50340
     ccctccgtac caatataagg gattttgagt ttttgtttgc aacgtttgac cgctcatctt     50400
     attcaatttt ttttgcaaat ataaaaaatg aaaagttgtg cttaaaatac tgtggataat     50460
     aaagtaagtc acaaataaaa taaataataa tttcaaaaaa aattgaataa gacaagtggt     50520
     caaacattac aagtaaaaac tcaaaatccc ttatattatg ggacggaggg agtacaattt     50580
     ctgagatcga gtcagtattg cagagataaa aaaacaatat atcaggcaaa actcttacat     50640
     tctttttttt ggcgaatacg catcattaag acgtaatgag gtgtttgagt acatcgcaaa     50700
     cgaacagaat tacaaagaaa gacaatagga actggaatcc tatatcttgt gcgaccatga     50760
     actctttcat tctttttttt taaaaaaatg aaaacctata tatatcacat actgttatct     50820
     cttaatgatc atgtgttcat gtgttgaatc aactagatag caatatccct tttttctcgc     50880
     aaaagaaaat tacgacgtct cggtcaaaaa ctgatctagg agtaagggga aactaatctt     50940
     ggagagacaa agggcggttt aattgttcgt taggagccga attacggcat agaacatgca     51000
     caaaaatagg tgttttcccc tttttttttc ttctttagct ttgggcatat gtacttacat     51060
     tttcaccatg tgacatgtaa atatatttgt cctttgtcct aattaagtgc tacggttact     51120
     tcgcatctag ttcttgttag gtctccggct cttatggctc tataattagc ctggattatt     51180
     gcttggtctt cttgttcatg ggcttataaa tagaacacac tgccattagc atgggtcgtg     51240
     agcttttctc ctcttcaaat tcccattccg ttgatgagcc tctaccttct cagtatcaat     51300
     ttagagcatt ccttggtgca agatccatca tgctcgacga cgtcgacgac gagcctttcg     51360
     ccgtaaatct cctgaaagca aattaggctc aattctgcag ttatttgcaa gcttcagtca     51420
     gtttcagcat ggttgttttc agcagtttct gctgttgtta ttctgcatgc atatggtctg     51480
     ataatttatt ttgcattctg cttgcccatg catattagga ttccatagca atggcaattg     51540
     gcaaatgcta atgctctgat cagattttgc tagagcaata attgttaggt ggctatcata     51600
     ctaaagcgga aaggggcacc agatcctgcg aaaatctttc tgctttttgg acctcttgca     51660
     gtacagatgg gaatcgatgc ctcgacttga tagtttctgc ttcctaatct ccacgagctt     51720
     tatgacattg cgcattggaa tttttgatta gttgcctgat cctaacagta acattccccc     51780
     cagcatacgg catacggacc tatacctcta ctgttcttga catcttcaga gatttcagat     51840
     ttcagataga acagtataat ttgcaaatac aacagtatgg catttgattc cttgcaaaaa     51900
     aagagattat aaaagaatca tagaaatggg tttaaatagc ctaatacaaa tctgtaaatc     51960
     accgttttgt caattcagga ttttggcgat gaatgtttgc attgcacagg cctgtagaag     52020
     aatacagttt ttttttctga agaaagaaat ggttacgagt tggtggtttg atggtttttg     52080
     tctgaatttt gtttttgttt ttgcaggatg gcatctcgag cccgatagcg cagcacatct     52140
     atgacttctg cgacgacggc aacggcggcg acctcttcgc ggcggtgaac gcggcggcgg     52200
     cggcagggtc ggacatgttc acggcctcct cggaggacgc gtccgcctcg tcgtcgtcga     52260
     cggccaccgc gcccatcgcc ggcggcggcg acaccctgtc gccgccgctg ccgtcgctgg     52320
     actccacgct ctcggctctc ctcgagcaag acgagccgcc cggcgccgac ggcgagctcc     52380
     tcctccccat cgacgactac gcgttctccg ccgtcgacga gacgcagcca ccaccaccac     52440
     cggagcatca gcagcagcag caattcaccc agatgcctct cccggtgatg ggcggcgcgg     52500
     cggcggagca cccggcgctg caggcgcagc tgagcagcac cgccaccgag ctgatgcagt     52560
     acgccgggtt caccgacgag gtcttcgcgg cggcgttggc cgctggagcc ggagctgggg     52620
     cgggagggta catgggcctg gacgacccgc tctgcccgca gcagcagcat tccggcgcga     52680
     tgctccccgc cgccgccgcc gccggcgagg cgttcttcag caaggacgcg cacgcggcgc     52740
     aggccgcctt cttcgccgcg gccggcggcg gcggcggaag catggtgatg tcgatgatgg     52800
     gaatggacga gatcggcgag taccagcgga tgatggaatg cggcggcgcg cttctcggcg     52860
     ccacccacgc cgccgacggc gccgacatgg ccttcggcaa cgccgccgcc gcagagttgc     52920
     aggtaggaca ttgccgccat gcaagaacct ctcgcgcacg cgcagcatga cgccatgacc     52980
     gtttcaccat ggtggtcgtg gtgccacaga tgggcggagg cgggagtagc ccagcgcggc     53040
     tgccggcgac ggggacgacg gagacgacga gcttggagga cacgagcttc aagaccgtcc     53100
     gcctctccaa cgaggagagg aaggaaaaga tccacaggta catcaagaag aggaacgaga     53160
     ggaatttcag caagaagatc aaggtgaggc aagaacttcc aaattattca aattcaaatt     53220
     caaaatatca cccccccccc caacccatat ttcaaacgaa tttcacctca ccgccgacca     53280
     cgttactgac atctcagatt ttttttttaa aaaaaaaatc tgcagtacgc ttgcagaaaa     53340
     accctcgcgg atagccggcc tcgcgtccgt ggtaggttcg ccaagaacga cgactactgc     53400
     gaggcatcca ggtcgatcgg ctcgcagaat cacgaagagt atgaacaaat tgtaagcatt     53460
     caaatgccaa gaacgccctc aaaaaaatct ttaaaacaaa gtgatattat cggtttgaaa     53520
     cttgggatta tatttacgaa gtgaaatttg gcaatgattt gaggactttt tgtccttttt     53580
     tttttgtctt gaatttgcag ggcggcgtga agggagaaga catgcttgat tctgacgctc     53640
     tagcgcatat cagcgggatg agctcataca tgtacaatca cacagtggaa tcctggatat     53700
     aaactcatac gacacagcac tgagaaactc tctcgaattg ctttttcttt ttttttccac     53760
     cctattttgt gcagatttaa ccggtccttt acttcaaacc tctgaataat tttgtagaaa     53820
     tttgatgtat gttgatcagc tggagttgct gtagggtcgg tctgttgtca tatcaatctg     53880
     cttttcactt gtttgtcatt cttgcaggtg aatgaaatag atagagttaa tttgcataat     53940
     ttgtatagat acaaatgtcg tgtgtactta acgatgttag aaggcatttt gaaatgccta     54000
     gtatgttttg aggtggtcct ggaaacggtt gagaaaattg gagcagggaa aatcaatata     54060
     gatttaggcc tttagcaatc tgagggtgta aaggaaaagg atatatttgc aaatgtttga     54120
     cggtataata cctctatatg aatatattat actattgact ttattccttc tctagtgttc     54180
     aagtctgagc agtacttttt tttaaattag aatacaacaa aactatctaa caaaactgta     54240
     ttattgtaaa tgctccagta aagaaaaatc tacacatacg gtatttttca aactaaatat     54300
     tatgagagct attaatgatc aagctttcaa aagtttgact gaataaagtt ctttttcttt     54360
     tctgaaaaca aactaaataa agttaacaac atcatatatt tgaatacgga tgaagtaatt     54420
     tctatatgtc ttttttcgcg aacgcgcaaa ccttttgcgt gtcaaagtaa tttctacatg     54480
     tcgtgtaatt gggaacaaga aacctaatct attcagtcaa aatataagcg gctgaataaa     54540
     attaagctaa gtagaagcac accgaataaa actgttatgc aaaccttgtt tacacagaat     54600
     gcctgattca aacaatcaac taattaaggt cccaaaaaga tcacaaataa aaaataaaaa     54660
     aatgacccaa aagttctcca gatatatcat tacttcatta ggaaatacaa gtgagggacc     54720
     aatgaaatct gtggcatcta aaaacacgac tatctaaaaa aagaatcaga taaaaaaaag     54780
     aaattcctta ccaaaggctg aatcttttga aaatcctgtt ggcagaaatt ttaacagtta     54840
     ttaccattta tcgtcgtaac aatgcacatc cattgagaat attggaaaat tacgcaagag     54900
     gaacttagag catcatcaag acattacgaa taatcttctc ccaatttttt tttctaaatt     54960
     gaaaatagaa aattttgttt ttggttttct aaactgaaaa tagaaaaaaa aactgatctc     55020
     tctcatagaa aacctaaatt ttataagaat agatcacgaa gaaactgaga tatgttagat     55080
     ccgtgtgtag gggatctgct gaatccattt tttcacttaa aaaccattaa aatcagtaag     55140
     ttaaaggaac tctaaaacgt gtgtggggat atgttggatc cgatttttca cctaaaacca     55200
     ttaaaatcag ttttggaaga aacagggttc tgttatatcc gtgtgtagat gatctgttgg     55260
     atccgatttt tcactttaaa acccttacaa tcagtacggt gaagggaact ctgaaacgtg     55320
     tgttggatcc gatttttcac tttaaaaccc ttacaatcag tatggtgaag gaactctaaa     55380
     acgtgtgtgg ggttatgttg gatccgattt ttcacctaaa aacataaaaa tcagttttaa     55440
     aaacataaaa atcagttttg ggaacaatat aaggactgtt agtgatgctc ttactatgct     55500
     acaggaaaag ggttaattgt atccatacca ttacaaatat gccaaattag aaaaatatcg     55560
     ctactattca ccattacaaa tatgccaaat tagaaaaata tcgctactat tcgtgatatc     55620
     gactagtacc gctaaaattt ggggaaattg gatccatgcc actccgtcgc gttatctact     55680
     ccccattggc gccaccatct ttcgtttgtg ccgagtgctg ccatctcctc caccatcgtc     55740
     gaaactcccc accatcacca tcgcgcatcg aggccgagca ccgccttccc tgcacaaccg     55800
     agccgccttg ccctcgcccc actaaccggc gcagccttac gctctccccg cctacacata     55860
     gcctcggccc gctgccatca cctcgccctc tcgccaccca ctcacagcca cagtccgccg     55920
     ccgcctctcc ttctcccctc cgacacagag tcacaacccg ccgccatcac ctcaccctct     55980
     cgccgcccgc gcacaaccat ggcccgtcgc cgccgcttcg ccctctcggc atgcttcgcc     56040
     atcatccccc ttgagacccg ccgccgtcac cttgacctct cgccgcccgc gtacagccat     56100
     ggcccgttgc cgctgcctcg ccctcttggc gtgctttgcc attgtgcccc tagagaccct     56160
     tcgccatcac ctcgccctct tgccgcgcac agccatggcc cgtcgccgcc gcttcgccct     56220
     ctcggcgtgc ttcgccatcg tgccccttga gagcggagaa ggccgtcgct gcttttcctg     56280
     ccgccgagct ccttcgccac atcaaggccg agcgccgcct tccccgcgta cccaagttac     56340
     cgccgctcta gtcgctcgtc gccgaagctc cgctcgccgc cagagttggg aaacgtcatt     56400
     gtcactgtca tgcttgaagg ctgtcatcgc tttccctgcc accgagctcc ttcgctaccg     56460
     catcgaggcc aagcaccgaa gttccttcgc tgccgcatcg aggccaagca ctgaagttgg     56520
     gaaattaacg aggagtggat ggaaaaccaa cggagtaaca cggttctaat ttctccaaat     56580
     tctagtggca cccaaccgat atcacaaata gtagtgctat ttttctaatt tagcatattt     56640
     gtagtggcat gaatccaatt aaccccagag gaaatcatcc tagaacatca cataacgtca     56700
     gaacgtacat agaaaggagt caaatgggcc gtcgctgatc gcagaggttg tgcagcggca     56760
     cattgaaaat gagcgagtag agattaggta gggaagcata gaacaaagcc taaatcttca     56820
     ggcagcttca ggtggcagaa aggtgagatt gatgttcatt cagctagttt ctccagaata     56880
     cgatctggtt gctgactgtg aactgattaa aaggagcaag gtaaacaagc aaacatgcca     56940
     ttttccattc atcaaggaca caatccgcac tgaaaattta actgaaggtt tgcttcaagt     57000
     tcaggttaaa cttggttgga aacaaaaaag aactggagca cattatcaca tccggcacag     57060
     aactgaaaac tactactcca aacaagctct agacaatggc atttgctgcg ctagcaatcc     57120
     ttggccagag gtcggcgcac tccttaccaa tgggtccagt gatagcagaa cctggaaaag     57180
     aatacacagt gagtaaatta ttgcctggta ggcttcgaga gaaaatacaa taacacataa     57240
     catatgggag tatagtagtg ttctcgccat acctttcatc tcacccttgg gattcacaat     57300
     caccccagca ttgtctgcac atcaaatttc ataaccggta ttaattcgat agaccacatg     57360
     gcagctccaa atgataaaac caatgacaaa atagccaagg gaatagtgta caaatgaaat     57420
     gctgctcaaa atgtaaaaga gaccaaagaa taaaagcaca caaaacatgt agaatgaata     57480
     aaagctaatg tattatattt atggcatcag aagacaaaaa tatatgtcac atggccagtc     57540
     ccaaagtttc atagcggcga tgccactacc tagggcaatg gaatatgtga ccgcttccag     57600
     atggaggaac tcttatgaag ataaaatctt tataagaaaa cctctacatc caacaatgct     57660
     ttgtttgtga cgtttactta ggaatatgca aacatgtata taagtttgct ccagaaaaag     57720
     ctgaagaacc ttgcagtcct cccgtcactg tgtatttcct acggcagtgc aaataaaata     57780
     acagaacaag ctccaacgaa caaaattcag caattggcct atacagcgca atcagataag     57840
     taatgccagc catcttccag ttgaaaaata ttttgagaac accatagtta ttaaaagtag     57900
     gaccagcacc atgtcaggca ataaagatca tgttcccaac caaaaggccc catctaaaac     57960
     atcttcctag tgaagacagt aaaatataga agaatatttg taccctcttt tatgccatgt     58020
     tacaaactca caataagcaa acacataaat ttttgcttaa aaataattca ccaaactaaa     58080
     aaaaacctgc taacatattt ggtgttttct ggtagatttg atgatagttc aagtaaaatc     58140
     aacctaaagc ctagccccca aaacaagctc actgtagctc ataagaatgt gtaacttaat     58200
     cacgtaatga cgtaagcata aaaaaataga gcattgctcc aatcgtagca gccacaactg     58260
     atcagcattc tcaatatggt aaatcgtgta acccataatg aaattgacac taatttatgc     58320
     aggtggacta aaagatcaca ctaaaatact tagaaaccaa acttaacgca gctcataaca     58380
     cgtcataatg caacactaat catcaagaca ctagagagca tcacgatttc acagatcggc     58440
     atgggcgaaa ttgggtgcag cttccgcgta ccttcgaagt acatgtagac gccgtccttg     58500
     cggcgccacg gcttgcgctg gcggacgatg acggcgggca tgaccttctt ccggaggtcg     58560
     ggcttcccct tcttgacggt ggccatgacc atgtcgccga cgcaggccga cggcagccgg     58620
     ttgagcctcc ccttgatgcc cttcacggag atgatgtaga ggttcttggc gccggtgttg     58680
     tcggcgcagt tcaccgtcgc cgccaccggc agacccagcg acatccggaa cttgttcccc     58740
     gccgacccac ccctccctgc gccaccattt ccgacacgcg cgaagaccag atcagcgacg     58800
     cagaagcagc ggcggaggaa ggagacggag cggaggtggg gagagaggtg gctcgcacgt     58860
     acctcgcttc gacatggcgg cgtccgcggc ggcggcggcg gcgcgaggag acgaggaccc     58920
     ggctagggct tcactgcctc ggctacttat aaggcgagag gcatgtgggc ctttgggctt     58980
     tgggctttcg gctcaatatg cggcccattt actgctaatg ttagagtttt aattgggcct     59040
     agattactag gaacagtact tagccctaaa gtggctttgg ctatgtgaat gatccatcag     59100
     tgtcgagagg aactgagatc ggtgctgtag tagtaatgac tgcaaggagc acataataac     59160
     tgttggatcg atggaaccaa cggctcggat ttgctctgcc atcatgccgc accatcgatg     59220
     ctacagtaat cggtacattg tagattggga gtaactatat ttatatttat gtcgccatat     59280
     ttttcaccaa aaaatagtca gcatgtattt acattgtaag tccctaaatt acatatgtaa     59340
     ttttagtgta tttacaatgt aaattctaaa attatatatg taagtctcta aattacatat     59400
     gtaattttag tatatttata atgtaagttc taaaattaca tatctaagtc ctgaaattat     59460
     atatgtagta gttttttcat gaaaacacat gctgacgaga tgagaaattt aaattgattg     59520
     gcttcacgat gcaacacgaa atatgtaaag acgttcaatg cacatggtat tgcaattgta     59580
     gcacgaatct caagggagat caattgaaca agaaatcgac tgtgattact cacaaaatgt     59640
     gttgacataa ttatagcaac accgttgtag atttgctaca gtaattcatg aacaatattt     59700
     tttttatgat ctaagccgtt ggtttttgat ccatcagttg cggtgcaact gctaaagttg     59760
     tagttatatg gtttcatctt ttcacttatg cttatgctta tcaaccaaaa tttaaaattt     59820
     taaccttaaa tttaaagttt atttttatga ttttttatca tagtttattt tttagccttt     59880
     gcttttaaat tgttaagaac atatacaata aaaaattatt cacaaactat tttttgtttg     59940
     taaatatatc gtcgaataag caaaatgata gggcttatag taaggactgc accaatctcg     60000
     gtccgtccaa caggctcaga ggaaaatgag agattcaaaa aaagtgaaat catatatgac     60060
     atgccagata aatgctttag caaactttaa tgatctgttt agaacataga atgcatacag     60120
     atcctgcata atgcataagt aaattggtaa aaaaaaaccc atacaaatcc cataggatta     60180
     actagcacca ttgctattgt ttgttgttgt agtcatgtgg tgctatctga tcagatataa     60240
     atgttgctgt taaggtggca gcttctgtga atctgatgag cttaagaaag atgtcatgct     60300
     cgaatctgat cgccatgctc gaagctgatc gccaagtgac tcggataatt tgacttgtgc     60360
     tttttaacta tactttccta atcctaaagc tgccggccat ccgtcgtcct tttgtgagat     60420
     ctgtgaatca gccgatcagg tcggtgagtc atcagctcat catctaatgt cactttgatc     60480
     tcgtagctag atttagcttt agggcttagt ggttttcctt ttttcgcttt cctgagatgc     60540
     tcactactac gacctagaaa tttgttaatt atgagtagat aagatcgtaa ggaaaggcta     60600
     gataaatgtc atcatgtcac taagcagata tgtacactct gcaacggctg aatgtgttgt     60660
     tcttgctgac gaatgaatat aactaatttt ttttaataat ggattaaaac ccgacctata     60720
     catcctgcag caggatatac gcagccccaa agatacatag tctgagtatt taagctcgca     60780
     atataggttt cgaataacaa aacataaaag ctaggcacta ggcctcaaac agtatccagc     60840
     agcaattggc ctgaaattgg aactgtttag ttgtactagc tgcgtataat tcctttgcca     60900
     gaagtctgaa atccgaccgt tgatgtgtgg ttatgttatc actctatagc actataatta     60960
     aacagaagtg tttttacgtc atagctagca gcttgagctt agtaggacgc taggacgtac     61020
     tccctctaaa agttataaat atttaacgtt taaaatagga tttaatcaaa cttaatttta     61080
     aaactttggc caccaataat ttctgaattt ctttgtttaa aaataaacta gctgggtggc     61140
     tcgcgcaatt gcgcggctag cacccatata aaattatata tttttaatat gattttactt     61200
     caaatttatt aaatagttat ctcgttgtct taagattttt aaagactaaa ccttattatc     61260
     ctcgtgtttc taatttcctt agtttctaaa gtcacaacaa ctgctacccc ttacttctgt     61320
     catattattc tttatttgct tgctcgatct accaccgttt tctattcatt ctccttagaa     61380
     tctttatatg ttttagagtt tattgtccta ttgggcatct tttttataat ttctagaagt     61440
     cccgtcaaac actatcatta tactcatcta tgttcgtcca ttgcatcttc tctttattgt     61500
     cattgctatt ttaaaaatcg aacataatta tcctttaggt ttattttttt actttctaga     61560
     agtttctcca aaacgtcagc gactttgtca ctatactact ctacggctca cccgctgccg     61620
     cccttcttta ttgtcattga gattttaaaa tcaaacagga ttatcattgg ggtttatttt     61680
     ttttactttt tagaagcccg aacctttaaa aattggagtt tattatcttg ttgggtttca     61740
     tttttatttt ataattttta gaaatcccat caaacgttac cactatactc ctctatgacc     61800
     cgtccgccgc atactcttta ttaggattgt aaaagtcaaa cataactatc attggaattc     61860
     atttttttta ctttatagaa gacccaccaa ccatcggcga ctttgccatt gtactcctat     61920
     acgacccggc cgctgcctct cattttatta ttattgagat tttaaaaatc taatatgatt     61980
     atcattgggt ttattttttt actttctaga agtcctgcca cctaccttga ccgattgctt     62040
     cacgacctgc ccgttgtact tctttttagt catcattagg attgtatttg gtgttttatt     62100
     aatagttttt agatgtccca tcaactgcca ctactctgct tatattttaa tattgcttat     62160
     atttaattct gaattttagt taattttaaa ttatattcct acttgaactc ttcttttctt     62220
     ttcctttttc taattttgat tttttttatt ttttattccg aaatttaatt aatctcgtat     62280
     tggattctta tatgactctt ctttcaatat ttcttatttt taattccgaa tttctgctat     62340
     ttttaaattg taatcctact tggactcttt ttttttggct aatttccgat tttattttat     62400
     ttttattccg aattttgatt aatctcgtat tgggttccta tatggactct tctttcaata     62460
     ttccttattt ttaattccga atttcagcta tttttagatt atattcctac ttagactctc     62520
     ttttttcttt tgctaatttc ggattttatt ttatttttat tctgaatttt gattaatctt     62580
     gtattgcgtt cctatatgga ctcttctttc aatattgctt acttttaatt ccgaatttca     62640
     gctattttta gattgtattt ctacttggac tcttcttttc ttttctccga ttaatgtgga     62700
     aatttctagc ccccacagtg aacgtaaaaa tcaaatatga ttatcattgg gtttattttt     62760
     ttttactttc tagaagtccc gccaaacgcc ttgaccgatt gcttcacgac ctgcccgttg     62820
     tacttctttt tagtagtcat taggatttta tttggtattt tattaatagt ttttagatgt     62880
     cccatcaacc gccaccactc ttctcctata taggcatgtt acttaattaa tctcgtcatg     62940
     tgtttcagat ggtcttttct tttagtaatc tttatttttt tatcaccaat tttagttatt     63000
     tataaattgt atttctagct gatatcttat ttttcttttt ctaatttcag aatttatttt     63060
     atttttcgta ttgtgttctt tagatttttt tatttttatt ttgaatatca gttgttttaa     63120
     aattgtattt ctactttaac tctcttttta atttgcctaa tttcagatta tattttattt     63180
     tttattctga attttagtta atctactatt gggttcttat atgtactctt atttcaatat     63240
     tgcttatatt taattctgaa ttttagttaa tttttaaatt atattcttac ttgaactctt     63300
     cttttctttt cctttttcta atttcgattt ttttattttt tttatttcga attttaatta     63360
     atctcatatt gggttattgt atggactctt cttttaatat tccttatttt aattccgaat     63420
     ttcagctatt tttaaattgt attcctactt agactctttt ttttcgctaa tttcggattt     63480
     tattttattt ttatttcgaa ttttgattaa tctcgtattg ggttcctata tagaaacttc     63540
     tttcaatatt gcttactttt aattccgaat ttcagctttt tttaaattgt atttctactt     63600
     ggactctcct tttctttttt ttctttttct ccgattaatg tgggaatttc tagcctccac     63660
     agcgaacgtg gtgcctcctt tcaaagctgt ttaataatat aatagataga tagattctcc     63720
     ctaaacgtca aatacaccgg ccagaggaag cagtaaccat ccatcaatat tcaatcacgc     63780
     gcgtaaagcg ccttgatgca gtcaccttta gggtttccca aaccgccggg gccagggtta     63840
     ccgcgcccca gcggtaagca cggttatcgc ggtaaccgta aaaaaccgtg taaaattcat     63900
     caaaaattta aattattttt taaatttaag aaggttaccg cggtatttac attaccatac     63960
     ctccacggta aacgcggtaa acccggtaac tgcggtaacc acgcggttac cggtggtatg     64020
     gtgaacccta gtcaccttcc tacactttcc tcctcatcgc gattgtcttt cctagctctc     64080
     tgcctatata tcatcgtctg tcatgcatat tgctccaacg agtgcagagt gcttatgcag     64140
     ttatgcttta ctgtactaat tcagtttcat caccaaaacc tttctcgatc ggcaacgtgg     64200
     acagccatgg tcctagctag ctgtttgaag tcagggccgg gccgttaaat ttgtaggccc     64260
     tgtacaaaac actaagtgag gatacaaact ataactaaaa taatatatat actgcagagc     64320
     aaatgcgata tatcaagaat agtatatttt ttatcacttg ttttgcataa tcagaaactg     64380
     tcaaattgaa aatggagaat gttcgttgtt gttgctggct tgctgcctag tgccttactt     64440
     gttggttgct tgctaagttg ctattcgctg gttgaatgaa aatttgaaat tggatgagcc     64500
     ggctggtggc ttgctgctcg gaggagacaa gacgtcgaga ctcgagacga actgaataag     64560
     tcacagatac gaaaaacgaa agagaataca aaacgccgtg gggtctcggg gctcggagtt     64620
     gagaatacga agcgccacgc acgcgaagtc gccgcgcgga gacacgcgcg gactcgaaca     64680
     gggttatggc gctctggcct cacacaaatg catgggcctt attcagttgg gctgattttc     64740
     tgaggcccta aaaatttgga ggtctatacg gtcgcatggg ccgcatgccc atgtgcacgg     64800
     ccctgtttgg agtgcattcg ttcgcagcaa cgaccgacca cgcgatatct gaactgaaca     64860
     cacagattgt cgtcgtttga acaagagaca cggccacacc gtcatgtcag ccaaacgggc     64920
     ataaattaag ccctgtcgta gcatggcaac atccagatat ctcgcctaaa ctcgaccatt     64980
     gtacaaccct cactgtagct gcaagctctc tcattgttca tgtgacatta tatttccccc     65040
     acgttttgct gtgtcaattg taaaacgtgt agatgtgtaa tatgcctcag acgctagcta     65100
     gtggcgctca gatgcctacg tacggccggg aatataatga ctacatcgat ctgcatagat     65160
     atctttcacg gggtttaatt tttcggtttg accgattcta tcggaggtca cggatatacc     65220
     aaatttctaa aattttgatc cgaaatttct gaaattttga acaaatgttg gtcaaatttg     65280
     aacaaaatat tatcaaatta aaaaaattaa aaaaatcggc cgaaataata atgtatgggg     65340
     tccgaaattt cattccggcc ggactttcaa accctaagtt tcacgcacaa catttcaatt     65400
     cggcagcagt tcgatcgcga tctcggccac gtatccacgc atgcatctgg ctgcttccgc     65460
     tttcgccgtc cactacaaca tttcaggacg gcagcgagca tcgatcgatc gcgcctcgac     65520
     acgccgactg atctatctcc aaacgatcga ttattccgat cgatcaacat agcttttgct     65580
     ctcctttaat ttatgctgcg atggagacgg ccgcgttcga tcgccatttc ccacctcact     65640
     gctcacgcta cctaggttaa ttagctactc cctctgtttt aaattataaa atgttttaac     65700
     tttgatcaat gttaaactcc tttaaattta actaagtcta tacacaaata tagtaatatt     65760
     tataataaca aattagtttc attaaatcaa caattgaata tattctcata ataaatttat     65820
     gttgagttga aaatattatt attattttct ataaatttag tcaaacttaa agcagtttaa     65880
     ttttaatcaa agttaaaatg tcttgtaaca ttaaaaacgg aggaatacct ctaaagcaaa     65940
     aggcttagcc tatatctacg atgctctcct cctctttctt ggctatctcc atccattgtt     66000
     tctgtccttg accacagcgg caatgggaga gagagagaga aaaaaagata cctgaaatcc     66060
     actttagccc ggaccattcc ggccggccgg tgagtggccg gcgggccccg ccaccggcga     66120
     tgatgcccag ccatcctgcg agctttatat aagccgcagg tgagggacgc tagcttagct     66180
     cacagcagcg cggcgaaaca agatttgcaa aaactcctag gcttgtgttt gatctcgagt     66240
     acagcaagtc gatcgagaga gtgatcttaa ttttgtcagt gagaagagat ggcgtttctg     66300
     gacggactgt acggcagccg gaggaggatg gcgacagcga agggcgccgg cgtagcaggg     66360
     aggcggcggt cgtcgtcggc ggtggcggcg ccgcggccgg tgaggcagct gtactggaag     66420
     ctgaggtcga ggttgcggtc gtcgtcgaag aggcacgccg gcggcgcggc ggcggcgagg     66480
     ttcgggtacg acctgcagag ctactcccgc aacttcgacg acggcgtcgg cctcgtcgtc     66540
     tccggccacc gcttctaggc tctctagcta ggtagctcat tcggttcgat cccgagatcg     66600
     cgcgccctgc cattgctgga gaccggagat tattgttctg gtctacctgc aactctgcaa     66660
     gtggtattag tgttagattg tactactgtt tttttttcat agtgctcatc tgggatggca     66720
     aaattaatgg agaaactacg atcctaacac gctcttgttc atgtattgtg tacatatact     66780
     gtatggacag tatggtatgg gatgtatata tacgtacgtg acacatgaat atattcggtt     66840
     gccataataa gcctgaagct gaagatgttt gtgtattata catgtatatg tcaatttgga     66900
     gtgacatgaa caattgagcg tacatatata tctggttgcc aaaagcatga aactactgaa     66960
     gaaattattg tattcagtga ttaatttttt ttcttgagac ctgatagcac atgttttctt     67020
     aattaggcga attttgttgt tgggttcatg tagggatatc tgaaatctga acagagctta     67080
     gctgcagctg tgttaattaa ggtggtatgt gtgtctctct gaatctctga tgaaattaag     67140
     atctcttgct cgaagctggt tcgccatgga cgccggtgac tctcggataa tttgacaacc     67200
     gttgttttct gtttgaattt cccaatcata attaaaagat gccacaccat ggccgtcctt     67260
     ttgtgagatc tgtgaatcag ccgatcaggt gggtgagtca tcagctcatc agctaatccc     67320
     ctttgatctc gtaggtagat ttagctttag cacttagtgg ttttcctttt ttgctttcca     67380
     tcgttttcct gcgatgctta ctgtgttact ttatacctag aagtgagtac tgcagataag     67440
     atcataagat tactagataa atgacatcat gtcactaagt agatatgtgt ttatcctctt     67500
     taatttgggc atgcatgcat gtgctttaat ttagcatcac caccactgat ttaattaaac     67560
     ttgatggata tttcttctgg agatcttact gcaatgacag ttctgttctt gttgacgaat     67620
     taataatgaa tgaaattatt tagagctttt ggtctgaggt gaagcctgac taggatcact     67680
     tgtttagttc caagtctgaa atctcacacg agatgcactg ttgtagagta ctgcaaccgt     67740
     ttaaatatat actccctccg taaaaaaaaa accattccta gcattccaaa atgaaaatag     67800
     tggagagcga taatgactaa aatatcctta atcattaaaa aaaagtaata agagtggtag     67860
     gtaggtaaag gtattgaagg gataaagctt ctcgtttgaa atagtggaga gtgagaatga     67920
     ctaaaatatc cttaatcatt aaaaaaaagt aataaaagtg ataagtagat aaagagtatt     67980
     gaagagataa agattctcgt tttacgtgtt aaggatatgt atgatggtag aagttagttt     68040
     ttgtgggaca aaatttaaac tctataagtt aaaatttttg aacggaagga gtatgatatt     68100
     gccagcttat cacttctgac acgatgttat cattcatctc attcagtatt atttatttta     68160
     ttgtgaattg ttttagcatt aaagataatt taagtataac ttatattaat cttcctatta     68220
     aagataagac aaatattcaa acgtcatgtt taaatatact aaaaatggaa ggactgtcat     68280
     ttagcggaaa tggattgggt catgtcttca atgacactag tatgcttttc catttttttt     68340
     taaaaaaagg tgtgtttcct tccctccatc tcctaacagc ttagtacagg acagtactag     68400
     ttttgttctt cttttgatat cgtaatgatc atgctgaaag ttggtatatg gtagaccgtc     68460
     gtagccacag atcgatcagc agatgttcag ttaagcaaaa agtaattagc cagtcggtct     68520
     cggtctcttt tgtgcaaagg attcggttgt tccacgcggc gctaatcagc gccagtgcgt     68580
     tcgtcagaaa ttgatttaga actcgcggct tacacgttac acgtcaggtt gatccatgga     68640
     atggatatgg cacacaaacc catcggtcat catgcgcgta aagcgtctcg atgcagtcat     68700
     ctccctgcac tttcctctca tcctatccat ctacgatcat ttcgtagctg cttcctataa     68760
     tcttgatcta tatattgctc aagtgcttat gctttaattt agttaattaa ttacattata     68820
     tcaccgacct caacctttct ctcgcaacat cgtcgtacgt ggacggtcag ggtcttcgcc     68880
     gtacatttgc agcaaggatc gtggatcgtg tgttatcgtc accatgcatg tcaggctgaa     68940
     ttacatggtg atggatggtc gtgagatcag gcacttagac ataaaaccct cttaaaatgg     69000
     attgagatat tctatcttta aagtcaccgt acattttatc actcagatgt ggattatcca     69060
     aggtttatta gattcatata tttttttata taatggaatt taacgtccca gcctttgcta     69120
     aaaaagagct acaaccaatt attatacagt agcatccaag agtgtagttc agataaatag     69180
     aacacaccaa acaaaaacag aggaaactaa gccaaaataa agagaacaca tttattgaag     69240
     tctatttatg aacctccatt cataattggc aaatagttgc ataaccatcg actccaactt     69300
     gcggcatgca acctttagga actccgcatc atcctcacac ctttgcagct gtgcccaaaa     69360
     ccggagccag tgcgttgccc tgaaaattac ctgcataaat aaaatagatg gtgatttgtt     69420
     aaaaaccaaa tcagttctac tcaaccataa agcccagcaa atggcagaag cttcaaccag     69480
     tatcagttta ctccttttct tgtcaacccc catagttcag tattagattc atatgtcaag     69540
     gataaaatca cgtgacttcg aaggtagagt attctgattc acacagaaca tgcatcagat     69600
     tcagatatat ctcccctaag gctatgttct agtgaggttg aaagagaaaa aatttctcta     69660
     gtttttcaca tacttctcaa attgctaaac aatgtatttt tcttaaaaaa taatataaaa     69720
     ttgttaacag tgaaatttgg taagcccaaa gttaccatcg gcttagagtc agtatcggct     69780
     tcaaagttct agaatcagtc gatgggagtc aagtcgccac gatgtcgtgt tcttggtgga     69840
     gtcggatcaa tcaaaggaag cttatctaga agagttcgag ttcaagaagg atgcgacatg     69900
     acagttatct attaattagg tatagtttgt tagtttcctt ttatcttgag gaaagtgtgt     69960
     ttagtgtccg gtaaggactt tatcttttcc tttttagttt ctttcttgtc cgacaagaac     70020
     tagtatctcc ctatgggtat aaatatgtac acccggggtc attgtaatct atcaatcgct     70080
     acgatcaata caattcggcg catcgccacc ttttaccttt tctactttat tttatcatct     70140
     ggcgggactt ggcacctgac gcggggctgc atcggtgttc gatctccggc gaaggggtaa     70200
     gtctaatgtt ccgtcggtcc aggcaattgt atcgtctacg tcggcgtcgt tcaaggctgc     70260
     atcagtacat tcgaccactt ggattgctct ggtttggatg atatatttgt ctacctattt     70320
     atcatatgtc tctgttaata tagtcctagc atatcaattt agctctatcg gctgcttctt     70380
     gttttagggt ttctgccggt atcggctaaa tcgcgttgct agattagatt agcttagaca     70440
     tctaccaccc tgaaaactca gtcaacggtt tgattgtcta aatattatgt ttcttttcat     70500
     acttagttat gcatcagttg agtttgatct actaagtcgt gcttagaacc ataatctcta     70560
     gcctgcttct tgattgccaa taagggtttc atcggggttt cagccggtga gttatgtgga     70620
     cgttgcatcg gctcataagg attgcaatac atataagttc gatttagccg atgacaacaa     70680
     aggtttcact gtttaatcta atcttgtgga tcttgtgaca tcggacctcc agccgatatg     70740
     tgctttaacc atcggatcaa tatttgtttt actgtttcat attgttagcc gattggtttc     70800
     tactggatta tattgctata ttatattatc atcagccgat tgcctttata tcattatcta     70860
     cattggacat atagccgatt gcttaaaccc taccgctatc ggctggtatc ggcatcggct     70920
     attatcggct atcggctgga actactccat cggcttgtca gccgattgag tgtttgatct     70980
     attatttgca aatcttgtca gttgcaggat caaactgact ggcacacctg catctcatta     71040
     atctttggac ctgcacagga gctaagcaga tctcctagac cggtgtattc gattttttcg     71100
     tcaacaaaaa tttacttaaa atcatattaa tcctttttta aattttaaaa taattaatac     71160
     ataattaaat atatacgcta atagcttaca tctcttctct tttcacttcc acttaaacac     71220
     gccctaactc gaccacatgt tgttaattag atcataacac gcgcttagag tggagctcgt     71280
     cactactaca caaaggctct ttccatgcgg ttgggaagca tctttgcata cggttgcccc     71340
     aaccgcatgg acgaaatcgt ctgcaaaaac cactcttttt gcatgtggcc ggcgcatccg     71400
     catgtgaaga tgggattttc gcatacggtc gcttatatcg gccgcatgcg aaaataaatt     71460
     cagcaaacaa aaaaaataaa atccaaaaaa ccccccaaaa aaataaatat caaaaaaatc     71520
     ccaaacccta gcccgccacc ggagcgacgc atccatgccg cacgccgtcg ccggcggcgg     71580
     atccgtcgcc cctgccaccc gccgtcgtcg tccccactgg atccgtcgtc ggctgcaccg     71640
     gatccgttgc cccagccgcc cggcgtcgtc gccggcgatg gatccgtctc ccccgccgga     71700
     tccgtcggcg gtggcaccgg atccgtcgcc ccagccgccc agcgttgtcg ctggcggcgg     71760
     atccgtctcc cccgccgccc gccgtcgtcg cccccgccgg atccgcgcgg tgcggcggcg     71820
     ccacccgagg cggccaagcc gcccccgccg ccgcggcatt gaggaggggg ggagggtcgc     71880
     ctcatcgtcg tcgttgtcgg cggcggtgag gagggggtgg cgggccgccg agtcgccgcc     71940
     gtagccacgc cgcccgccga tgccatcgac gtacggagca ggggctgtag ctgctatgcc     72000
     gagccatcgc cgtagacgcg ccgcccgccg ccgctgtagc cgctccctat ggcggtggat     72060
     ccggccctcc tgagggcagc gccgccagat ccgccacccg ccgacgccat cgacgctgtc     72120
     gccatccgcc gcccggctgc tctgagagag ggagagggag agagaggaga gagagagaga     72180
     ggggagtgta ataaattaat taaaagggga gagaggagat gaggtagaaa aaaatttaaa     72240
     gtggtgggaa aatgatttca tctgaaaaag aaaatcactt tgtcggatga agaaatgaca     72300
     aaaatagaag ttatagatct tgatgagtta tataactttg ttattgatga ctttttccga     72360
     tgaaatcatt tactgcttca aaatattatt tgaacttttg aaattcaaaa ttttaattga     72420
     taaaacaaag tcataagaaa aaacagccaa aataatacca gtaagaacac gatattctat     72480
     catgatttta gaaacattta gaaaaaaatt attcaatttg gagttcatat gagtgagata     72540
     cactagtttc aaattttatt ttcgcatacg gcttcttaag tggtccgtat ggaaaaatcg     72600
     atttttccat gcggggcgct tatgtgagcc gtatgcaaaa atgagctcat ttttacatgc     72660
     ggccctctta ataggtccgt atgggaaaat cgattttttc atacgggcca cttaagcaac     72720
     cgtatggaaa aatgactctc gatttttaca gacgccacta gttatggtcc gcatggaaaa     72780
     atgagggggc ctcatacaga aaaatcactt tttttaagta gtacgttaat tgtggttgta     72840
     cgttacctac acaaattaag ctcattgttc atgtgacgta tacgaacatc tcagtatggc     72900
     acacatgccc atagaaatga ccacattgat cgatcgatcg atctagctct taattagctc     72960
     tgcatgagtt tcgcgcacac gcacgcatcg atcggcatct ggtcgcgccg ctttcgccgt     73020
     ccactccgat cgagcagaaa gacatacacc gagcgagctt ggagcatcag agactcatac     73080
     gggtttcaca ttctctatta tagtaatact attattataa acattaacat ataaaataat     73140
     aaaaaatagc atagatcaat taatataatg atcgtgatat tatgacagag aatccatagt     73200
     cgatcgagga ttcgaggcca ggccgatcga ccaactctat ctcttccaat cctttcattt     73260
     attttgttcc tagctttggg cgagggtgac ggccgcgttc gccattgcca cctcactgct     73320
     cacgctaccg cctctaaagc aaaaggacga tgctctcccc ctcctctttc gtcgtggcta     73380
     tctccatcgt ctctttcctt gaccacagcg gcaatggggt agagagagaa taaaagatac     73440
     ctgaaatcca ctttagcccg gaccattcct gccggccggt gagtggctcg ctggccccgc     73500
     cgccggcggt gatacccaca gccatcctgc gagctttata taagccgcag gtgagggaga     73560
     cgctctcgca ccgcagagca agaagagttt gcagattaac tcgatctctg gacaagcttt     73620
     gagtactgat ctcggagtga tctttgttgt tgtgagttgt gaccggcctg cagccggaga     73680
     aaggcggatc gagatggcgt ttctggacgg actgtacggc ggcggcggcg gccggaggag     73740
     gatggcgacg acagcgaagg gcgccggcgc agggaggcgg cggtcgtcgg cggcggtggc     73800
     ggcgccgcgg ccggtgaggc agctgtactg gaagctgagg tcgaggttgc ggtcgtcgtc     73860
     gtcgaagcgg cacggcggcg gcggcgcggc ggcgaggttc gggtacgacc ttcagagcta     73920
     ttcccggaac ttcgacgacg gcggcctcga tcgatcgtct ccggccagct accgcttcta     73980
     ggctcatgta gctaggtagc tagagaagag tgccctgcca ttgctggaga ccggagagtg     74040
     caatatattc tggtctacct gcaataatta tgcaagtggt attagtgtta gatctacttg     74100
     taattgtagt gttgttctgt cttcatacaa tttggtcaga tttgcttttt tttatattgc     74160
     catagataac taaattaatg gaggaactaa aacttggtta cgtatatata tactagcaaa     74220
     atgtccgtgc tccgctacgg atataataaa attagaataa ttaaagtaaa acttaaatta     74280
     ttttttttaa tcgaagctat tttcacccag tgcttttgct cgctaaaata aatctcaaat     74340
     tacgaaggaa aatatgatag ctcatgataa actaatttaa aagaatagtt ttgaagtaag     74400
     catgatttcc aaatttacat ggtgcttgat gacgcatcaa catttatagc atgttaccgt     74460
     ttgaatactt ctactctata gatcgtagaa attatataag cctttttata ctctcgttta     74520
     aatcttcatg aagaatcata tgttgagatt atggtgtgtt tcataatatc ctaaaatggc     74580
     aaggacttct ctatatattg aaatttatct gactcaaatt taatcgggcc gaatcttgtg     74640
     tttgggctag ctcgtaacct agccgagctc atgaagtagt ttatggccca tcaaatctgt     74700
     atataaacac aaccagaaac aactctgctt ttcatggacg gtgcatggaa aaattagaaa     74760
     tcgggaagga aacggtgcgc cggaaaaatc ggaaatcgag aaagaaaata aaaaaacata     74820
     ataatatttt tttttgcaga aacgtgtttt tttccgcgtg gtggatgcct ttttttctcg     74880
     gttttttttt cagccttttc tattacggag tcgaactttt ttttgcgtgg tgtggtacga     74940
     accgtttttt aaggcatttt cgtttgttta acagatgact tttgtattac ggactgtttt     75000
     tttcgcatcg caatcgaatc tattattttt cgcccttttt ttttcttgtc acggacgtcg     75060
     gaacgtttta aattttttaa gtagtagaga tatgctgtat gcaacaaaat cgttttgaat     75120
     tttggaagca catgcaacaa aatcaaaact cgccaccatg ctctgctgtc tccacttcgc     75180
     cctcgtcaac gttcagttcg gcggtttctt cgccacgggg aatttctctg gcatcaaatc     75240
     ccagattcac attagattta aagtttatat gttaaattat agtgattaaa aatgtatatt     75300
     ctattttaaa taaaaataaa atgattcatc taaatgttat cagcgtgatt gcagagctat     75360
     aaatttatag tattaggaat gcccggtttc aaaacatctt gaattcgaag ttatatcaaa     75420
     caggatctaa atgatccatc agtgttagta cgtgttcaac gaagcgagaa taatgagctc     75480
     tttaattaag tgaactgaat aaatctatcg tacatcgggt caaccccatg cgaaaacatg     75540
     ataaacgagt taacaagatt taactgcggg agtggatttt tatctctcga ggggatatcc     75600
     tatcgttgta tgcatgtcac tcaaatggtt atgaaaaaat atgaaaaaaa ttaagaagat     75660
     gtattaacat gtgatatatc actccacaaa catgcaagtt gaaattcaac ttctacatct     75720
     cgcaacgaaa aaaaaattaa actacaacta gttaacgtat attcacagtc aaatttgttt     75780
     tttttgttgt gagatatgga agttgaattt gaacttgcat gtttgtggag tgatatatca     75840
     catgataata catcttttca aattttttta cattttttta taaccatttg aatgacatgc     75900
     aaataatgag gggatgtctc ctcgagggat aaaaatagtt tccctttaac tgcttgttca     75960
     gaacataggt tgtataataa tcctgcatga tccatatgaa cacattggta gatcgattaa     76020
     ttaaaggccc agttgactag caatgttatt agttgattcc tgcatgggag atatgaaatc     76080
     tgaacagaga gagagagatc atgtgaagct tttttttttt tgtttcttgc gagcttttgc     76140
     gctgatgaac tttaagaata tatatacatg catgtgtctt gtgttgtcat catgcatggt     76200
     agatgatgcg cgaagaagct ggtcgccata atccccgagc tgtcagccat cgtcgttcat     76260
     taatctgtga gatctatctg atcgattagc tggtcggaac tcggaaaatg agtatactca     76320
     tgaagctcat ttttcatgtg gcagctccac acctcgtagc tagctattgg atcatgcata     76380
     cgcatgttga tgatcatgtc acatttcaca cctgatctgt agctgctagt acagtcttcg     76440
     tctcttcgac gctaacacat gtactacgca cacggtatac atctccgtac catcacgtgt     76500
     ttcacgcgcg ttaacagtac gtcgcaacac attcagcatc tggcccccag ggagaaagaa     76560
     gaagctacct gcagaaatcc actcttgccc gtgccattat tgtcatcagt ggccgaccac     76620
     ggcgggccag gccggcggcc ggtgacattc tccgaacaat ccggtcatcg tcgtcgtcgt     76680
     agccaagtgc gagctttata taagccgcag gtggaaggag gcgaagaaac gaggccatcg     76740
     agttgcagac ttgcagttag ctactccctc cgtttcacaa tgtaagtcat tctagtattt     76800
     ctcatattta tattgatgtt aatgaatcta gacatatata tctatctaga ttcattaaca     76860
     tcaatatgaa tgtggaaaat gctaaaatgt cttacatttt gaaacggagg aaatacctct     76920
     gttctgagtg agccgtgagg aagaaattaa ttaagatccc tggcaaagtt gttgggaaag     76980
     atcctggcaa tccgtctgtc cagacagatc aacggtctaa tctcgtaagc ccagagtgcg     77040
     ttttatcaaa acgcgttgca tccaaaacaa cttcctttac gtctccaatt tggcaaggaa     77100
     aatgcacaga tccaagaaac ccaccctctt tttcaagttg gacattgcca aggccttcga     77160
     ctcggtctca taggaatacc tgctaatact cctagagaga atgggcttca gcgccaaatg     77220
     gcgcgactgg gtggcgttga tcctctcagc ctcctcctcc agagtctctc taaatggtat     77280
     tgagggggaa aggatcgacc atcgaagggg gttaagacag ggggaccccc tatctccgta     77340
     cctgttcatc cttgcaatgg accctctgca cagactcctc aagatagcaa ctgacgaagg     77400
     ccacctaagc gagctagcgg atcgcagcgc gcgcttcagg tgctccctag atgctgatga     77460
     cgcggcaatc ttcatcaagc catctcgcca agatgtggat agcctaatct tgatcctaaa     77520
     cggtttcggg ggagcaacca gcctccaagt caacctacaa aaaagctcag tgcttccaat     77580
     aagctgcgac gcggttgacc tcgacgaggt tctacacaat ttcaccgccc acgtggagtc     77640
     tttccaatgc agtacctagg aatgcccctc actgtaagca gactgcgcaa ggtccaccta     77700
     caatacttaa ttgaccgaat caaggcacga cttgccagtt ggaaaaagaa actcctctca     77760
     gccgggggca gaagagagct agtactctca gtactaagct ccatgccaat ctacgtcatg     77820
     acagcgctca agattccaaa gcaaataatc caagaaattg ataaagcaag aagaaaattt     77880
     ctttgggacg gtggcgatga gttccacggt ggcaagtgca aggtgaattg gcagcgagtt     77940
     tgcagaccga tcaagtatgg tggcctgggg gtctcgaacc tcaccaagat gggacgggcc     78000
     ctccatttac gatggctgtg gtacgaatgg accttcccag acaaaccgtg gattggtatg     78060
     ccaaccccat gtgacgaaca ggacgccgag ctctttgcag catccacaac ggtgaccatc     78120
     ggggacagca ggaaggcgct cttctgggaa tccccttggg tatccagctc cccactaaag     78180
     acaatggcac caaacctcta ccgtcatgct agaaggaaga aaaggactgt tgcaaatgcc     78240
     ctacaggaca ataagtggat caatgacatc agacacaact tgacatcaat gctcgtcacg     78300
     gagttcttca aggttttcga gatactttgg gaatcaaaca ctaccctatc ccaaggtgtc     78360
     caagacagca tacaatggaa atggacacca accggatcct atacagcaaa agtcaaccta     78420
     tcaaatgcag ttcctgggca gcatcctatc attatcggca actgcagttt ggaagtgttg     78480
     ggcaccgtcc aaatgcaatt tttttgcctg gctgctcctt caaaatagaa tatggacggc     78540
     tgataggctg cagcagaggg agtggccaaa caactacttc tgccaactat gctttaggaa     78600
     cctagagacg gcacaccacc tcttctatga atgcccgatc acaagagcaa tatgagatgc     78660
     tatagcgaca aggctggttg tcccccaact acggccagta aattggacca agacgacatc     78720
     ccttgaggac tggtggactc agaccgttcg cgcaatgaca aaggagaaaa ggaagggcgt     78780
     caaatcaatc cttaccctac tatcctggga aatttggaaa gaaagaaata gtagggtatt     78840
     cagaagcata gagactccgc tgcagggaat cattgaccga gcgactaacg agatctggct     78900
     ttggcacgca ggcagggcaa aaagcctcca atgcctacta ccgagcaacc atggaagtgc     78960
     agacgacgcc acgtaatcga ctaatcaaaa tcatacgtct cttctagtag ctacacccca     79020
     cccaccctcg tttttctcac tttctttttt cttgtaatct cctagccttt ttggctattg     79080
     tacagtgttt ccccttcttt aatacaaata taccccgtgg ggtttaaaaa aaaaagatcc     79140
     cgcactgtag tctgtatact gtggagctag atataagaga tggtgtttct gttggggctt     79200
     tacggcggct gtggcagccg gaggaggacg gccgcgtcgt cgacgggtgg cgtggagagg     79260
     cggcggttgg cagcggtggc gatggcgcgg ccggtgaggc aactgtaccg gaagctgagg     79320
     tcaaagtgga ggagctcggc gtcgacgcag ccggggaaga aagccggcgg cgcggcgagg     79380
     ttcgggtaca gcctggagag ctactcccgc aacttcgatg acggcctcgc ttctctggct     79440
     cctatatctt atagttagct agagaaactt cttctgcctc ttgccattgc tagagtcagg     79500
     gggatccaag tccaatacaa gttctgctag cacatttgtg attttgtaca cattgtacta     79560
     ttgttcatat atatacaggt cgctattgcc atggattaga cagtgcaatg tctgagtact     79620
     tatctagctg gtcacaaaac taatggagat ttttactttt ttaaaaaaat ctttagctgc     79680
     agctttcaag caccatattc tccattgttt cgcttattaa tatgtttatc cgaaatgctt     79740
     attagtgaat aaaaagttat ttgtaagtaa aatttttatg tatatattct tagtgaatta     79800
     aaaacaaatg ctgtaaaata aacaataatg aactaataaa aatcaaattt aaaattaagt     79860
     ttttttaatc ttagctttat aagtataaat ataagcgaaa taattacaga aaaccaagac     79920
     aatggtatcc cgttggaacg cgataccttc tataagacag tatcggatac ctgatatctg     79980
     ttgtggtact agctgcatgg tacctgatac ctgttacccg gtacctgtga tacctaaaac     80040
     ctgatacctg tgatactcgt gcaagagaat agttaatatg cctgtcccgt tgcaacggga     80100
     tcccgttttg tagttgccct caaataatta atgagcccct ttgtatttgc atgaactgga     80160
     tgttgctgaa gagcccatcg ttttcctgag aaggcccatc gacagaagag cccatcatcc     80220
     tctctaagcc cggcccatcg tcgcctcgtg acgtcaccac ccccgtcccg tctccctcaa     80280
     ggcttctctt ttgcgcctcg cctctccttt ctctcccaca cgcacacaca ccgccgtgga     80340
     cgccgaggac tacactaacc ggcggctgcg gcggcaactc cggcggatcc acccgcagct     80400
     aggccgagtc gcgctgccgg ggaagaggca gcgggaaccc tagccggccg agcctagccc     80460
     gggggaggag gaggaggcag gatgctgttc caggtgggag ggcagggggc gcggcccacc     80520
     ttcttcgaga tgtcggccgc gcagcagctg ccggccagcc tccgcgccgc gctctcctac     80580
     tcgctcgggg taaagtggat gaactcgcct cgcccccgcc cctctcctca tctcctccaa     80640
     attcgatcca aatcgctcgg gataagggtg ttttgacttc gtggctgtaa tttgtttaga     80700
     tgtctggggt ttctaggggg tgatagaaaa ttatagtgtc actcgacgat gctggcttcc     80760
     tgcgcattgt agtggtctag cttgaggagt tggagatgat tgaatggtgc gggctctggg     80820
     ttgttgtttt atttgtttct gtgccagatt ctgttggtta ctggtgcaag ctcggagtat     80880
     agttgatcag tgctagtttt gtatatgcaa ttcgcagtca cagaagttgg ttcttctgct     80940
     gatggatatt acagctcttt aggttgtttg gctagctgca ctgaattggg ttgattcatt     81000
     gggatcattg ctatatgtag ttttgagcaa acttctttta aaggacattg agctcacatg     81060
     atgctgttca tttttctata caaataatat taaattggtt gttgtatatc acatgtttaa     81120
     gaacaaattg aatgtgacca aatgatgcaa ttagaatagc atcccaacaa actgaaggtg     81180
     aagtgttttg tagagcatct gtggaacgta tgtagaagta tattacgaag aaactccaat     81240
     aatactgtta aaaagtacta aaaaacagtg tgcactgggc acgaaatagc caagaggatt     81300
     acatgcggaa tggaagtttt tggattgccc tacacaaggt tggaccttta cctagcacaa     81360
     catactgtca aaagcatgat acaaattctg ctctatctgg ttcacaaaga ttcttgcaca     81420
     tgcagttaag tatgtaattg cgctttgtga ttcttgcaca ggcagttaag tatgtaattg     81480
     cgcttttact actacctgtt tgaaaaaagt gtctcaacaa tggagagcga taaagcagag     81540
     tttaatgtag tatatgcacc atttttaata aggggaaaaa cttgtgacta gaggagtcat     81600
     tttttcagct gatgctttct ctaaattctt gaacatatca ctttgtgtgt gtgtttaatt     81660
     ttagtacatc atgcctctta aatagagttc taactaactc atactattac tcacaggttt     81720
     ttgcactaag acggccgttg ttacataaag ttttagatta cgaggatgaa ttctttgcct     81780
     tgttaatggc tgtccttgag tcccatagtt tgcgaacgac aggtttgtca tcacagaaac     81840
     ataaggttct tttgctgtaa aggatttgct gtgttcatga cctttgtact aacttttctt     81900
     tgagacatct caacgcctct gtgattataa ctgtccaggt tttttttttc agatggttct     81960
     ttttcggagt cattgtatgg tctcaggcgg agacctgtta aggtttcagt aaagagaagt     82020
     agttctggtg cagaatccaa tgataaagcc tatgattctg ttctaaggaa gcgccagaaa     82080
     gtcctttctg ttgttttttt ggtatgatgt cgtttagcag caagcagctt tagtgtcaaa     82140
     tattactgct tttttttttt ggtattggct ttgttgtttt cgtggtaaat acttttgagc     82200
     tgttctgtct tgctactctg catatgcagc tactatcaaa atctacgaaa acagtacctc     82260
     tctctaccaa tttgattaaa ttggtttatc atgacttcaa gagttgaaca cctagaaaca     82320
     aatctaaccc atatgttaac cttgtgtgat tttgcatggt tctattatgt gccctgagct     82380
     gctcttttat taaagctggc cttgtttatc aacgttttac aactgacacc aatgcctagt     82440
     ctatttttac tatgtactac tccagtatga atacagaatg tccttttgct ttagttacaa     82500
     gctacgatgc tcttactgga tctctgtgtt cagttatttt cttattgaaa gttggtgcag     82560
     attagaaaaa aaagtttcga gtcttcaatc ttgctttggt ctattatcct ttaatgcgta     82620
     ttcagcacca aaacttagtg tagttgttaa atgtattagc gatgctcttg atgaagttgt     82680
     tatttttggc atttatgata caatttcatg tgctacctca gtgactcaag taaaacgaca     82740
     aacatatgga tatcactatc aaaatgctca taaaaaatgg gtgtcacatt ttatttatgt     82800
     tatgatgaaa tttctcaggt ttggaatatt ttttttatgg tgttcttaat atgtttgtag     82860
     gttgttttgc catatttcaa gtcaaagctg cagtccatat ataacaaaga aagggaggcc     82920
     aggttgcagg caagcctttg gggtcagggt gatgttagat tcgatgaagc tgaccttgtt     82980
     tcagatcaag gggagacttc tcaagcacaa gtcgaggcta caactggaga agtatcaaat     83040
     atggcacgta ttaagaagaa ttttgcggca ttaataggtg tttgctatcc atggattcat     83100
     gcgaccaatg aaggttaact acccttatgc ctagacacct tgcataaatc ataagtgttc     83160
     cagctttctt ctgtatctat tgattttaga catcttatta caagtgcatt attctcagtt     83220
     aaagaccaat aaagaatgag atcattccag cggcccagct ttagcttatt ttgtataacc     83280
     tactttttat tgtcttaatc cttttgtttt gctgtgtgtg gatgtaactc atgttttata     83340
     caaattcaat tacatagctg tgcaccgctg atttgtttgt ttcatcagat gggctatacg     83400
     gttgccataa tttttactta tcaggtctta aaattgattt gcaggtctct catttgctta     83460
     ccagttgctg tatttgttgg atggtactgc attttatagt ccagcactgc atgctcttgg     83520
     gcttcatgtt tgtcgtgcta caggacaaga gctggtattt gatacttagt tacttactaa     83580
     tttgtgtcct tgactattgg ttagctcaaa tatgcagaag cctatttcta atcctattac     83640
     cttgatacaa atgccctttt tctttcttat gattatgatt tctccatgca gaccattgtc     83700
     cttttttaaa atccaagaaa acatatcaga tatcaaattg ggttaagttt tcatatttag     83760
     agatggttag cctttatttt gctaatttat tttctattgt tttttcttga aaaattagat     83820
     ggaatcatct tctagggtat caagaatcag aaatcgagaa cttgagagac ttcgtggtcc     83880
     tccatggctg aaggtagtaa aggattgtat cactactcat atagtggatt tgctcaagtt     83940
     tgagtcattt aataatggcg cataacacta atattttaat attatccctg cagaccatgc     84000
     aaagggtgtt acttaactgt atgtacacta gcctagatta tgcacaaact ggtttgattg     84060
     ctgcagtttt ctttttcaag gtcagctctc caatttctgc tctaggaacc caagttcttc     84120
     gtttgtctcg gtggtcaaat ttgtttttcc ttgcacactc tctttatctt taatcttctc     84180
     agttctccct acaatggatg taatatgatg aaaaaacatg atcccccatc gtgcttcgct     84240
     taatgttctc tatctcgtga tcttatctag atgatggaat ggtggtatca atctgctgag     84300
     gaaagaatgt cagctccgac tgtatatccc ccaccccctc ctccacctct gccaaaggta     84360
     catgttatat gctagtcaat atatgcagaa agcagttacc cttgtctgaa atctcaattt     84420
     gcagtaacat ggtgaacaga actctttgtt ttgccactgt gcagttggat atattttgtg     84480
     gtttaatagt tctttatatg actactgttt gatttgagcg tctacttctt tcatcaggtt     84540
     gctaaagatg gacttccctt gccccctgac aggacattgt gccccttatg ctgccagaag     84600
     cgcaataacc cttctgttct ttctgcttct ggttttgtat tctgctacag ttgcattttt     84660
     aagtcagtct cccaggtaga ttactgtcac aaagaagctt tccattatta tgatcagaaa     84720
     gaagcaaccc acaatctatt tatcttagcc accaatcagt cgctaatttg attttgtttt     84780
     gctctacagc ataaaaggtg ccccatcaca ttgatgcctg ccacagtaga acaaatcaga     84840
     cgcctctttc atgatttgta gtttgattag acagaacaca ctcttctccc caaagatcag     84900
     gggaagccgg atataaagaa tcgtactatg cagctattca tttttgttga acagaccaca     84960
     aggaactcag cccttctgac actcaaggca tggccatcta ctcaagaaca gtgctgttga     85020
     ttcttccccc gttaggaaat tctatgttca tacaaagctt gtattcgttt tcttctgttg     85080
     aaatcaaaaa aacatgcaca gctcgagatt ttggtactga tgtgcaatta ctgtacaaat     85140
     gtcactttga cgaggtgact ggttacacaa tttgagaggt ccttgcccaa ctgtatcaaa     85200
     tatgaaagtc atcgaaagct tatggctctg ttcgggagga ggggttgggt taggaacccc     85260
     tcctccccgg cacgcaaaac gaagtatcta ttattgcatg attaattgag tatttgctaa     85320
     ttttttttga aaaatggatt aatatgaatt tttaaagcaa ctttcgtata gaaacttttt     85380
     ttaaaaaaca caccgtttag cagtttgaaa agcgtgcgca cggaaaacga gagagatggg     85440
     ttgggaacta cttctaccga acgcagccat agatatttca ctctcatctc tctcaaggaa     85500
     aacttcttgt gtttctgaat ctatcatgat gctgtgagca tgatttgtgg aattttggat     85560
     gtcatgtgtt tatgatgctg tgagcatgat ttgtggaatt ttggatgaac ctatgacaga     85620
     cgtgttgggc tggaacggca taacggtgtg gaaaaagtat gatgctgtga gcatgatttg     85680
     tggaattttg gatgaaccta tgacagacgt gttgggctgg aacggcataa cggtgtggaa     85740
     aaagtacacc gaaggtccct caacttgtca tcgagttaca aaatcgtccc ccaaccgcaa     85800
     aaccagatat atgacatccc tcaacttaca aaactgttca ctttaggtcc ttcggtggtt     85860
     ttgaccctgg ttttatctga cgtggcggct gagtcagtgt gggacccacg ctggcctcac     85920
     atggtcaggg tgtccacatc aacaccttat ctctttcccc tcttctctcc cttctttctc     85980
     tcacttctct gtgcaggggc gtaggctggt tgacggagcg acgcgggaga cgagggtggc     86040
     ggcggggcgg ggcgaggcgg gactgctcac tgcaccaaaa gggcgggcag aacaagcgaa     86100
     gcggcggcgt cggcgggcga gcgcggcgcg gggggaggaa gaacccgaac tagcttagga     86160
     aggggcggac ccgggaaagg gcggggcgaa gcaggactgc tcactgcacc aaaagggcgg     86220
     gcagaacaag tgaaagcggc ggcagcggca ggcgagcgcg gcgcgggggg aggaagaacc     86280
     cgaactagct taggaagggg cggcgtcgac aggcgagcgc aggggggagg aagaacccga     86340
     actagcttag gaaggggccg gggggggagg aagaaccccg aactagctta ggaaggggcg     86400
     gcggcggcag gtgagcgtag cgggaggggg ggaggcaggc gagcgcggcg cggggggagg     86460
     aagaacctga ggcgcaccgg gaagaatttc ccggtcagtc acccatccca aaattgctct     86520
     aggccatgca cacttaacct tagagttttt tcgagatcgg cttccggaaa agaagttgca     86580
     acttgttgat gagtattcta ttaatcctat taagccctga gccgggatat cacattctca     86640
     cccccttaag ataccgacgt cctcgtcggt caacccaggc caggaatgtc tcctattagc     86700
     accacgtata tgcagacatt tttcggcgca catacgtcat accatacgac cacatcgtgg     86760
     atcatcccgt atacactgta tgcccgcgtg catattcata tatacgtata gctacaagag     86820
     tcggctctga taccatatgt gacgccccca cactctccga ggccgggccc tttctacatc     86880
     tggcagcttt cctaggatat agactgccct cacaaaccaa cactagtctt ttctgcacac     86940
     tttgttctca ctcatgcaca ctcgggaaga atttcccggt cggtcaccca tcccaaaatt     87000
     gctctaggtt aagaagaatt tctcggtcgg tcacccatcc caaaattgct ctaggccaag     87060
     cacgcttaat ctcagagttt tttcgagacc ggcttccgga aaagaagttg caagatatga     87120
     gtattctatt aatcctatta agccttgagc tgggatatca catcctcctc ccgccgcccg     87180
     cgtgccgctc ctttccccac cgcccacgcg ccgctccttc ccctaccgcc cgcaactcct     87240
     ccccctgtcg cctgcgcgcc gctcccccag cgttgccgcc ttgcactgtt gatctcgctg     87300
     agaagagaga gagatgagga aggcagagaa gaggggaaaa gagagaggag gctgacatgg     87360
     ccacgctgac atgtgggtcc cacgctgact cagccgccac gtcggataaa accgaggtca     87420
     aaaccaccga aggacctaaa acgaatggtt ttgttagtta agggataccc gatatctggt     87480
     tttgcggttg ggagacgatt ttgtaactcg atgacaagtt gagggacctt cggtgcacat     87540
     gaggcccatt ttatttgtgt cgggaatggg tttcgtttca cgtgaggccc atctatatgg     87600
     gccacaagga gactgcgatg tacttgcgtc ccgttataaa cgggccggac cgggcctcta     87660
     gtggcatcgt ggggtcgtag cccaggtgaa aacgcagcac atctccctcg ccaacgcggc     87720
     catatccaga agccgaaacc ttcttcccct tctccttctc tttcccctcg gcggcggcgg     87780
     cggcttctcc cttctcttct ctctctcgca tcgcctactc gttcgttttc cctcgaggag     87840
     gagcagaggc ggcggcggcg gcggcggagc ggacatggct gaggtggagg cagcgccgat     87900
     tgcggcggcg gagaccccgg aggtggcggc ggcggaggga gcggcggcgg cgaaggcgcc     87960
     gcacaagctg cataggcagt gggcgttctg gtacgacatc cagtccaagc ccaagcccgg     88020
     cgccgcgtgg gggacctcgc tccgcaaggc ctacaccttc gacaccgtcg aggagttctg     88080
     ggggtacgtg ccgatgaagc gccctaagcc cttgcccgat ccgtttcccg gtcttcggat     88140
     ctgatctact ttctgtgttt tgatcctgtc tggtagctca tatgcttgat ttagtggcta     88200
     tgccgtgggt atttctggtg gtgtagatcg ggggttctga ttattcccat gcgagcacaa     88260
     tctagaatga ttagagggta cttcggttag tttttttttt cgctgatatg tttgttgatg     88320
     ctatcgttgg ctgcagtttt cgtcagatct aattactaca atgcatcgat gctgattact     88380
     ttggagctga ttttaagtgt aggctgcatc gtggattact gatgtttagg gattgtctgg     88440
     atgcttgttt cccgaagtgc aaccctggtc gtttgttgtg tcttataaac aacaattgtc     88500
     ccctcccgca tagtcgtaac aactgatttt gaatgttcag atttctctac ggctttgtat     88560
     tgctgaacca gctgttgata gactagaatg tttaagattt ctcgaaggcc tcgtattgct     88620
     gaaccagctg ttgatagagt tgtcttattt ccatacatgc tgcatggagt atattttcta     88680
     gcttctttta tggatgttcc gggactttta atgtggttaa atgtacaagg gtagcaatta     88740
     tacaacatat gaacacaact atctttgttg tttatttatt attcaagctt gcatgcgact     88800
     tttttttttg tgtctaaaga taagaaaaat agttatacct tttgagactt acaactagaa     88860
     tgacattcaa tattgtgggc acatggaggc gtaggtatta attactctgt tgtatttttt     88920
     ctatgttttg gcaagttctt actgtaggta ttcctgccta ttatcggata cttttgaatt     88980
     tgattgtcct tttatcctat atgtgcaggc atgatcttcc tttcatttaa atccccttat     89040
     ttcttgctgc agcttgtatg atcagatttt ccgtccaagc aaggtgacag taaatgctga     89100
     ttttcattta ttcaaggctg gtgtagaacc aaagtgggaa gacccagagt gtgcaaatgg     89160
     gggcaaatgg actgtgccat gtagcaggaa gaccaccctt gagaacatgt ggcttgaaac     89220
     ggtacatttc ctctaaaatc attgcttagt ttggtcggag gctctgaagt gctttggata     89280
     taacatctgt tgcttgacct atcttctaaa gtttctatca tttctgctga caaacttttc     89340
     gaacatgcag ctgatggctc tgattggaga gcagtttgat gaaagtgagg aaatttgtgg     89400
     agttgttgct agtgtccgcc agagaggaga caagcttgca ttgtggacta ggactgccag     89460
     caatgaagcc gttcaggttg gttttttgaa aaatactgta gtataacaat atgagtgtat     89520
     ttgctcatat atttgatgta gcaagcaatt taatctgtag tacattgttt tcccaccacc     89580
     tctatagtca acattaaaca tgttgttcaa agctgccatg ttctctttag tattctgttc     89640
     atcaaatttg tccacttcac taattttgct caatttattt gggatacagt tgacaagtat     89700
     ttgatggtag gctagacttt acattttgtt tgcttttctg agttccatat cttatttgat     89760
     accatttatc tgcttgtttt attggaacaa tttatttctg tcttgagtag agaactattt     89820
     tgtttgattt gactttcagt caatttaagc tatgcttgat aaagcctatt gtgtgagcta     89880
     aatccctatt aggtaatttg atgccgtgtc aaagagactc aagactctta aagtcatctg     89940
     gtgcccacat catgcaatac tattgatggt tgatgcatcc attatgattg ccatctattt     90000
     tgtttctgat atagtgatat attgcattgg tatgataaca aaaacataaa cacaacatca     90060
     atgctggttt gcattgatga gcaccataat agtactaaaa cgtttcacat tttgcaatga     90120
     agcaatcgct ttgtaattcc ctaactcttc aaccatcctg tctctttttt ctgcacttca     90180
     taaatttttc attgttacca caggtctgtg cattcaaagg acatctctat atgtgttttt     90240
     ttttgagatt tgagcattac cttttgaaac atggcttcaa ccatagacca atgataacta     90300
     gagaaaacta acatgccttt gctttgcagg taaacattgg caagaaatgg aaggagattg     90360
     ttgactacaa tgataagatg gtctacagct tccatgtatg tgtttagact atttttgttg     90420
     tctcaataac atattatttt ttagtcacct gtagaataga tcaaatacgt ccatagctca     90480
     ttctatttgg atggtgcttc aacttcaatg caggatgacg ccaagaggga gaaaccaagc     90540
     agaggtggac ggtacaacgt gtaagtcacc gcaaaacgtt gcagcttgga tagtggccat     90600
     cgagtggtgt gccgataccg gcgcctgttc tttacagcct cagctagtgt tgttgtccga     90660
     ggcaattttt ccgacctatt gtgttgcttt cctctctgat agcttatggt aaaagataca     90720
     aagatgttga ggagtttgta cgccacttaa ttttgctcgt aacatacatt gacaatcaag     90780
     aggagccatg gcattgcgat ctgcttacac ggcatattct tactggatgg tgtacactac     90840
     ttaccctttt taatgcaagc atcaatccat tgcttttctc actgcacacc tgattcgtac     90900
     tgaaaacgtg aaacataaaa aaaaacaaaa atctagctga tgttggctct cggggcctcg     90960
     agtctagttt gtcctagatg gctaacctga tatgtgttgg tcacgctcac gtttgaaccg     91020
     agaaagagtg tgtgtgtgtg tgtgtcggcg tgctgctaca ccagagcctc cctgaatcgc     91080
     aatgcgtgtt aacgccagca tcgcaggatt tcatctcact tgacaggttc agatggcctt     91140
     cctcctaccg tctgccattt atacacgcag tgacttaacg cttacacgag ccggatggcc     91200
     cggatctccc ccctgcacca tctcaccaga aaaacggtga ggcgtcaccg caacccaccc     91260
     accaaacaca tccacgtccc ttcaccgttg gccttcgatt ttgcttcagc tgcactacga     91320
     cccctccaac acatttccct cgcgtctcgt tgcgatctca ccttacgacg atctcgttcc     91380
     agcagcagca gcatcggcag cggcggcttg cttccgaagc gagcaatgca tggcgcgcgc     91440
     ggccgcgtgc gtgcgtgcct tggcttgcgc tctaatcaaa ccgggacgcc ccaactcacg     91500
     gttggtgcgg gacgccaccc cgccacctta ccgcccccgc ctccctgcat ctgatcatca     91560
     accagctgct atatcaccta gctagccgcc gcctcctcct cgcccaccaa cgtcgcttcc     91620
     ccggcacctc accatggaca ccgcctccgt caccggtggc gagcacaagg ggaaggagaa     91680
     gacgtgccgg gtgtgcggcg aggaggtggc ggcgagggag gacgggaagc cgttcgtggc     91740
     gtgcgccgag tgcggcttcc cggtgtgcaa gccctgctac gagtacgagc gcagcgaggg     91800
     cacccagtgc tgcccccagt gcaacacccg ctacaagcgc cacaaaggta acatcatgtg     91860
     ttgtgtccat gtgatcaatc gcaatttagt tcacaagatc gagcttgaca agaatgtctg     91920
     tctgtctgtc tcgatcgatc ggtcgcaggg tgcccacggg tggaaggcga cgaggacgac     91980
     ggcggcgaca tggacgactt cgaggaggag ttccagatca agagccccac caagcagaaa     92040
     cccccccacg agcccgtcaa cttcgacgtc tactcggtga gagctcaact cgactcgatc     92100
     gatccatcgc cattgatttc tcactgcaat tgctctgcaa tcaagtgctt gtaaactgat     92160
     gcgaaacctg tatacaacct ttgtcttgca ggagaacggc gagcagccgg cacagaagtg     92220
     gcgccctgga ggcccggcgc tctcttcctt caccggaagc ggtcggtact caaatcccgc     92280
     aagaaattgc gtttcttggt gtaacaattc atctgaagat gtgtgtgtgg attgctgtga     92340
     aattgcagtg gctgggaagg atctggagca ggagagggag atggagggtg gcatggagtg     92400
     gaaggacagg atcgacaagt ggaagacgaa gcaggagaag cggggcaagc tcaaccgcga     92460
     cgacagcgac gacgacgacg acaagaacga cgacgagtac atgctgtaag cttagctctc     92520
     caaagatcta tctatcgatc gacctcagat ttttcaaatc ttgtgaactt tggcatgatc     92580
     gtgatgatcg aatttctgca tgcaggctcg cggaggcgag gcagccgctg tggaggaagg     92640
     tgccgatccc gtcgagcaag atcaacccgt accggatcgt gatcgtgctc cggctggtgg     92700
     tgctctgctt cttcctcaag ttccggatca cgacgccggc gatggacgcg gtgccgctgt     92760
     ggctggcctc ggtgatctgc gagctgtggt tcgcgctgtc gtggatcctc gaccagctgc     92820
     ccaagtggtc gccggtgacg agggagacgt acctggaccg gctggccctc cggtacgagc     92880
     gcgacggcga gccgtgccgc ctggccccga tcgatttctt cgtcagcacg gtggacccgc     92940
     tcaaggagcc gcccatcatc accgccaaca ccgtgctgtc catcctcgcc gtcgactacc     93000
     ccgtcgaccg cgtctcctgc tacgtctccg acgacggcgc gtccatgctg ctcttcgaca     93060
     cgctctccga gaccgccgag ttcgcccgcc ggtgggtccc cttctgcaag aagttcacca     93120
     tcgagccccg cgcccccgag ttctacttct cccagaagat cgactacctc aaggacaagg     93180
     tccagcccac cttcgtcaaa gaacgccgcg ccatgaaggt aaaccttctc cactccatct     93240
     gcgggttgag tgtcgtggat ataccggatt caagggttta atatattgtt ttaggcattt     93300
     gtgttggggg gaccgatata gccggttatt tcgatccaaa attattttat tttattttga     93360
     aaaaaaatga ttaaaatttg aataaatatt atcaaattca caaaaatttg aaaaacattt     93420
     aaaagtttcg tccgaaataa tatcatatca ggttgtccaa tagaactgaa atgtcaaaaa     93480
     ttatgttatg taattttgaa ccctcattca attggagcat ctcgtgatca gtctgttttt     93540
     ggagatgtag gctatggcta aacttcgtta ccgatatatc ccttctcgat gttgtcatcc     93600
     agtttagatc gtctataagt tttttaacac ctactcttga tgtgacagag agagtatgag     93660
     gagttcaagg tgaggataaa cgcgctggtg gcgaaggcgc agaagaagcc ggaggaaggg     93720
     tgggtgatgc aggacgggac gccatggccg gggaacaaca cgagggacca cccggggatg     93780
     atccaggtgt acctgggcag ccagggcgcg ctcgacgtcg agggcagcga gctgccgcgg     93840
     ctggtgtacg tgtcccgcga gaagcggccc ggctacaacc accacaagaa ggccggcgcc     93900
     atgaactccc tcgttcgcgt ctccgccgtg cttaccaacg cccccttcat cctcaacctc     93960
     gactgcgacc actacgtcaa caacagcaag gccgtccgcg aggccatgtg cttcctcatg     94020
     gacaagcagc tcggcaagaa gctgtgctac gtccagttcc cccagcgctt cgacggcatc     94080
     gaccgccacg atcgctacgc caaccgcaac accgtcttct tcgacgtgag cactgccttc     94140
     ttctccggcg tgcgtgcgtc gcgccgtgac gtgagctaac gatggtgtcg tttgatgtgc     94200
     agatcaacat gaaggggctg gacgggatac aggggccggt gtacgtgggg acggggacgg     94260
     tgttcaacag gcaggcgctg tacggatacg acccgccgcg gccggagaag aggccgaaga     94320
     tgacgtgcga ctgctggccg tcgtggtgct gctgctgctg ctgcttcggc ggggggaagc     94380
     gcggcaagtc gcacaagaac aagaagggcg gcggcggcgg cgagggcggc ggcctcgacg     94440
     agccgcgccg cgggctgctc gggttctaca agaagaggag caagaaggac aagctcggcg     94500
     gcggcgcggc gtcgctcgcc ggagggaaga aagggtaccg gaagcaccag cgcgggttcg     94560
     agctggagga gatcgaggag ggcctcgagg ggtacgacga gctggagcgc tcgtcgctca     94620
     tgtcgcagaa gagcttcgag aagcggttcg gccagtcgcc ggtgttcatc gcctccaccc     94680
     tcgtcgagga cggcggcctc ccccagggcg ccgccgccga ccccgccgcc ctcatcaagg     94740
     aggccatcca cgtcatcagc tgcggctacg aggagaagac cgagtggggc aaggaggtaa     94800
     tccatcaaaa aatctccacc attttcaagc tcgaggaaga tgatcgaagc taaccaaaaa     94860
     tcaaaattct tgcagattgg gtggatctac gggtcggtga cggaggacat cttaacgggg     94920
     ttcaagatgc attgccgtgg gtggaagtcg gtgtactgca cgccggcgag ggcggcattc     94980
     aaggggtcgg cgcccatcaa cctgtcggat cgtctgcacc aggtgctccg gtgggcgctc     95040
     ggctccgtcg agatcttcat gagccgccat tgcccgctct ggtacgccta tggcggccgc     95100
     ctcaagtggc tcgagcgctt cgcctacacc aacaccatcg tctacccctt cacctccatt     95160
     cccctcctcg cctactgcac catccccgcc gtctgcctcc tcaccggcaa gttcatcatc     95220
     cccacggtaa agaaccaacc aagaacatca aaatttccgc taaaatttca agctccaaat     95280
     gatcttgcac tgaccgatcg atcgcgatct tggtgtacgt gtagcttaac aatttggcga     95340
     gcatatggtt catagcgctt ttcctgtcga tcatcgcgac gggggtgctg gagctgcggt     95400
     ggagcggggt gagcatcgag gactggtgga ggaacgagca gttctgggtg atcggcggcg     95460
     tgtcggcgca cctgttcgcc gtgttccagg gcctcctcaa ggtgctcggc ggcgtggaca     95520
     ccaacttcac ggtgacgtcc aaggccgccg ccgacgagac cgacgcgttc ggcgagctct     95580
     acctgttcaa gtggacgacg ctgctggtgc cgccgacgac gctgatcatc atcaacatgg     95640
     tggggatcgt cgccggcgtg tcggacgccg tgaacaacgg gtacgggtcg tggggcccgc     95700
     tgttcgggaa gctcttcttc tccttctggg tcatcctcca cctctacccc ttcctcaagg     95760
     ggctcatggg gaggcagaac cggacgccca ccattgtcgt gctctggtcc atcctcctcg     95820
     cctccatctt ctccctcgtc tgggtcagga tcgacccctt catccccaag cccaagggcc     95880
     ccgtcctcaa gccatgcggg gtctcgtgct gagctgctgc tgctacttct ctgtgtctct     95940
     gcattttgca agagggatga ccggatggat gattcttgtt gtatggagta ttttgacttg     96000
     ttcatgtaca agtttttgtg agtgggataa aagtgttttg ggggtaaaat ttgtaagaac     96060
     tgaggtggag attatactcg aatttaagaa caattgtttt tgaattttct tttaagattt     96120
     ttgggagtaa attcagtcca tagttcggcc gaaaaggtcg taaaattggc cccttatttg     96180
     agcgttagtg cggaccgaaa atgagcgcaa atttagccca ttaggcccgt aaatttggcc     96240
     caacagtgag cgttagttgg acccaatgag gataaattcg gccattattt gacgtaattt     96300
     cagcccaatg ctttctgctc aatggtccgt tggtttgcgc atatttagcc catatatgca     96360
     ggtaaatctg acccagaaat gctggtcaat ctggccgaca agtttacgtc gattgagccc     96420
     aaaagctggc gtgaattcgg cccttatgtg agtgcaaatt cagccgataa ctgtgcataa     96480
     attcagcccg taggaaggca tcaattcagc ccaaacgttc ggtaatttac atgtagattt     96540
     tacctcgcct ttcgttagta ctttcaaact tctaaacgac gtgtttcatg aaataacttt     96600
     ctccataaaa cttgttttaa aacatagata gataaatcca atttttaatt tcttttttaa     96660
     aaaaagtcaa tcaacactct tcatcatctg ttctcaaacg ggactaaata tcactgtaca     96720
     aaaactatac agatgctaat gagaatctac taacggaatc acataagcac aaagcaatcg     96780
     ataatttgtc acaaattttc tctctcatct gtgagaattt gtcaggtcgc ctatcttgat     96840
     catctcgaac ggcctgtcca ggatcggtcg ccggcgagcg gcgagctcct gcgcgacggc     96900
     gcgcatcgtc ggccgggcgt cggggctcgt ccggacgcaa gacagcgcca cgacgaaggc     96960
     gaacacgacc tgcccggcca gcttccccgc cggggcgtcc agcctctgat ccaccacgtc     97020
     cttgagcagc agccggcgcg acgccgacgc cgacgcctcc tcgccgccgc cgccgccgct     97080
     gccgtcgtgc ccctcggctg acagtgactg cggcgagtgt tgcagcgagc tgatgagccc     97140
     gccggggtac ttgcccatga gcatctccat cgccacgacg ccgaagctgt acacgtcgca     97200
     cttggtcgtc accctcatgt acgccagctc tgcggcaaga ccgcaagata aacatggtat     97260
     cagcgtcaat ggcggattcg gtgtgtataa ggggtgaaaa tggtcacgaa aattctcaat     97320
     caattgggcg ccgtttatgt ttaaggggca ctgttttcaa cggttttcct tttttttttt     97380
     ggctatacta gcttagagtc cgtgcattgc aacagaaaac aaattaaatt tctagcttat     97440
     tgaatcaatc aatcaatcta ttatattatt aaaacagcat tgaaaggagg caccatgttc     97500
     gctgtggggg ctagaaattc ccacattaat cagagaaaaa gaaaaaaaaa aagaaaagaa     97560
     gagtccaagt agaagtacaa tttaaaaata tctaaaattc agaattaaaa ataagcaata     97620
     ttgaaataag tttccatata agaacccaat acgagattaa tcaaaattca aaataaaaat     97680
     aaaataatat ccaaaattag aaaaggaaag gagagtccaa gtagaaatac agtttaaaaa     97740
     tagctgaaat tcggaattaa aaataagcaa tattgaaaga agtttccata taagaaccca     97800
     atacgagatt aatcaaaatt cgaaataaaa ataaaataaa atccaaaatt agaaaaggaa     97860
     aggagagtcc aagtaggaat acaatttaaa aataactgaa agtcggaatt aaaaataagg     97920
     aatattaaaa aaagagtaca tacaagaacc caatatgaga ttaattaaaa ttcggaataa     97980
     aaataaatcc gaaattagca aaagaaaata aaagaagagt tcaagtatga atacaattta     98040
     aaattagatg aaattcgaaa ttaaaaatag gcaatattga acgaagaatc catataagaa     98100
     cctaatacga gattaataaa aattttgaat aaaaaataaa ataatatcca aaattagaaa     98160
     aattaaaaga gagttcaagt aggaatacaa ttttgaaaca actaaaattg aaaatagaaa     98220
     ataaaaacat taaaaaaaca caatacggta ttaactaatt tttctaaaaa aaattaaatt     98280
     ctgaaaatag aaaaagaaaa ataagatttc aattaggaat acaatgtata aaatttgtga     98340
     taaaaataaa gactattgaa agaaaaccat ctaaaacaca tgacgagata aattaagtac     98400
     catgcatata aaggagtaga gtagtggcgg ttgatacgac atataaaaat tgttaataaa     98460
     acaccaaata gaatcctaat gacgattaaa aggagggacg tcaagtaggc cgtgaagcaa     98520
     acaagtaagg cggttgccga gacttctaga aagtaaaaaa aaaacaccat tgataatcat     98580
     attcgatttt taaaatctca atgacaataa aaaggaaaaa cagtgggcag ggtgtataag     98640
     agtatagttg cagagccgcc gacggttgac gggacttcta gaaaataaaa aataaattct     98700
     aacgatagtt atgttcgatt tttagaatca caatgacgat aaagagtagg cggcggacgg     98760
     gctgtagagg ggcatagtgg catcgtttga agggacttct aaaaattata aaaaataaaa     98820
     ctacaagttt aatttttaaa ggtttggaac ttctaaaaag taaaaaaaaa acaataataa     98880
     tcatgtttga ttttaaaatc tcaatgacaa taaagaaggg aggcagcggg cgaaccgtag     98940
     aggagtacaa tggcaaagcc gctgatggtt tggcgggact tctagaaagt aaaaaatgaa     99000
     cacaaatgat aattatgttc gattttaaaa atctcaatga caataaagag aagagacagt     99060
     ggacgggcca tagaggagta taatggcaac gtttgacggg acatctagat attataaaaa     99120
     tgaaacccaa cataacaata aactctaaaa actataaaat ccaattttta aatgttccaa     99180
     gaaaaatgaa tagaaatagt gatagatcga gcaagcaaat aaagaaggag atgacataag     99240
     gggtagcaac tggtgtgact tttaaaaact atataattag aaacacgagg atgataaggt     99300
     ttggtctttc aaagtcttaa gacaatgagc tagttattta ataaatttta aatgaatcat     99360
     actaaaataa tatatgattt tgtttgggtg ctagccgcgt aattgcgcgg gtcacccagc     99420
     tagttaataa taagacccta tttagtctaa gtaatactat agtttttctt atttcaacaa     99480
     gtaggtgatt ttgaaatttg ggagagctaa tggtgaaatt gaagatttgc tgaaaggtaa     99540
     tagtatagat tatgagaccc atatgtcaat ggtagagatt gcgtgcgaat ggacaccacc     99600
     actattaaga ttttaaatat catagatata aaatttgttt tttctaattt ctttatgcat     99660
     cacattaata tcgtactgag tagtttaaat gataaatata atcaactagc agcgtcgtta     99720
     gattccgacc gttttcaccc tgtgtggcta tggatgtacg gacagtttgt acctggtgcc     99780
     atgtagccgt aggagccggc gatgctgtcg caggtggagc ggccggggac gaggaacctc     99840
     gccgtgccga agtccgacac ccgcggctcg tagtccgggt cgaggaggac gttgttgacg     99900
     gagacgtcgc ggtggatcat cggcggcgag cagtcgtggt ggaggtaggc gagcgcgtgc     99960
     gcgacgcccc tgatcgccct catcctcgcc ggccagtcga acctgcagcc gccgccgccg    100020
     ccgccgccgt acagcaccgc gccgaggctg ccccgctcgg cgagctcgta cacgaggtac    100080
     atgtacccgc ccatggcgca gaagccgtgg agcttgacga tgttgcggtg gcggacccgc    100140
     gtcagcgccc tcacctcgtt ctcgaagctc ctctcgctga cgccccagca cgcgtcgccg    100200
     gtctccgacg cgtcgagccg cttcacggcg acggcgcgcc cgccgccgag gtcggcgcgg    100260
     tacacggtcc cgaagctccc cttgccgatg cagtacgcgt cgttgaagtg ctccgtcgcc    100320
     gccaggatgt cgccgaagga gaacgtcgtg tccttgctcc atatcgaggc ctgcaccgcc    100380
     gccgccgtcg agctcccgcc gcctccgctc gccgacgtct ccgccttctc tacgacgacg    100440
     gcggctcgcc tcgccttgcg tgacaccgcg caaaccacgg ccaccatgga caccagcagc    100500
     gcggcggcga cggagagcgt gacggcgagc accagcctcg tcttaccgga gtggccgtcg    100560
     ccggtggtgg tgttcgagct gcaagagttc agcccggcaa tgtcgtggcc gcacaggccg    100620
     gggttgccgc tgagatccag cgtcgtcagc gacctcatct tgccgagcag gggcggcacc    100680
     tcgccggaga ggttgttgct gctcaggttg aggtaccaca tctcggccag cttcgtcagc    100740
     tccaccggca cgccgccgtc gagcgcgttc ccggacaggt cgagcatctc cattctcgcg    100800
     gcgttcccga gcgtcgcagg gacacgtccc gacaaggcgt tgcggcgcag gttcagcttg    100860
     gtcaacggca agctcccgag ctccggcggg atctcgccgg cgagacggtt cgacgagagg    100920
     tccaaatctt gcagggacat ggcgccgtag ctcgccggaa tcgctccggc gatcttgttg    100980
     ccgctcaagt ggaggaacga gaggctcttg aactgcgccc agtgctcggg gagctcgccg    101040
     tcgaacgagt tgccggacag gtcaaggtag taaaggtcgg ggtgcgacgc gaggatctcc    101100
     gacacgtcgc cggcgagctt gttccgtgcc atccggaggc gcacaaggtt ggtcaggttg    101160
     cggtagcacg ccggcacggt gccggagaat tggttgtcgt cgaggccgag ccaccggagc    101220
     cgcggcgcgc tcgcgcacac gccacgaggc agctcgccgg agaagcggtt gttcgccatg    101280
     ctgacgatgg agagctggcc gttccggccg aactccggcg ggatggcccc ggagaggagg    101340
     ttgtcgaagg cgacgaggcc gacgagcctc ggcagccgcg cgagccccgc cgggagctcg    101400
     ccctccagca tgttgctgct tacggacagc ctctgcagcg ccgccatgtc gccgagctcg    101460
     tcggggagcc ggccggtgag cttgttggtg tacagccgca gcgtctcgag gctcgtgagg    101520
     ttgccgatcg tgcgggggat cgcaccggcg agcttgttct cggcgaggtc gaggagcttg    101580
     aggttggcga gcgttccgat caccggcggg atcgcgccgg agaggttgtt ggtcgccaag    101640
     gagaggaact ccagcctcga cgccatggtg atcgccgtgg ggatctcgcc ggtgaaccgg    101700
     ttgccgtccg cctggaacac ctcgaggttg gtccaggcgg tgaagtagtc gggcaagacc    101760
     tcgccggaga gcatgttctt ggagacgttg aactcccgca ctctcgtcag cctcgccagc    101820
     gctaccggca gcttgccggt gagcttgttc ccggcgaggc caatgacggt gaggttggcg    101880
     cagaggctga gctcgtcggg aatggtggac tccagcccgg cgaggctgac gttgatgtgt    101940
     tccagcgacc ggagcttgcc gagagtggta gggatcgcgc cgcccaacgg gttaccggag    102000
     agctcgagcg ttcgcaggcc ggagatgttg ccgatcaccg gcggcacgcc gccgtggagg    102060
     aggttggagc caagaacgac gctctggagc ttcgtcagct tcgcgaggga cgccggtatc    102120
     tcgccggaga actggttgga cgagaggttg aggtgctcga ggttgggcat gagcgccggc    102180
     agcgccgccg ggatcgggcc ggagaggttg ttgctcgaca gatcgatgga ccggaggctg    102240
     agcagcggcg acgacacgtt cgacgggaag gagcccgtga gcgagttgag gctgaggttg    102300
     agcgcggcga ggcccggcag cgacgagagg tcgagggcgt cgagcgtccc ggcgaccccc    102360
     gcgccgccac gtcgacgccc accacgacgc ccgacgcgtc gacgccacgc cgcgccacgc    102420
     gcgccgcgac gcggggttcg cgttcggctg ctgcggcgac ggcgtcgccc acgacccgag    102480
     gacgccggcc gccgccgccg ccgagcgcgg cagggtgtcc ttccacgcga gcagcgcctc    102540
     cgcctcgccc ggcgcggccg tcgcgccgcg cagcgaggcc gacacgagca gcaggtggag    102600
     cacaagcacg ccgcgtgcat ggtcgcgcgc gcgccgcggc ggcgttcccg cgtcgtggcg    102660
     cttcatactc cgccgcgggt ggctgaacca cggtgattgg agcggcgccg gcgagtaggg    102720
     gctacgacga ctggacgcgc tccggcgaga gcgcggcggc ggccatggct agcattgctt    102780
     gcaaggaggt gatcgagagg tgttagagcg actgagccgg cggtggttgg gcgggcgcca    102840
     tcaagcgcac tgtttgttcg agatatgatt tctctatatg tgatgagtaa atatatctct    102900
     atcaaaaaat aggattgcta gacttttggc gtccaaaaat tatgaaaatt tgaaaaattc    102960
     aaaccatgag gtcacgattg gattcatatg gagattgatg ctccggctat gacacgatgc    103020
     tggcttggta ggcacttaaa gatacaagat catgggtcca atactctctt tggaacttag    103080
     gaatataaaa aacataaaaa tagaatgtca gtaacacctt gaattgtaag gaacaaaaaa    103140
     tacaggaaaa ctacgtggga tggaatacaa gaaaagcaca ggatatggca gagagaggta    103200
     ggcataaatg gaaattccaa agagattaga gagctcatgc caggaatcct tcaaaattcc    103260
     catgaaacat gccattccac acaaatttca aaagaattat atgggctggg acctgattcg    103320
     ttccaaaaga cctaatagaa aattttacta taagatttaa atcctttgaa atcttattat    103380
     ttttcctgtg ttccaaggta ccgttaagca ttggtggcaa agagatgggt gaaaggacac    103440
     aaacattctg catagagcta gagactaagt gagtgaagtg ggtcagagca caaatcttga    103500
     agcaatctta tatttgcaaa aaaaaaaaaa actttagata accgtttcaa atgtggcaat    103560
     aaccatttgg ttatcgtggt tatcaatctt atctatctag ccgtagccgt atttacgaat    103620
     cgctcgataa agtagataac tttaaaaagc atacaatttt ttcaacaagt tttgctggtt    103680
     ttcgataata accgcttgat tatcacggtt gtcttaaggc aatcggttct gtaaaccttg    103740
     gctggagaat agagaatccc ctcatgaatt atttttctcg tttgaagttg ataccctaaa    103800
     ttcttttaaa aaactgggta ttcctttgag tgtacggtta ccaaccattg tgtactttca    103860
     tagtcatccc agtgcatata caacagtagt agtgatctag tggacaactt gtgcaagcct    103920
     atctatccga tatgcttgag ttccaaaagc cacatttcag cgaaaaaaga aagttccaaa    103980
     agctacacaa caatgtataa tctatttgac acgcaattac aacattctat tagctcttcc    104040
     attgcgtgga ccagtacaaa attgaactgt ttaatcctct aattatttcc ctcatatccc    104100
     tagttttttt agataatgac ctccttagtt gagctctcgt ccttgcttca gctgctgacc    104160
     atgtacgggt agttgcaaca ccaattgact agaacattat gtcagcaatt ttcttaggga    104220
     ttttttaatg ttatagaggt caaccaagtg caattaattg ttgttgctgc tggctggatt    104280
     gcactgcatg taattaaggt gacataagtt ttttatactt gcaaaccgtg tttgtttaat    104340
     ttgcttgttt gtttatatgc agttgatctt gcatcattgc tcttactggt aggacgcttt    104400
     ctacgacagg ttggtacatc aagcttgaga tgttgagaag ctataatagt aaactcttca    104460
     aaatgttgga gctggcacta gcagatgaaa cagtgcaagc gatggactaa tttaatcctt    104520
     cttctttttg ccgagtaact tagaataaat ctaaatgtaa ggtgccaatt gcgataagga    104580
     aaatatttta tttctatgaa aattttgatt gtttgatcat tttgctattg atgtcatttt    104640
     cagaattagg tgggaaaaga tgaactgatt ttgtacagtt cagtgtgctg acaaagctga    104700
     agaaaggaga aacaggggat gccaattccc gctgtttggc actgtatata tgctcagtta    104760
     aatgtccgat aaacaataag ggtgtgtttg aggagattgg gaagatacgc aaaacgaggt    104820
     gagccattag ctcatgatta attgagtatt aactatttta aatttcaaaa atggattaat    104880
     atgatttttt aaagcaactt tcttatagaa aatttttaca aaaaacacac cgtttaatag    104940
     tttgggaagc gtgcgtgcgg aaaacgaggt gctttctccc tcaatgtcct ccaaacgaac    105000
     gctgcctaag tgaagaaaaa gtacataagc aaagaggaat tacactgtgt cgaaacaaga    105060
     tttcggcaat aataaaaggg ggtggctatc aagctaggaa agtggatggg tttgaagaca    105120
     aggaatttta tacaggttca ggccttctta ttcaagaagt aataccctac tcctgtccgg    105180
     ggatgattcc gccgagtgtg ttattgattg tataattggg aaaaaagaat cgtgccccaa    105240
     gaggcacacg gaccctcctt atacagggga agggatccgt aatacaaagt acaacccata    105300
     tcctaacgga atatgggatt acagataaaa cacaatcgta accgactagg atcccgggta    105360
     ttttcttgac atacaagttt agaatctaac ccgagtcctc gtaaaaatat tttatctata    105420
     tttggtaccg tatatccagc tggaatataa ccgccatgta gatatggggt aaccataatc    105480
     tccacagtag cccccgagac cttcacagtt gaccaaaata gtcttctcga aacaaaaaca    105540
     ataatccgag tgctttaatt caacttgctc cggcttgccg agtgctaaaa gactgtaaag    105600
     ggcgaaaata aaacatggtg catcgagtag atgcacctaa ttaggtgtag cccctgacta    105660
     tgtgattagt tgaaaaacta aacatatagt caagaaccga gtggttttat agtgaagcac    105720
     gcatggtact tagtaagata cccaaccgac tgcttctcaa tcttgaatat atcaaggaca    105780
     aaaaatacaa gaagggccga gtgataaaca ctcaaaaggt ctaaaaatat atatatttgg    105840
     taggaatccg agcaagaaac tcttaaaatg atccaccaaa tatgataaag atcatggtaa    105900
     ttaagaagtt cattagccta ggctataacc tttaccataa tcaaaataag catataacat    105960
     gctaagagaa taactatgaa taaaccagtc atctcaaatc aacccaaaca gcttttgtag    106020
     cctaataaag cttacaaaaa cggcataaca cctttctgtc aggcaccttt tgtttgcatc    106080
     gtgttaattc taaagaatta gcaaaccgca ttaaaaagga tttaatcagc attgggccac    106140
     aacattgtga gtacaaattg ccaaagcaaa aagtgcctaa gtccctaaga atcacaacgg    106200
     gccacgctgg aaataaaatt gggctgaagt actgtacagg cccaggccca ttagtactca    106260
     cgatacccta aaaaacaccg aagtccaagc gacgcttcgt cttccccgcc aagactctcg    106320
     ccatttcccc attcctcgct acagtacaag actacgccga cggagctagg gttcatcaat    106380
     ccgccccaat ccattctcaa aaatcccacg aatcttctcc acgcgtccac cgcaccgatt    106440
     cccccatccc tttccatccg tatctcgaac caaatcaaac catccagttc acattcatgg    106500
     tggaagaaag agaaagcttc gagagtcagt gggcgccctc cgatgtgaca gaagataatc    106560
     tgaaggagat ggtggcgcac ggcgttcttc cagcgaagga gatcatcggg tggcgaccgg    106620
     catttggcga agcattcccg actcccgata cgcatgaaat cgtggtattt gctcacttct    106680
     tctatggcgg attttctctt ccaacctcaa gatttttccg gggcattctg aacttctacg    106740
     ggattagctt gcatcatctg aatccaaact ccatagtgca tattgccaat tttatccacg    106800
     cctgcgaagc ttttctgggc attaggcctc attttgcctt gttccgccgc atcttcttcc    106860
     tcaagcccca gccaaataag agcaaaccat gcgtagttgg gggtgctggt ttccaactca    106920
     ggggaacact aagccaaaaa tacttctcca tgcccttcaa gacctcaaat aaaggctggc    106980
     acgcaaactg gttctatgtt cagaatcctg agcccgcact cctgagcacg caaactgtct    107040
     tcctccggtt taccaggaca catggaactc attgcctatg ggagatgaag ctgctcaggc    107100
     agtagaactg atggagagga tgataaagct gaaagaacag ggtcttcaag gagagcagat    107160
     cacccagcac ttcatcaagt gtcggttagc tccaatcaaa gaaagatccc gcacagcttt    107220
     tgagttcgac ggcaagcatg atccaaatcg ggaagatcca gattctcttg actttaaggt    107280
     catgaaagaa agaatgtaca agatcttctc aaacgctatt gtcgtcagct attcacatct    107340
     gctgcccgtt gtgccattca acgcattcaa ccctcctcca ccggtatgca ctcaaacatt    107400
     tcaaccttcc tcaaaatatg atcttgtctt cctgttgaat caattaataa tgaaagatat    107460
     tacacccagg aatttgcttt gatgaaatcg gatcccccaa tcgctcaacg ccgatctccc    107520
     cgccaccaaa ctgggcaagg gagcggagga ccaagaattc ggtctgaaac tcaaccaagt    107580
     gcttctgatt cagtcggcca gtcagactct cgaaagagga agctggttct gagtgacgac    107640
     gaagccgatg ataccaccag gaggcctgga gaccgagaga caaccaagaa actatcaaaa    107700
     caggctactc caaagaagaa aacatccagt cgccctgcgc caaagatcag gaagtcttct    107760
     aggtacaact catataacga tctctcttgc attgatgcac atccattgca gcaataatac    107820
     taataatcaa atttgcagga aaccatctga tatagatccg tcagggaaag actctgaccc    107880
     gactagcgtg gacgcaaatt cttccaaaga aatcgggaca actgccgagg accgtccaag    107940
     tgacaatcag ccggcaaccg ataatgtaga atccggtgat caacccccga ttggaaacca    108000
     gtcggccgaa gccgaagccg gggttaatca ggagcccccg actagaaacc agtcggacgc    108060
     aaggccaagc caagagattc cagaggttgg agctcaagca gatagccttc gcagtcaaga    108120
     cgccagcaat aaccagagat ctagatctcc tttaaaggca tccgaatcca ctcatcctca    108180
     tccagaaatc attatgggta aaacactttg tctgaaacca tgtcaaccca aataactctg    108240
     accaattgtc taacctctgt tagtagatac attagggcca atgatcagtg atgaagaaga    108300
     aattccccgc atacaagcag ctgaggattc acgccctccg attctggtca agtggtggga    108360
     tgacaacatg cagcctcaag ggaccgtgat aaataagcaa aaagaggacg aagagttatg    108420
     cctactgaag aaggcacttg gtcaggcaac ccacattgta aatgtaagcc ctctggtacc    108480
     tgatctcaac catcttgttt gccatttaat tcaggcgcta attaaactgt cttgcagagg    108540
     attcatctta ggaacgaagc taaaacggaa accttagaga ggctagtccc tcatctcggg    108600
     accctcgaag ccaccaggag tctgctgcac gagacaaaag agcttgccag gaagaatgag    108660
     catgatctga ggaatcgaat tgctgagctc caggaatcaa attttgaact gagtggctca    108720
     tcaaaaggta cgtacaaacc ctacttaact gactcatatt gttatctttg caatcttgat    108780
     taaccgtagt caatgtagtg caaactgcca agatatctca gttggagaag cagattcaaa    108840
     ttctggaaaa cgacaaggca gagctggcaa gacaaagaga cctggcttta aaggaagttg    108900
     aaggtatcaa caatcaatat ctcaaaagcc attatcctcc atatgctgac ttattaatgt    108960
     gaatctgttg atgcagaccg caagattaaa tctcaagctc aattcgacgt cctggttagc    109020
     aagatcaaaa aacttgaagg agcccgggat gaggttgata acgctgctgc cccaattgtt    109080
     caagcgatgt tcttaaataa caacggcccg agtgcacttg atgcttccga aattttcgac    109140
     aagctgagag ttgctccgga tatatatttc aagaacatca aagaagctgg aagtatggga    109200
     gtaagtatgg cgttggcgat gactaaatcc ctttatccga gagttgatat tgacgtcatt    109260
     gatggctttg cagacgggac gagcgaagaa gctgctcttg acctcatcag tgatgcgcag    109320
     aaagcggctg acaaaattgc tgctgatgta gttgagagat ttcaggacac cgatcttcga    109380
     ccgactggtc ctggtaattc tgatgatgaa aagactgaga ctgattaatg taccgataat    109440
     tttgatgatt aatgatgatg gaggcacaat ttgtacaata ctgatgaatt tatgctgtgc    109500
     ttgatatctt aactttgctc ctgatttctt aaaagttttt gtcaaacctt gttgagccta    109560
     aaacccgcaa aagttgttaa aaaactttca gtcctcattg actaagccaa gaaatcaaac    109620
     agggcaatga tacatcaagt aggcaaattg aattgataaa aatcacactc cattattatt    109680
     atagtagccc cctaactgaa aacttcaaga aaaaacttga agttagcagt caaagaggaa    109740
     agatacaaac gaaatgccta agcataaaat tgacgaaggt gttcaatgtt ccaagaatta    109800
     ttgatgatag taccatcttc gcgcttgagt cgataagaac ccggccgagt gacttcagca    109860
     attatgaacg gtccttccca taagggagat aatttatgcc gatcctgtgt tttttgaatt    109920
     ttccttagaa ccaggtcacc gactaaaaag gctcgcgatc gaacattccg attatgataa    109980
     cggcgcaacc cttgcaaata tcgagtcgac tgaattaaag ctgcttctcg ggcttcttct    110040
     agtcggttga tgtcgtctac tcggccttct tcatagccct cctcgttgaa gttccaaaat    110100
     cgtagtgatt caaattccac ttcactcggc aacattgctt ctgcgccata aaccaaaaag    110160
     aacggcgact ggccggtagc ccgactagga gtagtgcgta aagaccaaag tacggacggc    110220
     agctgatcta cccacttgcc agcatagggg cgtaatcggt cgaaaactcg tgctttgatc    110280
     ccttgcagta tcatgccgtt agcgcgctca acttgtccgt tactcatagg gtgtgccacg    110340
     gaggcataac aaattttaat gccgaagtct tcacaaaaat ctttaaatgc tccgccagtg    110400
     aattgagtgc cattatcagt gatgatccga ttaggtaccc caaaccgatg cacaatgttg    110460
     atgaaaaaat ctctaacttt atctgctgtg atcgtgatga ccggtttagc ctcaatccac    110520
     ttggagaatt tgtcgatagc cacaaagaga tgcgtgtaac caccgactgc ccttttaaat    110580
     gggccgacca tgtcaagccc ctagaccgca aatggccagg acaacgggat ggtttgcaac    110640
     tcttgggctg gcaaatgagt ttgtctggca aaaaattgac aaccttcgca tgtccgcaca    110700
     atcttgtccg catcggacac agctgtaggc cagaaaaaac cttgccggta agctttgccg    110760
     acgatggtcc gtgcaacagc atgattacca caaataccag aatgtatatc cttcagcaat    110820
     tgtctccctt cctccaaaga tacacaacgc tgcagtattc ctgatggact tttcttgtac    110880
     agttcagctt cgtgaataat gtaaagcctg ctgcgcctgg aaatccgctc ggcttcattt    110940
     ttgtcttgag ggagttcttg tttggtcaaa aattttatga gaggttctct ccagtcggct    111000
     tcaatcatgc ttacgccttg agtatccatg gcttcagttg tctcttttct gggcacggtc    111060
     ggttcgtaaa gatgttcgac gaacacatct gaaggagctg cttcccgttt tgaaccaaaa    111120
     ttggccagtc tgtcggctgc ctcattgtta tgtcggagga catgggtgag ctcaagtcca    111180
     tcgaatttgt cttccaactt gcgtacctct tgtcgataag cggtcatatt atcatctaga    111240
     caagaccact ctttcatgac ttgattgaca accaactgag agtctccacg gacgattaat    111300
     cggcggatgc ctaaagagat tgcaatcctt aatccatgga gtagcgcctc gtattccgcc    111360
     acgttatggg acgcagaaaa atgtatccac aatacgtcgc tcaatctttc tccagtcggg    111420
     gaaattaaga cgaccccagc tccagtgcct gtaagcctct tcgacccatc aaaaatgcat    111480
     agtccaatat tccatctttt cctctggcat gtcttcttgg cactcggtcc actcagcaag    111540
     gaaatcagct aaagcttgtg acttgatcga agttcgtggt ttgaaagata tgtccaaaga    111600
     catcaattct aaggcccact tcgcaatccg tccatttgct tcgcgattat gaagtatatc    111660
     cccgagtgga aacgatgtga ccaccgtgat cgagtgactt tgaaagtagt gagataattt    111720
     cctaacggta attaagacac catataataa cttttgaacc tgaggatacc ttgtcttgga    111780
     gtcggctaaa acctcgctga caaaatagat cggttgttgg actttttgaa tatggccttc    111840
     ctcttcacgc tcgacaacca ggaccgtact cacaacctgg gaggtcgctg acacatataa    111900
     cagtagcggc tcttgcggat gtggcgaggc caaaactggt ggagtagtga ggagtttctt    111960
     gaagtcttca aaggctttct gtgcttcggg tccccactag aaatcgtcag tcttcttcag    112020
     cagcttgaaa aaaggcatcc cccgctcacc gagtcgtgag acgaaccggc tgagcgccgc    112080
     catgcaacca gtcagctttt ggacgtcttt ttgggagctt ggcggtttca tgttgaggat    112140
     ggcattgatt ttctctgggt tggcctgtat gcctctttga gataccataa atccgagcaa    112200
     cttccctgac ggtactccga agatgcactt ttccgggttt agtttcatct tgaaagcacg    112260
     aatgcttgta aaagtttctt ctaaatccgc aatcaggtca tccttctgct tggtcttgac    112320
     gactacatca tcaacatagg cttcaacatt gcgaccgatc tgagttgaaa aacacttttg    112380
     aatcatgcgt tgataggttg ctcctgcgtt cttcaatcca aagggcatgg tgatgtagca    112440
     gtaggcccca aagggcgtaa taaacgaggt cttcaagcag tcggattctt ttagtcggat    112500
     ctgatgatat cccgagtaac agtccaagaa gctgagtaac tcgcagccgg ccgttgaatc    112560
     aaccacctgg tcaatgcgag gtaacccaaa agggtctttg ggacaagatt tattgaggtc    112620
     gatatagtcg acacacatgc gccattgccc cgtctttttc cgaaccagga ctgggttagc    112680
     cagccagtcg ggatgaagga cttccttaat gaagcctgct gctaacagct tggttaattc    112740
     ctccttgatc gcatccttcc tgtcctgtgc aaaacggcgg agtcgttgct tgatgggttt    112800
     ggcgtcttcc ttaacatgta aagagtgctc aatcacttct ctggggatac caggcatatc    112860
     ggatggtttc cacgcaaaaa tatctttatt attctgaaga aaggtgatga gcgcgctttc    112920
     ctatttacaa tctaactcag cgcctattac agcagtcttg tcaggatcgg agggatctaa    112980
     gggaatcttt ttcgtcttgg catcactttc ttcggtcttc gtcagcttgg ttgcaggcac    113040
     ttctccctcg cttgccgtgg tcgcagccag tcggatctct tcgcgggcga gagtggtctc    113100
     gtgggtttga gccatctcgc aactttcttt gtcacatgtg acggcttgct tgatgtcgct    113160
     ccgtagtgat atgacccctc gaggaccaga catcttcatc atcatgtagg tgtagtgcgg    113220
     gacagccatg aacttggcta gagccggtcg tctgagtata gcatgatatg ctatctcgaa    113280
     atcagcgact tcgaaacaaa cattttctgt gcgaaaattc tcccgagtgc cgaaggtaac    113340
     tggaagagtg atctggccga gtggtgtagc tgacaatcct gggataacgc catggaaggg    113400
     tgcattactc ggctttaatt ccgtgcgagg aatctgcata tcgtccaggg ttttagcgaa    113460
     aaggatgttg agtgcgctgc cgccatcgat gagagtccgt cggagcttga cattgcgaac    113520
     cactgggtct agtaccaggg ggtaccaccc cgggtggacc actcggtcgg gatgatccga    113580
     gcggtcgaac ttaattgctg tttctgacca ctgaagatat tggggcgtgt taggctgaac    113640
     cgcattgatc tcccgttcca ttagcttctg ttttctcttg gactcataag ccaggggtcc    113700
     gccgaagatg tgattaagtt ctttgcgatg atcttgaaaa ccagtcgggg catcgtcttc    113760
     atcatctctt ctttgatgtg ccttgatctc cgtctgaagg tttacgtgcg ttcttgacgt    113820
     attgttctgt gaactatttg tagacgaagc aatctttggc cacgtggttg gagttgggat    113880
     gatgcggaca ttgggagttc attatcttgt cgaaggtgtt gacgcgggga cgttgtcggt    113940
     aagatggaga ggtggtcgcc acaagttctt cgggcttatg cttgcgatct ttgtggttgt    114000
     tacttccact cccccctgca gtcggtgcgt ccttctttgg cttccaagtg gtgcccgact    114060
     gtttggacgc ggtgattgca tcttcggctt tggcatactc gttggctttt tcgaacatct    114120
     gcttaaccgt cctgggaggt ttacgtccga acttgccgac taggtcctcg tggcgaatgc    114180
     ctttagtgaa ggcggcgatg atgacgtcgt cggtgatgtc ggagatcttg ttgcgttgtt    114240
     cagagaagcg tcggatgtaa tctcgaaggg attctccaga cttctgaacg atgttgtaga    114300
     ggtcaaattg tgtgccgggg cgctcaaagg tgccctggaa gttggcgatg aagtgatcgc    114360
     gaagttccgc ccatgatccg atcgtgcgac ggggtagtcc gtggagccag gatcgggcgg    114420
     agtccgctag ggccacaggt agatagtttg ccatggcctt gctgtctcct cctgctgcac    114480
     ggatcgcgat tccgtagacg gtgagccaag actccggatt agtggtgccg ttatacttct    114540
     cgattccagt cggcttaaag ccgactggcc aatccactcg acgtaggtca ttagtgaagg    114600
     tagccactct atccacgtcg tcgtcgtagc gatttggtga atggcggtga cctcgtgctg    114660
     cacggtgctg gttgatcatg tcgcgaagat cgacggggcg ctgatgaggt ggagagcgag    114720
     gccgttcgac tcggcgctcc ctgtgacgtt caggaggcga gtgaacagat cgttcgtcgt    114780
     gacccctgct cctgcgactg gatcctgtgc cggtgatgct gaggcttggc tgatgatgat    114840
     catgagatca gaggtgaggg gctcggctac cagtcggggt gcggatgctt acggagttgg    114900
     ctggaaccga ggcagcgatc atggtcttcg tctggttcaa gatgttgaca acatgatcgg    114960
     cttggttgag tgcgtcttcc ttgaggaggg tgtcgaggag agtgattgct gcaaccgcgt    115020
     tctgctgggc ggtgcggaag accgatgtcc cgtcgacgtc ttgttgccca atgagctctc    115080
     tcgctcggcg cccagattcc aaggcgcgtt gccgtcgatc ttcagcctcc tttgcaatcc    115140
     gttcgcgatc ttgttgctca cgctgtagtc gttctcgctc ctgtcgctgt cgcacttcct    115200
     ccagtcagcg acgttcagct ccttgccgtg cgcgatcttg gtccgcttct cgggctcggc    115260
     gctgttcttc cgtttcgttg tcagccatga atacgccgaa gaagaggggc atgtagttat    115320
     cctcatagct gtcgtcgaag ttgtcgaggt cgccgtggtc gtagtggtag ccgaagtcgt    115380
     cgtagtcgag gatctcggtt ggtcgagaac tgacgccggg ggagcagagg gagccatcca    115440
     attcttccgt cgagactgtc ccaagaggtt ggagtataac gccgaccttc ctggatctag    115500
     actggatcgg ggccgatgcc ggagctcgcc tagatctccg agtgggagat gttttggctg    115560
     tgaaaacggc ggccaagtca tcaggaagtt tcatcaagat tgaggggtag gacccgtcgt    115620
     cttgatctgg tcgcggaaga gtagattgga tctcgtccga gtggtttgaa gccgactcga    115680
     gagagattat cttggagtag gccttggccg agttcagaat accgaatggc acggggacct    115740
     ggtctctccc cgactggtct gaatccgagt caaggagaga aatcttgccg aagttgttgg    115800
     tgatgaagtc gaggctgccg aaccggaacg cctgcccggg agggaaggcg aagtcgtcga    115860
     tgccagaaac gaaacccatc gcacttagta ggcgagaact tgacgctacc cctacctggc    115920
     gcgccaactg tcgaaacaag atttcggcaa taataaaagg gggtggctat caagttagga    115980
     aagtggatgg gtttgaagac aaggaatttt atacaggttc aggccttctt attcaagaag    116040
     taatacccta ctcctgtccg gagatgattc cgccgagtgt gttattgatt gtataattgg    116100
     gaaaaaagaa tcgtgcccca agaggcacac ggaccctcct tatatagggg aagggatccg    116160
     taatacaaag tacaacccat atcctaacgg aatatgggat tacagataaa acacaatcgt    116220
     aaccgactag gataccaggt attttcttga catacaagtt tagaatctaa cccgagtcct    116280
     cataaaaata ttctatctat atttggtact gtatatccag ctggaatata accgccatgt    116340
     agatatgggg taaccataat ctccacagta actatcgaaa caagattttg gcaataataa    116400
     aagggggtgg ctatcaagct aggaaaatgg atgggtttga agacaaggaa ttttatacag    116460
     gttcaggcct tcttattcaa gaagtaatac cctactccta tccggtaatt ctgatgatga    116520
     aaagactgac actgattaat gtacataagc aaagaggaat tacactgttt attattcttc    116580
     agaaaggaat cagattatca cacacgcaca taacattcca atgtgactgt gacctaacat    116640
     gtttacatat tgtcactgaa atttctatgt gccaaccttt tgatggtact aggatttgtg    116700
     cacgcgatca cccttaaaaa agatcagaaa aagatgactt gtgaaaccaa cttacgcaaa    116760
     gtcactatta gggtgtgcgc atgtggttac tagctagtgt ttcttttagc ccatggaatg    116820
     gtgataacca gggagtttga tgggtaagtg tagaatctct cttcctcttc tctggaagac    116880
     acaattttct atctgatcgt ggcagaattt gggtaatcag ggctagtgta ctgttgtcgt    116940
     gccatataat atacttgtgt cattgcaaaa tataagcaaa ttgtagagca gaatggttat    117000
     gattggttca agcagaaaaa aaatatataa acaaattaac tgatagattg tgattggtta    117060
     agacaagaaa gtaatttgac ttgaaaatag gttgattagt tgctatatcg agggaaaaaa    117120
     tttaaacatt aaaaatactt atattatgga acggaagaaa tagttaatta atgagtaaat    117180
     tttacaaaat tctgggtaag tgcctccttg gctgacacct gtaagattat ttttctacgg    117240
     taagtgcccg ttcctaccag atgcattatc tcatgattgt aaatactttt caggactgtg    117300
     aaaatattat ttgaagtggt aaaatatact ctcccaagtc ccaattgtaa aatattatcc    117360
     gtactgggct tgcgccatgg atactggata gaagaagaca atagtacgtg tacagtatat    117420
     aatttgaaag agaaaaaaaa aacttgaaac ctcaaagctt tgagtttaca catgggctgt    117480
     tctgccaagt tcacagacgg gccatggcgt tcttgacatc tggcctgttt ctgtcatttt    117540
     cgttgatttg cccaatttta agaaagcccg gacctgatca cctgaaccaa attgttcatc    117600
     tacaattaca agcccagtac ggcagtactg tgtgtaaagt acacaatcgg caattttcgt    117660
     gagacatagt cacatggacc agtttttctt ttttaatttg aagcgcaaga atttttcttc    117720
     cacgaaagga atttaacttt tagacctcct ttcgaacggg agattttgga ggaatttcgt    117780
     gggattgaac ccaactcttg caaacttccc cgtttcagac cagacttggc tggcgaatac    117840
     cgatatcaga tttcaatcaa gcctctgttt gtatttctct tcatgtttcc ctaccaatat    117900
     taattatatt ctcttgaagc aatttagaaa aagaaatgtt gcatattttc ttcttcattc    117960
     tatttgaagc ttcaaatatg gattaatagt gctttcttga gtactttttt ttagaagagt    118020
     aatttttttc cggcctccat atctaattgg atatatgcag ccttttaaat tgggaactta    118080
     acctctcaaa atagctcaat ctaaaattca ctcctatgga gatttgaaat caaaaccttc    118140
     gagtgctact tagatcactg caaccgctaa gttatatgcc cttttccttg aaatgttgca    118200
     tactgaatgc aacatatata ccaattacta aaatgttgtc gcggttgagc ttagtgacag    118260
     agccaatgac gatgtcaagc ccagctactg aaacccattt ttatcaactt ataacttgag    118320
     aatccgagaa tgtttaacca acacgggtta gattgtacga ttattgggaa attgatggca    118380
     ccttactgta gagagcagcc aatccatagt actactctct cgattccaaa ataaatattt    118440
     tcaatataca aacatagaat tgtagtttta gttgcataga actaaaccca ttttgacttg    118500
     agcgcgctct cctatcccca ttccatgtgc cttgccccct tcttccgcgc tatatactga    118560
     ttgaaatacc ttctggttcc atgtgagtgt gattcaaaga ttgtattact gtacagcagt    118620
     tcatgaagct agctgtatca ggtggctaat gaaagtgcca tgtccctttg actttgaatt    118680
     tgagatcctc tctgttctga cttccgagtg tgactggctc aagcgactcc atttcttgtt    118740
     tgttcctctg ttctctaatg tgtcactttt gaccatgggt gttgtacttt gaccataaat    118800
     tactaatgat gaatgataac ttatagggtt atatttataa tgttataatt tcgataatac    118860
     aacatatttt cgagtatcta tatttttttc aaaaataagc gtgaatatta cgagtgtgaa    118920
     ttattcgaga atagaggaaa tattttattt tgatgcatga tcttctgcta caggaaccga    118980
     ggatcgagga gtaggatcaa agaatctatg gtttctttct atttttttac atatttatag    119040
     tatattattt tgtccggagt tgatgcatac gctagccctg tcgctgtctg ccatctcgtt    119100
     atgctgatgg tgagctcatg tgatcctatc ttgcgacctt tttcagtttg aagataagag    119160
     ctgtggattg ataatcaatt tctgaaaaca aactccacgg ttactgtcga agaaacgtcc    119220
     atggttaata actagtacta gcaaccagca aatagtttgg tctaagacgg caaaacagac    119280
     tgggtttgct gactaataag gaccaaaaaa ggaaaattgg catcgatttc ttgcctgttt    119340
     ttaagcacta aacggattaa cgagggcgta aggctacatg cagtcgcttt cgctcaagaa    119400
     ttccaacgcg taaacaaaca actagtgcgc cgcataatgc aagctgatcg gtcaactagc    119460
     ggaagcccca gtacctgagt tcaaaacgga ttattgacac ttgactgaca gtatcattgt    119520
     ggagtacgta gtattaatca gagaacatag cagtatcatt gttactgcta tgttctctgt    119580
     gttcgctcct ctggggcaaa ggaaaactgt aatcctccct ttgaggtttc tgcttctagt    119640
     ttttttcttt ttctgctatt ctccctctcc tctcttgctc tgtaagacac ttattcccgt    119700
     ttctggtaat agaaatgggg gcagtgatgc cctagctcta aaaaaagaga gtattgttat    119760
     caaagttagt cgatatagcg gaatgacgac taaccctccc gatcgtttca gtcattgatc    119820
     acccaagaca tgccagatga cgacacagga acacacgata tttgttaacg aggttcagcc    119880
     gaagcctaca ttcccagggc tctgattatg ggcgctcctc cccaaccaat atatctctta    119940
     gccgctacga gtccatggcc aagccgccat cctctccctg cgtgtctatg ctacactgta    120000
     gtcgccatgg ttacattgtg gtgtccccct ctctatttaa gagagttgcc gggttataga    120060
     gtccgactct aactccaccc ctaacaccta ttacaactcc aagtccaact gtaaccaaat    120120
     aggactagta tattcgacac ctattctaac aaactctacc ttggcgaata tacgccaccc    120180
     agaagtagta gaatcaccat gccaatccat ctgtcctcca gacttgggtt gtttcctttt    120240
     gcagcttcac cacgagccgc ctgacgagcc tgcgccagac ccgccgcctt gaagagactc    120300
     cgctatccct gcaatttctt cctcttgaat ccacctgcaa cagtgctcca ccttcttacc    120360
     tatcatctca gtcgtcttgc caagcgaaat tggatttctt cctagctgtc acatcataga    120420
     ctccccgaag accatgttca cctccatctt ccatcttaaa tttgaattga tctaatccat    120480
     ggccagataa cctatgtcat caccaaatag ataaatcaaa ctcaccagac ttgaagagaa    120540
     ccatttcttc cttgttgtct tatgaaccga gctaataaat ccaacatcct cgctttcccg    120600
     catccgtaga ctgaacctat gatactttga gaaaattcac tgttgccttg aatcccttga    120660
     agaaattaac accatagcgc ttgcttttcc tcttcagtga cgcagatttc catatatccc    120720
     ccatcatgcc gacctgcata tcctggatat atcctgtatt gccaaacagt ttcgttgacc    120780
     ccatcaacga tatttgaccc gctgttgccc gggatctttt ttttcccttc agttctggtc    120840
     taactccata tatctcaact cctcgtcgag tcccatatat atcatgtctg ccagataatt    120900
     ccatatgcga cctgaccgac ctgtcgccgc cagtctattc gccattgtca cttgcaaact    120960
     atccagaccg tagaaccttt ttgcccttct tctgaatccg ctcacaagtt tctgcaacga    121020
     accaccggtc cgttgaaccc ggtctaaccg tccaagctcc gcagtctaac cagtccgtcg    121080
     gtctaaccac cctgccggcc cagtttaacc agcctcgatc ctctctggac cgaatgccac    121140
     atgatgtacc atctcctaag tcaccgtaga ccatacaagt tccgtcttag ttatcatggc    121200
     agcaccacac caattgcccc tgcgcctgtg catctctcta ctgaatcacc accaccttaa    121260
     ttatgccaac caatgcgtcc tagactcctg gtagccttgc acgctttgat ctccacgttt    121320
     aattagcacc accacacagc tagcttattg gtcttcctgg ctccctgcca tacgtaaacc    121380
     aatgttgcac agtagtataa tgcatgcacg tactatggca gccaacatat gcttgcatac    121440
     acatgtaacc ctatcataat taacgtgacc agcaaaagac tactactctc tccttttttc    121500
     ttggtccacc gcctgacttt gtggaggtta acaccggtcc atgcactttt tacacatgcc    121560
     actacaagaa acttgttaat ccataacgga ttcttggtga cggattcata aaccgtcact    121620
     gacagaggca atccgtgacg ataatttgtt ttccgtcatg gacgtgcact agtggatatt    121680
     cttggcccgt taactcgtga cggttttatc cagatcgtca cagtgtgtga ttttaaaatc    121740
     atcacggtgt gacgataatc aaaaggcatt tcaaaacttg ttttgcttga aaaggatttg    121800
     aatttgaggt tcaaatgaat ttaaaaaaat gaaaagctac actctctctt ggaccatttc    121860
     tggctcactc tctcctcttg ggctcgggcc agcctccctc tcgcgctctg ccccttcagc    121920
     tgggccagcg gcccattttc cacatgggca gccaagacag gctagccgca ggccaccctg    121980
     cgccttgtaa aaaaacaaga aacaaaaaaa tgtagccctc taggggactc gaacctacga    122040
     caacacgcac agtattcatg aggaaacccc actgagccac tgaagcgttt tgccaaacga    122100
     cgtgcactgt attttatata tcaaactgta gcaggtaatg gacctgccac ctgctcgtgg    122160
     tgttcatcat aaaattcacg agaatagctg cagattttta cttttaatgc gtgtataaaa    122220
     atttaaatta gtttatctcc ctcatactaa cttcaacttt aattattctt ttttataaaa    122280
     ttttctaaac tcatgatcta tccatttatt gtgctattac aactattatt tttgtcatac    122340
     tttcatgtga ctttgtttta tcaattgaag atttaaattt caaaaagtgg caacttcaaa    122400
     caacattttg aagcagtaaa tgattgcaaa acaaatcaaa cccaaaagac aaattttttt    122460
     tgaactaaat tattttgtta ctaatttgtt acttgtatat gttgcatatg gtaaaactga    122520
     aaatatttgc atatatatag tgtgcgaaca aaaaatattt ggagcttgta ggaatttaac    122580
     ctaacaccta tagttatcca gcaacattca tagctacttc ttttagttga ttatgtatgc    122640
     actcacttat acttttcact acaggaaata tattaaaagt taaagcaatt taatcaagtg    122700
     aattaatgag gaaactaaat ttttccttta aaaatcatgg ccggaaatat ttttgtaaaa    122760
     ttctaagtgg tctaaattat tctctaaaat tttccgtgaa ttttcggagc tcaataaata    122820
     gttttaatac cacaaagttc atttaaccta ttaaaataaa tggaaaataa attaaaatat    122880
     ctctctgtcc ttgggccttt tttggcccaa gtgttactct ctccctccct cagcccgcag    122940
     cctttctctc cgtcctgggc cggcttccca ttcccctcct tcttcttcgg gctgccagcc    123000
     tagcccattt gctcccccct cgccgagaag tccattttgc ctccctcttc tcaattaatt    123060
     tcaaaatata aaaaatccga gtcaaatttt atcatactaa ataaacttat gtgaaaaagt    123120
     tatcaaaaac aaagttgtat aacttaatta gatctatcaa ttttattttg gttatttctc    123180
     catctgactt tgattgacct atataaaatt tgaattttaa atataagaaa aatcaaataa    123240
     tttttctggt agtaaataat ttgaaatgaa aaaaaaatgt caacaacaaa gttgtatgac    123300
     ttatcaagat ctacaacttt tgttttggtc attttgctat acgacttcat ttcaataatt    123360
     tgaatttgaa tttcaaatta tgacaacttc aaacagcagt ttcaaatact aaatgatttc    123420
     aactgaaaaa gtaatcaata acaaagttgt ataaatcatc aatatctata acttttattt    123480
     tggtcatttc ttcatccgac aaagtaataa taacattatt tataaaattt acatatctct    123540
     ctcatagttt ataaactgta taagagatat gtacattttg tgaataatgt tacaattcgc    123600
     tttaacggat gaagaaatga cccaaataaa agttatagat cttgatgagt tataccactt    123660
     tgttattgat gactttttta gttgaaatca tttagtattt gaaaatgttg tttgaaattg    123720
     tcataatttg aaattcaaat tcatattgtt caaaccaagt catatagaaa aatgaccaaa    123780
     acaaaagttg taaatattga tgagttgtac aactttattg ttgatgactt tttcagttga    123840
     aatcatttat tatttgaaaa tattgtttga agttgtcata atttgaaatt caaattcaaa    123900
     tttttgatac aaagtcatat agcaaaatga ccaaaacaaa agttgtagat ctcattaagt    123960
     tatataactt tgtttttgac atctttttca cataaattta tttagtatga taaaattcga    124020
     tttgaagttt taatattttg aaattaattg agaggaggga ggaaaaacag acgctgggcc    124080
     ggcggcccga aggagcagcg ggcgccaaac tttcagtgtg gcgggatgtt gatcaaaatt    124140
     tcaacgtgaa atgaccattt tgtccagata ttttagtggt aacttcggat gcaccatggg    124200
     tattttagta aaatcgcatt ggttcctcaa ccctagccga tccaaatcag ataagccgcc    124260
     accacacgcg aggcgctact gcagatgaga ccgccggcct ctgtctccgc cgctgctggg    124320
     cgccggcctc cgtctccgcc gccgccgggc gccgctcacc gcgccggctt cctccccctt    124380
     cgccgcttgc cgtgccggca tccgtctcca ccgctgccag gcgcgggagc ggtggatccg    124440
     ctgccgccgg cgcctctcgg gcccggaggg ggcgtgcagc gcagcatccg gggcagccac    124500
     cggtgacgtg aatcgaggtg gaagaagcac cggcgaggga gagctccgac gagtcctcct    124560
     cctcctcctt ctccggcagc aggtcagggc gcagatcccc tcccagtagc gcgcctgctt    124620
     cctacatctc gcgagctccg tccatcgaga ggctgctcga ggaggacgac gcactgctgc    124680
     acgcgtgagc atagggagca cggcaggcga tcatggtggg cgaggacggt ttgacacgga    124740
     tgaaaaagaa gaggagaggc gccagtcttt ctatctttgt ttcttgcatt agttttcttg    124800
     gcgagttttg acgcatgtgc ctcacccatg tgcaggaggg cggaggcggg atctgctact    124860
     gtgagaggga ctggtgattg gtgaagcgcc ccaacttcga ctgcgagcga ccgcatccca    124920
     actgtaacca atctctctct atccgctgat gctagttgct tatcaaagtt cctgaatctg    124980
     atgaatgcag aaacctctaa tttagttaag caagtcaatt catgctgtaa caatatgatc    125040
     tctgacaaaa aactgaattc cttgtttctg caaatgcaag tgcagtcata aataagaaag    125100
     aatattcgtg aaagtttcat agaaactaga taaaaaaaag aaagtgtttt agataaaaaa    125160
     agaatgtgtt tattttcaga aatccacagt tgctatattt tcagatatct tcaaaactga    125220
     ataatgtttt aatccatttg ccaacaaaaa gaaaaagagg tgcagaaaac agcttacttg    125280
     ggggatacca tggatcatgc ttgatttgat cagctcaacg gtgatttgat gctatctaga    125340
     ttcatccttt ttttttaagt tcaacactgt acacatttgc tggacataat gcatatatgt    125400
     tgttttcagc gtgacaaata caatgaagaa gaacctaatg catttgattt gttcaaggag    125460
     ttccactaca gcaagaaaaa aaaatgctac accactgctg tacaataggc tattgtaaga    125520
     taagtttcaa actttgctct ttgtaatgct tatttttaat tctctcatca acaacaatgt    125580
     ttgctccttg cttgctagac tcaaatggaa aacaagctgt ctacaagttc gatgaagagg    125640
     actcaatctg agatggaagc ggaaacttaa tcttttgctc agtcaagttc gatcaagtta    125700
     attcatgcat gatgctatat cttttgctac tacatgcatt ttgctgctat tgctaacttg    125760
     tgtcaagtca atttttgact aagctaagct atacatgctt gcattttgct gccgcagcat    125820
     tcattaagct cctagacttg tatgcattgc ttggaatctc tatttgttgt tggcttgagc    125880
     catggtaaac tgcaaggttg tatgcacttt gagggcccct ttgattcgca ggataggaaa    125940
     aacacaggaa taggaaaaac acaggaattg aagtagtatg attcttcaat cccgcaggaa    126000
     tcaaaaacat aggaaaaaat gaaaggtgcc ctttgatagt gctataggaa aaatacagga    126060
     tttctcttcc ggtttgaatt tgaacagata gccgttggcg ttcaaagcaa gtactagccg    126120
     ttgcatgtcc ttatatatat tgctgtagct gcaactggac atcaacaaaa ctagctcacc    126180
     tcaccttcga ttgtatcggc caagcatgac aagagctcaa acgtggcaat tcatttggta    126240
     agtcataaat gaattttttt tctttttggt atgtatgtaa ggattagcaa cttatttgct    126300
     tgcttctgct ctcctatata tattggtaga ccaaaccatc agatttatta tttgttgttg    126360
     atttcccctg tgattgtcat ggatccaagt tatcgacgac ggtcacagaa tgaagatgag    126420
     ttcatgcttt ttgttctccc taccatcgaa ggagattcgt cacaaccatc atctagtagg    126480
     aaaccgatgc acacatcaaa actttcaggg gcttgtcgtg ttaatgaaat cttaacaggt    126540
     catcagagcc taagcaaaag gaattttcgc atggaagtta atgtttttcg agctttagtc    126600
     gataagttgc gtgagaaaca actacttgct gatgcaagag atgtctcagt agaagaacaa    126660
     gttgctatat tcttgtatgc actagcaaaa aatgcaagta atgagacctt gcaagatcag    126720
     tttcaacaca gcgggcaaac aataagcaag tattttgggg ttgtgcttga tgcagttaca    126780
     caacttacat gtgtatatat acggccacct ttcctacacc cccatcatat cttgagaaga    126840
     ccaaaatttc accccttttt tgaggtatga acagattcat gttttgattt tttttttact    126900
     ttgagttaaa ccaatcattg tacataaaaa gacttaatca aggttatatt tgtatttgta    126960
     tagaattgtg ttggctctat tgacgggaca catgtaccaa tgatacttcc actagaccag    127020
     caagaaccat accggaatag aaagcaaaca atttctcaga atgttatggt agcttgcgac    127080
     ttcgatctga aatttgtaca tgtacatgcc ggctgggagg gatcagcttc agacgcaaga    127140
     gttcttcaag atgcactaaa ccatggtttt gaagtacctc ctggtaaatt ttttcttgta    127200
     gatgctggtt atgcaaatac aacacagttt ctagcaccgt atcgtgggac aagatatcat    127260
     ttaaaggaac agggcagagc taatcaaaag ccacaaaatt ataaggagtt attcaatctt    127320
     cggcatgcac aactcaaaaa ccatatagag agagcaattg gtgtattaaa aatgagattt    127380
     cctatactaa agaccggctc acaccaccca gctcgtaaac aagttgatat ttcggttgcc    127440
     tgttgtgttc tacacaactt catacgcctg cataatggag atatggtgtg gccaagtaat    127500
     tgtcgtttgg agattgatcc agatcatatt gttgatgtgc caaatggaga cgagaactat    127560
     aatggtgatg tacaagaatt taacaactct agagaagctg ggaatagaaa acgagatgac    127620
     atggcacaac ggatgtggaa ccattacgta gcacgaagga aataatatat tgcatttgac    127680
     caccatggca ttcaaggtca attactagtc ttgtactcca agtttgtcac attctactta    127740
     atgaagtaac tacttgcatg cactccctct aagcaaaagt atatcctact actatctgct    127800
     tcacaaaagt accccctttg tttcacaaaa gtactatcct tctatttgca tgccatctat    127860
     ttcacaaaag tactatccta ctacttgcat gccatatgtt tcacaaaagt actcactcta    127920
     atgctgcgat ttcctttcta atccaagcca ggcgtaatgc atcacttgaa aaggacaaga    127980
     aaacttccct attatcctta cctttgaaga tatcagctgc caccaatata tctcctattt    128040
     gtagaccatg taaaccttca agcactgtga tacacttgtt gatgctgtaa ggatcctcca    128100
     atttcttctc ctcaattgca gcaaatcgat ctatgtcttc ttttttaagt tttaggtatc    128160
     tctcatgaaa tccatcatca ggactaacag atttgatctt ttgtttcttc ccaggtcgag    128220
     attcaggaac ctctgaaggt gtttgtgccg agctaggtgg gacttttgtg agatggacag    128280
     gggtaggtga atgctgtgaa aagtccaaat tggctgtctc aacctcttca ccaaaaggaa    128340
     attgcaaacc tgattcacct ggagcatttg aattagggga tggtgactga tatgtatcaa    128400
     ccgcatttgc ttcttgtgtt gaatgagctg gtgcattctt tgtcttcctt gcataatggt    128460
     ccataccatg gcgagttctc ccttcagcat aacgacctgc acaattatat tctcctcacg    128520
     atcagcataa cttgcctaaa acatttcaac aaaacaaaca aaccactgat aaaaaaaata    128580
     taaagctcac catcataaag tggagctaaa tcatcaaaat atgggaacga cttatctcgc    128640
     caatgaattg catctttgtt cttgcgatca gcaaaagtgt cccaaacact ttgtggtgca    128700
     ctcaccatca ttctgtcact atcccaccca aaaccacttt gatccaacaa atctttaaca    128760
     ctgcgataat ctttcttcaa atcctgctcc ttttgcttga cttggttggt cgtaaatgat    128820
     gtaccgaatt ttgtattcag gcggcaaaca atatttgtcc atgcttcctt actccaagca    128880
     ttttgtgttc gaaaacctgg cacgtcatga tctgttagga gctcaataag gaacatcttc    128940
     atctggtgac tccatctggc tctctttgcc gtccctaaat ttgacaaaca tttaacaatt    129000
     tcagtttcag cagcaatatg aaacaaaaaa ggtttgatgc aaacaacaag tgaaactgaa    129060
     tttgcaaata ttacctattt cttgacgctc tgcagtccca tgctcactgt caacatcaac    129120
     ataaacctgt gatagaggtt gctgggctcg tcgatcggac aaattgcgtt gatttgtcat    129180
     ggtcatctga gaagagcctt tcgatggcat tgctttccta accccccaaa aaaaagaaag    129240
     aaaaaagaaa tacacaatcc ttatcagaga gggatttaca cctacagtgc caatgaaaca    129300
     aactagttcc aagtagtcag cttaaaaatt cactaatcca tagatccaaa gtacagaagc    129360
     actaataagt caataataag tcaagtatga aagctcaaaa gtgcagacaa ataccaaatc    129420
     gatggccctg gctgctgccc tcgatggcgg acctgccgca cgcctccgcc tagcggagcc    129480
     caacctgcgc gccagatgga tgctgtgctt ggttgctgcg tgctgctagt tgttgggccg    129540
     gcgtccccag cggaagccgc atacacgact gagccggcga gcctcgcctc cgccttgcac    129600
     ccccagcggc cggctcaagc tgctgtctat ctctatcaca gttggctttc ttggctgcta    129660
     atatgtggtc ctcggtgttc tcgttcccat ctttctctct ctctctcttt ttttctggaa    129720
     gaagcgcgaa gggccacggt ttaccgccaa acacacaaaa gtggcgccaa cgacgacgtg    129780
     cgcacgcgtg ggcgcgccct tctttcgcgc caggaaagtt tccaaagagg tcagacctct    129840
     ttcttatttt cctgtgaaaa tgaactaaag gaatgcaatc ctaaggaacg tttcctttca    129900
     tttcctatga atcaaagaca tactatggaa aaaatccata ggattgtaaa tcctacaaaa    129960
     gtcctatgcc aatcctttga atcaaaggag ccctgaatgt tgtaatctga tgttggatga    130020
     aaaatcatgt gatatgatat tgaatggaaa aatgatattt ctatttgatt tgctgctgca    130080
     actattagtt gcatgggctg tgtatatggg ctttagttat gaaattaagc tgtatatatg    130140
     ggctgtaagc gatgtagtag tgggctgaaa agggcaccaa aaaatggtga caaaattggg    130200
     ctgcaaagct gctgaaatgg gttgtaaagc tattgaaaat gggctgccaa aatggctgaa    130260
     aaggagctgc gaaaatggat ggaattgggc taaaaattgg cccatctttg attttggcct    130320
     gttaataaat aggttgaggt agtgtctacg tcatcatcca cgtaagcaac catgtaagca    130380
     tccatgatga tgtggcattc aatccgtgac ggttattttt cgtcatagga aatgaacttg    130440
     ggctgggcta actaggcctc gggctctatc gtgatggttt aaaaccgtca gcgattccat    130500
     taatccgtga tggtttttgg taaaccgtca cagaggttaa tccatgacgc tcaatccgtg    130560
     accatctctg aaaccatcac aggtgctgca tagtgacggt tttttgatga tccgtgacgg    130620
     aaatttttca tcatgcatta acagattcct tgtagtgtgc ctgccttcct acgagccaaa    130680
     aaccaaaccc cgactcaatc tcggtatccg cttcctcctg ctacaagccg cagcctatgc    130740
     ctcctctgag tcgtcgccgc cgcctgcatc agacaccgaa gccgaaactt ccaccgctcg    130800
     gattagagaa acttcttcgc tagagtccat agctactcct ccacgatgga gcccactgcc    130860
     acctctccct gcttaagtcg acgtctccgc accgtatccg tcttggttct gctcttggaa    130920
     accacaccta tgcatgtgta gatgtgcaca agtcatgcct ccatacacga cgtccatgcc    130980
     cctgcacgca ccgcagtcgc agccctcgta ttcaccgtcc acgaccccgt cgtcatcggc    131040
     cctgcacgtc cgccgcgccg cgccatgctc gccagcttcg cccttccgtc agtggcctcc    131100
     ctgccgccgc ggatccgcgt tcgccacgtg cgtcgggcgc gccgtccatg gcgctacccc    131160
     tccgatctct ccgaacgcct tcggccacgc ccggcctcgt cttccggtca cgctccgcca    131220
     tcgtcagtct gatcgcgagt gaggtcgtcg cctccgcaac gtcctcgttg tcgccatcga    131280
     tctcatcgcc acgactgacg atctcctatc gatgcgcgat cccacctcgt gtttccttct    131340
     ccacatgtct tcttgatcca atgctgaaac cttctgctct gataccactt gttataaaag    131400
     ttagtcaata tagcggaaag acgactaacc ctcccgatcg cttcagtcat tgattactca    131460
     agacatgcca gatgacgaca caggaacaca cgatatttgt taacgaggtt cagccgaagc    131520
     ctacatcccc ggggctctaa ttatgggcgc ttctccccaa ccaatatagt tcctagccgc    131580
     tacgagtcca tggccacgcc gccatcctct ccctgcgtgt gtatgctaca ttgtagtcgc    131640
     catggttata ttgtggtgtc cccctctcta tttaagagag ttgccgggtt acagagtccg    131700
     actctaactc caccccctaa cacctattac aactctaagt ccaactgtaa ccaaataacc    131760
     aaataggaat agtatattcg acacctattc taacaattat ttatatgact atacatacaa    131820
     gtcaaatgtc ttgataaata agcttaataa ttagtttaaa acattaaata aacacacata    131880
     ttttaaaaga cgtgaagcag ataattcatg gtgataaaga atgttcggcg tgagcggaaa    131940
     cagacatggg ataataaatg ctgctatcta atttcaaaaa aaaaattaat gttttcatta    132000
     gattagcaat atgcgtgaaa aattttccca ccactgcagg gcgcgacggt gagcccgaca    132060
     gttgcactcc cacgttcaat aatccaggat cagaggacct tgggttagtt atccaatcct    132120
     agctaaaatg tctcatttta attaatacac caactaataa ttagataatt attactccat    132180
     ccatctaaaa tataagtatt tttagcatag tgataaatca aacattttta actttaatta    132240
     ttaatagcaa aaaaataaaa aatatcaatc atgtaaaatt gatattaata tatttatcat    132300
     taaacaattt atcgtaattt tatttaaaac atctcacttt tataaatatt attgatcaaa    132360
     atagcatcac gaaaaccata tcagagtcta aaaatactta tattttagga tagagggagt    132420
     gctatgtatt gaatccctat aatttttctt ttatgttcgc ctgaccagag cccggccggt    132480
     tgatcgattg gccgtcggca ttctgcgttt ctttctcttc tcgtgttccg acttccggct    132540
     gtgaaccaag agtagccgac ggctccgcgc gtggtcgcag ctgcctcctt tcgacgattg    132600
     gctcgattgc gccatgtgac tggtcataag gccgtaatat caaattttag ttatttataa    132660
     attatatata tttttatatg gactctagac tcgtctttta atatattttt ttattctgaa    132720
     ttttttgtaa attgtatttc tatataaact ctatgctctt cttccactat tatttatttt    132780
     tatttctgaa tttttattat ttctaattgt atttctatat agactctaaa ctcatctttc    132840
     aatattcttt aattattaat gaattttagt tacttctaaa ttgtatccct atattgactt    132900
     taaacttttc ttcccatgtt tttcttaatt ttaaatttta gttatttgta aattatattt    132960
     ttatacggac tctaaacttt acttttaatt ttattatgct tattccaaat tttagttagt    133020
     tttaaattcc tatatggact ctacactcta cttctaatat tccttatttt tttaattccg    133080
     aatttctatt gttttcttaa ttgtatttct atatagaata tatactctac ttctaatatt    133140
     ccttattttt aattccaagt ttctattatt ttctaattgt atttctatat ggactctata    133200
     ctctacttct aatattcctt atttttaatt ccgaatttca gttattttct aattgtattt    133260
     ctatatggac tctagtctcc tcttcgaata ttccttattt tttaattccg aatttcaatt    133320
     atttctaaat tgtatttcta tatggactct agtctcctat tataatattc cttatttttt    133380
     aattccgaat ttcagctatt tctaaattgt atttctatat ggactctgct ttttcttttt    133440
     ctccgattaa tgtgagaatg tctaggccat gagagcgaac gtggaggctc ctttttctat    133500
     tcctttaata atataataga tagattgcac ataatctgag ttctcaattt tttgatccaa    133560
     tggtccaaat caattgccac taggggtgag caaaataaga ccgggccgaa gaaccgaact    133620
     gaaaagaccg ataccgagac tgaaaagacc gagaccgaaa cgaccaagac cgagaaattc    133680
     ggttagtaat tcggtcttgg ccgttgaaag accgaaattt atttgggcaa ttcggttatt    133740
     ggtctcggtt aaccgaatta accgagaaaa ccgaattgtg gcctaataga tctaggaggc    133800
     acgataagcc caataaacta ctaaacccta aagggaacca ctgacactcc ctcctctccc    133860
     accagcctca cgcagcgccg ccaccaatcc cctcgcgctc ggcgctcgcg ccgtgcggtc    133920
     acgctgcctc cgcctccacc ctccatctcc atcacgccgg cgccgtctcc gccttccgcc    133980
     tcatcgcgcc ggcgccgcct ccgctctccg ccctccgcgc gccgcctctg ccggtcgtcg    134040
     ttgacctcca ccgtgccggc accgcctctg ccctccgcct ccacctccgc cggtcgtcgt    134100
     cgacctcgac cgcgcaggcg ctgcctccgc cctccgccgg tcgtcctcga cctccatcgc    134160
     gccggcgccg ccttcgtcgc ccgcctccgc cctccgccgg tccgccctcc acctctgcct    134220
     caatgccgcc atcacaccgc ctccgtctcc agctagccct ctgtgaaagt tcggtcagac    134280
     cgagaccgaa accaaaaaaa ccgaaactga atttgtcggt cttgagtttt ttgggaagaa    134340
     attcggtcct cacttttcaa agaccgaaat aaccgaaaga ccgaagaccg agaccgaatt    134400
     ttttggtcag accgaacacc cacccctaat tgccacggta aatcgaaact ttactgtgcc    134460
     acaataaatc gctgcagtgt tttgctactg tgtttagata catctagatc acgcccgttt    134520
     tagatccgat ggtgctcgtg tgactgtttc acactaccca ctgcacctga actggatcaa    134580
     gcttaaaaca catgcacggg ccggggccgg tcactcggtc agtggcagat ctactggtca    134640
     tcgttaattg tgttagaatc ttgctttaca taccatatta tatggttagc atccgactac    134700
     gtctcattca ctgattcttg tgctctattt ctctccatgt gcagtggtgg agctacagta    134760
     atctatggga tcagctgacc ccacttgttt tcgcgaaaca gccaaaaaaa aactattgat    134820
     atttgtgtca caataataga aaactaaaaa taattttaca gctttaaccc cacaggtttt    134880
     agtcactgcc tctgccgctg tttatgtggg cttagaaaaa taatagatgt gtttatgcat    134940
     tggttgaatc gaacgtggat catacctata ctcatttcat attgtgttat gcatgctatc    135000
     tacaccattt gtaaagctat agagagagat ctaggagcat atgtgtttat acccaaattt    135060
     aacatctaag attaaaatag aaaaattacc aaagtttgga cgttctaccg atttttctct    135120
     gagagggtcg atctgatcgt cgtgtgtcga ccggttagac caccgccagt agaccggtca    135180
     taccagcgtt gtgtggctgg tatgaccagc agagtccaat cccgaatctg tctctacaat    135240
     atatataaaa aaaaattgcc aacaatatgc atcctcgcct aactcatgca atatacaaca    135300
     ggcacacgat actcatagca ctaatctgtg tctaaaggcg tacgtaatca ggtgatgacg    135360
     ccgtcacgta cgacgaacga agcggacaca tgatcgatgg atggaatcca ttttaatttc    135420
     ttcggagtca cgtgtggctc accgggcaat ctagaagctg gatgtgcgcc cgtacgaaga    135480
     gtagtgtgtg agtgtgtgac actatcatgt cctcatgggt atatattgga tccttcttta    135540
     gtggaaaaga ggagtgaagg gtcaaagttg atttctttgt caatgtgtaa tcggaggagg    135600
     agatgcacag acacggtttt cacaaagaag aagctgggag ggaattgctg aatatggcca    135660
     tcaccgtcca tggtttccac aggtggggag aaaaatggtg gtgcttgtgg agatagagaa    135720
     tggccaaatg gaggtcgttt ttattggagt ggagatcctg agggaggaga ttgtgcgggg    135780
     acgatgaaac cacacgatct cctttctcgt ggatcggatg gcgttaccgg ttatgtcaca    135840
     tatgtgctct aaaattaatt tgaattttga ttgcggctga taccaacaag ccaaatatat    135900
     tactaaactt cttgtgtcaa agataatcgt cgagtgagat tagcatatca taggtctatc    135960
     catgaaccat cattctcctt tttttattat atgctgcaat caaaatttaa atttcaaaac    136020
     ttacttttaa gttaacacta aggtttttct ttcattggta aaagtatgct atgggatatt    136080
     caaaatttat gattttttac tcttggacac taaaaaacat aaactcaatt ttaggacata    136140
     aaaaaccgat gatttattag gggagactgc tgttattatt ttatcattta acatatctgg    136200
     aaccagatcc aagccacatt tcctctacca atcccctctc caagacctta agattggagg    136260
     cggtgaaaga cagggcccat gacagaggcc attacaagca attggcctag ggggcaaact    136320
     catcttctct aaaagtttct ttcctcattt tcctgaaaat gataaaataa tgactatagt    136380
     gtctcttagt gaattaccag ttttttttct acaaccatgt cacattttta ggtgttcaac    136440
     accaagaatt ataaacttta gatgtcctat agcaaatttt acttttacat tatattttat    136500
     cttccaagat aatttaaacc gtaaaaaaca cacatataaa acttgtattt ataaattatt    136560
     tggattgctt aattcattat tgtactgtag atcaaacatt catagcagtc agtcaagttc    136620
     tactcactcc atcccaagat atggcattat ctatattcgt agtatatgtt tatatgcaat    136680
     ccaatattag attgccatat tttatgattg agagtgtctc ctgaaaaaaa aaaaggtaac    136740
     aaatgggtca tttttaactc tagacgagct gctacttatg gtgagacgat atagggaatt    136800
     tgtaagcatt gtggtttcta atttaaccca cagttgaaca cctttatatc catgattcta    136860
     cactgtcacg taatcagttt ctgataatgg aacgaggata taggagcaga aagtcctggc    136920
     agcgaacacg caaatgtatg ttcaaagaga ccacttgact cacatacatc caacacgtcc    136980
     gtggtttcta aattcccagg aaacacagag gaccatgatg actaccccac acgtacacac    137040
     aggtttggac tttggaattt cttcccatcc catggcccca tctcggggat tgctatctga    137100
     cgcgtatatg tcagctgacg ctcccgcacg attttttttt ccatttttta cgctttcccc    137160
     cacttcctga cacgttttcc tttttttcac gattttttaa tctttagcgt acttttttta    137220
     tttttaatgt attttataat ttagatcttt tatcttaaat ttcaaaacat tctatttaaa    137280
     actttcaatt taaaatttga acttaaacta caaaacttac atctcaaaat ttgaaactct    137340
     caaatcaaat tttaaaaaac ttttaactca aaatttaaaa cttaaataaa tattgagttg    137400
     aaggttctaa aattttgact taaaagtttt ctaatccgag ttaaaagttg aaataatgag    137460
     ttgaaagctt tcaaacttta aactttaagt tgatagtttt caaaatttaa aaattgaggc    137520
     aagtcgtggg ctgattctct gcctcgtctc cccctattct cctcttcgcc ggcatcgcag    137580
     gaggtgagga tagataggag gagtgtgcta ggacccagtg gcggatccag aaaatcgatt    137640
     tgttggtgtc agaacgcgtc tatcgatgtc ataatatgct aattatactt agatcatggt    137700
     gttatagcat atgaataaac agtttagcta taggttttgc caaaagtcgt cgttgtcgcc    137760
     tgacaccggt cctataacta tagatccgcc cctgctagga ccacgttgag gctgggtggt    137820
     tctacacgtt ggggaggggg catggtttgt ggtgttcgcg gtcggggagg atgtatcagc    137880
     atcggcgctg ggctccatct tcccaatagc ggctctgtct ccccctcctc tcttttggtt    137940
     cagcttgggt agggcgggag aagcctctta catatggacc caagggcatt tcagtctttt    138000
     ggcatcattc gacacatcgg atagaaagga aaaaaaatac aaatgtaaca ccaagtgaac    138060
     tagaaaagta ggaatagtga cacacgagag agttagactg gatgacaaat ggaaatgaaa    138120
     atttcaaaga gtgacatttg aacctataag gatggcaaac agtaaattct tgtcgacgtc    138180
     attgcgagta tgggtgaaaa cagtcagtaa cgattagaat tgggagcatt cttctaaaac    138240
     aatgctttca cgacataaaa gaatagatag caactggtct cgactctagt ttttctagag    138300
     agggttaaac ccaccccaga cagccgataa ttaaccatat ttattattta aactactcaa    138360
     tatcaacatc aatacgatgt tgaaaaatta gaaagaataa tttttatata tagctaaaaa    138420
     gggtaaaggt tgaaaacgtt cggtcgattg ggaatttttc gtcatcattt cacccctagt    138480
     cgcccaggat gagccccggt cgactggccg ccgggcttgt gcgtttaatt ttttttctcg    138540
     tgctccgact ttcgactgtg aacggatata tgttgacggc ccgcggtcgc agctgcacac    138600
     gcctcctttc tcggatgacg aggagtcgac gattgtgcga tgtgtgactg gtgagcaaaa    138660
     cggcacgact cgagctagtg attgtcaaac tcgtcataac ctcctgctcc ctccgttcgt    138720
     cgctttgaat ttctttcttc tagtcaaata tttttttatt ttgtctatat ttataaaaaa    138780
     atttaataac atatataaca caaaattagt tccgttaaaa actaacattt attatagttt    138840
     gataatatgt ttgttttgtg ctaatgatgt tactgtattt ttttcataga tttaatcaaa    138900
     cttaaaaaaa tatttaggaa aaattaaaac aatttataat gtaaaacaaa ggagcatgcg    138960
     gtaattaagc taatcacacg gtttggcaga acaatgcatg gtagcattag cattttgaac    139020
     acgaaaagta aaacactgca tgcccggtca tctccgacga gtcatcggcg tgtgttatgg    139080
     tagctatcta cgcatttgca aagttcgcct aactctgcac taataaaaat tagaaaaaga    139140
     aacacacgat cgacaggaag ctctcgcaga gcactactga tctgtctaaa gccgtatatg    139200
     attcaagtgg tcacgaacga caaaacggcc gcgatgaggg gtggataacg agctaataaa    139260
     atttagaatt ataaaattga aataaactcg ttaacatatt tatttcacct ctataattct    139320
     aaatttatca ttttattcca tataaataat aataaacact gactaataaa aaattcacta    139380
     aactcaagta ggttggttgg atgtagttaa ggaactaaac atcattagct aagaagggct    139440
     aagcatataa agataggtga tcttctgtac taaccagcta aacgagtagc tcattaaatt    139500
     cacgagttaa aattctagct tggcttgact tattaaaact atgagtttga gtcgatctga    139560
     atcaagctcg ttacaaaccg attcgagcga tgagcttcga gatttctgtt cacccctaga    139620
     tcgatggata tggaatctgc ctctttcgga gtcccgtgca cggctcaccg gcactctaga    139680
     aacaggccgg cacaatgaga agtgaatggt caaagttgag ctctttgccc atgtgtctaa    139740
     ttggagaatg agatgcacac acacggtttc tatagcgatg aataaaactg gggtactgct    139800
     gaatatggcc atcgccatcc acagtttcag gaggggagaa aatgttgttc agttcgatca    139860
     gtcgtttgca ttgggggtag gagatcgtgc ggggaatgat gttgccaatt gtgctgagta    139920
     catactccct catttcgtag tataagttat tttaactttg atcaaagtta aattacttta    139980
     aatttaacta agtttatagg aaaatatagt caatgattaa agtcaatatt tttataattt    140040
     ccccgaaaaa atatttttaa tatatttatc ttatattgaa aatgttacta tttttttaca    140100
     aacttaatca aacttaaagc aatttaattt tgacaaagtc aaaacaattt ataatctaga    140160
     acggaatgac taccggcttt ggccgtgatc ctcgtggatg atgtacagtg tatccgtccg    140220
     agtcagctga caccgacaat taaccgctag cgaaagccat tggtaagctt ctcctttgtt    140280
     ctttttttta ttattttttt tggcgcacaa agctaaaagc ttcttacttg tcgacgatga    140340
     acatatgtct gtactgcgat tcgttgtaag atcggccagt cagtcatttt tctgagttcg    140400
     tcaattattc ttgtcttatc aaccgcaact aggactcaaa ttttataaat tagtttaagg    140460
     gctgatattg agtttttttt cttaatttta ttttttagca gtggttttta aaacgctaag    140520
     gacaaatatt ttaaattttc attaataatc attttctatt gcttgagttt gtttttctac    140580
     ggctttatca gtagtagatc aaacaatcaa aacaatcaag ttccaagtgg agcgtgtttt    140640
     ctaatgtttg agagaaagca agtttatccc acgttcccac tccaatagca ccgtaccaag    140700
     atcggctcat tttcaactct agatgagcat cttcctgtga tgagacgaca ttgggaattt    140760
     gtggatctag ttttactgac actgacaatt agacagttga gcacctttga tttccttttt    140820
     tttaatgtgg atacctctat attaatgatt gacgtaatat gtttctgata gtggaaatgg    140880
     ggctgtagga tcagagacaa tggctgtgtt tagttgaggg aaagtttgga ttttggttga    140940
     aattgaagat aatgtgactg aaaagttgtg tgtgtatgac aggttgatgt gatgaaaaag    141000
     gactgaagtt tggatccaaa ttttagataa tattaacatc accaaagtca aacatacaaa    141060
     tgttcacaca catccagtac gcccgtggtt cctaaattcc taggacacat aggaccatga    141120
     ttatgattac tgcccatctc aaaatataaa aatttagaat cacataatct ctccatccca    141180
     taaaaaacaa tctaatacta gatgtgacat atcctaatat tacgagtctg gacatacatc    141240
     tgtctagatt cattatacta gaatatgtca catccagtac tagaatgtta tccgatacta    141300
     agggactcat cttttcgctt atgcttatac ttatctacca aaatttaaat ttttaacata    141360
     aaaaatttaa agttgatttt gaggtttttt caatcaaagt ttatttttca gcctttactt    141420
     ctagattgct aaaaacacat atataaaaaa tttatttaat ttacaaatat atcgtttggc    141480
     ttatttcacc aataaaataa aggatatgac aaaaaaaaat tattatattt gggggcgaat    141540
     atggcatccc accccacgta ccacacgaca cactccggtt tgggttttgg actttcgacc    141600
     gacccacgcc atctggccac cacaaattga cactgggctg gccgtacatc gcacggctat    141660
     aatcattcca cgtcaacaca aacgtacgtg gcccccaccc gccgtcgacc ccacccaacc    141720
     cccaccccac gtgttttggt caaccccgcc ccgttgaccg ccccccgcgc cgcaagctct    141780
     taaaaaaaaa acgttccctc cacgcgaact ccggcgacca accaggctgc ctccaaagca    141840
     gccaaaccca agccactgac ccgccgccgc tagatctcgc caatgccgcg gagacacgac    141900
     gccctccgcc tgctgctgct ggtggtggtg gtcgccgcgg cggatgcggc gacggaggcc    141960
     gacgcgctgc tggcgtggaa ggccggcctg caggacggcg cggccgcgct gtccgggtgg    142020
     agccgcgccg cgccggtgtg cgcgtggcgc ggcgtggcct gcgacgccgc cgccggcggc    142080
     gcccgcgtca cttcgctccg gctcaggggc gccggccttg gcggcggcct cgacgcgctc    142140
     gacttcgcgg cgctcccggc gctggccgag ctcgacctca acgggaacaa cttcaccggc    142200
     gccatcccgg cgagcatctc gcggctccgc tcgctggcct cgctcgacct cggcaacaat    142260
     ggcttcagcg actccatccc gccgcagctc ggcgacctct ccggcctcgt cgacctccgc    142320
     ctctacaaca acaacctcgt cggcgccatc ccgcaccagc tcagccgcct ccccaaggtt    142380
     gcccacttcg acctgggagc aaactacctc accgacgagg acttcgccaa gttctcgccg    142440
     atgcccaccg tcacgttcat gtcgctctac ctcaactcct tcaatggcag cttcccggag    142500
     ttcatcctca aaagcggcaa cgtcacctac ctcgacctgt cgcagaacac tctgttcggg    142560
     aagataccgg acacgctgcc ggagaagctc ccgaatctga ggtacctcaa cctgtccatc    142620
     aatgcgttct ccggcccgat tccggcgtcg cttgggaagt tgacgaagct gcaggacctg    142680
     cggatggccg ccaacaatct caccggcggc gtcccggagt tcctcgggtc gatgccgcag    142740
     ttgaggattc ttgaactcgg cgacaaccag ctcggcgggc cgatcccgcc ggttcttggc    142800
     cagctccaga tgctgcagcg gctcgacatc aagaactcgg ggctctcttc aactctgccg    142860
     tcgcagctgg gaaatctgaa gaatctcatt ttcttcgagc tgtccttgaa ccagctctcc    142920
     ggtggcttgc cgccggagtt cgccgggatg cgggcaatgc ggtacttcgg catttccacg    142980
     aacaacctca ccggtgagat cccgccggtg ttgttcacga gctggccgga gctcatatcc    143040
     ttccaagtgc agaacaactc gttgacaggc aagattccgc cggagctcgg caaggcgagc    143100
     aaactgaaca tcctctacct attcaccaac aagtttacgg gctccattcc ggcagagctc    143160
     ggcgagctgg agaacctgac agagctggat ttgtcggtga actcgctcac cggaccgatc    143220
     cccagctcgt tcggcaacct caagcagctc acaaagttgg cgctattctt caacaatctc    143280
     accggcgtaa tcccgccgga gattggcaac atgacggcgt tgcaaagcct cgacgtcaac    143340
     accaacagtc tgcacggcga gctgccagcc accatcacgg ccctgaggag cctccagtac    143400
     ctcgccgtgt tcgacaacca catgagcggc accatcccgg cggacctcgg caagggcctg    143460
     gccttgcagc acgtgagctt caccaacaac agcttctccg gcgagctgcc gcgccacatc    143520
     tgcgacggct tcgcgctgga ccacctcacg gcgaactaca acaacttcac cggcgcgctg    143580
     ccgccgtgcc tgaagaactg cacggcgctg gtccgtgtcc ggctggagga gaaccacttc    143640
     accggcgaca tctcggaggc cttcggcgtg caccccaagc tggtgtacct ggacgtctcc    143700
     gggaacaagc tcaccggcga gctgtcgtct gcctggggac agtgcatcaa cctcacactc    143760
     ctgcatctcg acggcaatcg catatccggc ggcattccgg cggcatttgg gagcatgaca    143820
     agcttgaagg atctcaattt ggctggaaat aatctgacag gagggattcc acctgtgttg    143880
     ggaaatatca gggtcttcaa tctcaacctg agccataact ccttttccgg gccgattccg    143940
     gcgagcttga gcaacaattc caagcttcag aaagtcgatt tctcagggaa catgcttgat    144000
     gggacgatac cagttgccat tagcaagctt gatgctctga tattgcttga tttgagcaag    144060
     aacaggttgt caggggagat accaagtgag cttggtaatc tggctcagct gcagatcctg    144120
     cttgatttga gcagcaattc tctatcaggc gcgatccctc caaatcttga gaagctgata    144180
     actctgcaga gactgaactt atcacacaat gagctcagtg gttcgatccc ggcagggttt    144240
     tctcgcatgt caagcctcga atcagttgat ttctcttata atcgactcac cgggagtata    144300
     ccgtcaggga atgttttcca gaatgcttca gcttctgcat atgttgggaa ttcggggctc    144360
     tgtggtgatg tgcaaggtct aactccttgt gacatcagtt ctaccggatc atcttctggg    144420
     catcacaaga gagtagtcat tgcaacagtt gtgtcagtag ttggagtggt gttactacta    144480
     gccgttgtta cttgcatcat actgttatgc aggaggaggc ctagagagaa gaaagaggtg    144540
     gaatctaaca ccaattattc atatgagtcc acaatctggg aaaaggaagg caagttcaca    144600
     ttcttcgaca tcgtgaacgc cacggacaac ttcaatgaaa ccttctgcat cggcaaagga    144660
     gggttcggaa gtgtctaccg ggctgagctc tccagtgggc aggttgtggc cgtcaaacgc    144720
     ttccatgtcg ccgacacggg tgacataccg gatgtgaaca agaagagctt cgagaacgag    144780
     atcaaggcgc tgacggaggt ccgccaccgc aacattgtca agctccatgg cttctgcacc    144840
     agtggtgact acatgtacct ggtgtatgag tacttggaaa ggggcagctt ggggaagaca    144900
     ttgtatgggg aggaagggaa gaagaagatg gattggggca tgagggtgaa ggtggtgcag    144960
     gggctggctc atgccctggc ttacttgcat catgactgca atccagccat cgttcatcgt    145020
     gatattactg ttaataatat cctgcttgag tcagactttg agccgcgctt gtgtgatttt    145080
     ggcacggcga agttgcttgg gggtgcatcg acgaactgga cttctgtggc aggatcatat    145140
     ggatacatgg ctccaggtac ttttcttaaa tttgaacatt tttttcctta aaatgtcaca    145200
     tgtttcttat gcatacaatt tttgaaatgt agcttataat atcaaatcct agttatactt    145260
     caaagtgctt cagtgagatc cttatggtag caccaaatag catttgggat gtttcagtca    145320
     taattaacga aaaaccagat ggctaaattt agttcgatac tcccaggtag taatgtagtg    145380
     tatgataaac tgtcaaacat ttctgaccat aaaagaacat tttgtgcaag taactaccaa    145440
     atgaagagca gtagttatga aatatagttg tcgaattgtc tgttgtttaa aaaaggaaaa    145500
     aatgagagaa agaaactcag atccgatcta tttaagattg ttttgcacat tattgtgatt    145560
     catgaaagta ctgaagtcat tactgtaagt agagtggtca ttattgaata gattgccaca    145620
     tactcctgtc ctgaagattt gcagaacttt gaaagattgt cattgggaaa aggaactgct    145680
     caaattccga caagtacggc accgcaccat taacacttac cgacttcgat tatttcttgc    145740
     agaattcgca tacacgatga gggtgacgga gaagtgcgat gtgtatagct ttggcgtggt    145800
     tgcgctagag gtcatgatgg gaaagcaccc aggtgacctc ttaacatccc tgccagccat    145860
     ctcatcatca gaagaagatg atctactgct caaggacata ctagaccagc ggctggatgc    145920
     tccaacaggg cagctcgcag aagaggtcgt gttcatcgtg agaatcgcgc ttggttgcac    145980
     aagggtgaac cctgaatcca ggccttccat gagatctgta gcgcaggaga tttctgcgca    146040
     tactcaagcc tacctctctg aaccattcaa actgatcaca attagcaagc taacagacta    146100
     ccagaagtga atatatatct gtgcagagat gtaaagcacc aggaggggag gaagggaact    146160
     tcgcagttag tgatttgtaa gatgcatcct cagattatat taatgccaag ggtaagctta    146220
     ggatagtata ttacattaac tgctgataaa tatatagaaa ttattctgta cactgaatca    146280
     caaaacctgt ctttcatcaa ctttgtacaa ttgtattgct cgttgttact atccctgtgg    146340
     taatattatt attttccccc ataggctaaa caataaactt gtaaatgtaa gacagagaag    146400
     agaaatggag aaatttatga ctttgccata taattctctg agagaaaatc aacatatctt    146460
     agaaagaact gttcactgca gcagtccctt ttccttctat gaatgtgaat tagaagaata    146520
     ttcagtggat gacggaaatg tatgtgatgc tgtaaatgag tggcaatgct tctgctcttt    146580
     cgttcaacat gatgtatgaa aaaaaaaaaa ctcaaatcca agcagcaccc tccgtgtcgt    146640
     ccacgcctgg gtggcgaatc ctaccacccg ccgccgccgc tctcccctct ccctctcctc    146700
     gccgctgtca gagaaccgtg cggcaagtcg ggatggcggc agcggggccg aaccctggcg    146760
     gcgcctcgcc ttcagcgtga cgaaggtggc ttggcgcatg gatcgctggg aagatgacgc    146820
     agcgtgtagg ccacagattc aatgctgccg tagccggatc tagtcttccg tcaggtggat    146880
     ccgccgcctc tgaaccagat ctggttggag ttgctggcac gatggagcat caacggcggg    146940
     agtcccacgc gggttcctgc gtggaaggcc atgatggcta gcgacagtgg gatgccgcga    147000
     cagctggtgt cgaggaggtc ggcacgggcg acgatggtgg aagcctacgc aggtgacggt    147060
     ggcggccctt gcctctcctc gcgaacggcc gctcggctgg ccagtggtgg cgacgatggg    147120
     gcctctcctt gggcgcatgg agatgcacag gggttgccag gcggagggtt aacacgcctt    147180
     gaggacgact cgaccggagc accagcgtgc atggcaacga cggaggtttg ctgtttgcca    147240
     acccgtgtgg cggcgtagct ggtgttgggt ggagcagaag ctggatctgg ggccccgagc    147300
     ccggatttgg ccacatagca ccgccatcac gggcagcgat gatggtgggt cgctctctat    147360
     ctatggtgcc ttcacatctc catggagctc ctcaccttct tgataggttt acctggtcat    147420
     ggggagtccc atatggcaag acggtgaaga tggcgacagg aaaggaaggt cgaggctgcc    147480
     aacatgtagc ggttggtggc ggtcacacct cctccctttc ttggtgagct gatggaggtg    147540
     atggcatggg aagaaggcta ataattggtc gccatagtgc aacagtggtt ggtcgcaaga    147600
     ttggtcatgg ttatggttgt ggtcgtgtcg gcagcatgac aaccgtatgg aggacagccg    147660
     gcgaagcggc gttggtgcta ttgcagtcac gtgtcagcaa gattggtgat tggtgaggta    147720
     gcaacaagaa aggtgcaagt ttaactaatt tgttccgaca taggataata agctcatgag    147780
     gttggtctta cttcacccta aacgaaagaa gacttccata tccaagttta gctcagacgt    147840
     agctgccttc tttttgggcg tgaagcagtg tcaaaccaaa atacccaata agcataagca    147900
     ttagctctcc ctgaaaagga ggtgatccag ccgcaccttc cagtacggct accttggttc    147960
     cgccaggcga aagccagccc aatcttaagc tgacagcggc aacgccttta ggcgccggaa    148020
     ccctcttgaa ggtgttgtcg aggtgcctct cttcccctct ttaataagat cttttaggcg    148080
     aaaaccatat cttttgggat gggcgatggt ggtgttttta atgtcttaac ctttttagag    148140
     gcatcctttt ggaggttctt ggtcgtggct gtgttttctt agggtgtggt ggtggtgtgg    148200
     gacatgacgt agtgtatttc tttttttttc cctgagtata gcatttcaga attataatat    148260
     tgtaatactt cacttttttc aaagttttaa tacaaaaatg cacaattttt tgcgtattcc    148320
     agaaaacatg atgcatgaaa agttcaattc gaattggtga ggttgctggc tgcagacatc    148380
     ggacaaccac aacaagaata gtagtaggaa tgagtatagt acactagagt agctagaaca    148440
     cagctgttca ttcaggtgaa cacatgcatg ccataaaaat gcatctaata tacttaattt    148500
     ttgaatggga attaactatt tcaaaaatgg ccaatataaa ctgaaaactg tatgattctt    148560
     tggttgctga tttgcaactg aagagtgcat taatgtctac tgcttatgca caacttcttt    148620
     ctatctggta aagtgaaaaa tgaaaactca gtggcttaag taaaaccaga gctccaaact    148680
     aaagccaaaa cacacaaaaa aaaaggccaa taatattaca gaataaagta atggcgcata    148740
     gatttcttta tggtcttcat ttttttatcc agtgtaggtg catggaggga agccacaaag    148800
     aagcagattg ttgctataga ctgatggatc cacaattgac tgaagttgac ttacagtggt    148860
     tacctcaccc tatttcagat acttaacata ccaaagcata acgaatttga aatgctcgga    148920
     ggaataacac cacaagggtt tcaaactgcc tatcttttct ggaatactgc cggatagagt    148980
     atttccagaa taaagccata agattttgga taagataaag tagcatttta aattcctctt    149040
     agtcttaata tacaaaggaa acatgccaat tacagaacaa cagaaagcta aatatacttc    149100
     ttcatcataa ggtaacatta cggaaacaca gctgcacaga tgctaagccg tatttcctct    149160
     agaaagaaat tgattaatat aggacacctt ctgcgtaacc ttacactgta tggcatcaac    149220
     aaagcagata atgacatacc ttaaggtctc gatggaaaag aacattccaa accacagaca    149280
     aagcccggaa accactccag acatcacaaa gtaggataga tattggtcct cgcatgttct    149340
     acaatatctc tcttcagatg caagtgaaga atttgtgcac gaaatgttca acggaaaacc    149400
     acatagccta ggatttttgt tgtatatcga tgggtcagta agggtttgaa gttgattccc    149460
     aaagggtatc ttgcccgata gattattatt cgagagattc aaaatgctaa gggtagatat    149520
     accggcaagg cttggaggaa tagctcctga aagttcattt gacgagaggt caagggactc    149580
     gagatttttc aaactaccaa tgtttccagg tatgctgcat gacagatggt ttcttgacaa    149640
     gttcaaaaat tgaaggcctt ggaggttcgt taactcatca gggatgcatt gtgataatga    149700
     gttacttgac aaatcgatac ccgtaagtag ttgaaaaaaa tttaatccag aaatttttat    149760
     ttcaaaaatt tgctcctgcc ccttccagat tgtatcaatt ctttcatcgg aactaagcca    149820
     ttgtaataat tcctgaggag atattaagtt ttttattctt catggaagtg aggttactaa    149880
     aagatctggg aatcgatcct gtcagaccat tgttgctcat gtctagtagt tgaagttgag    149940
     aaagctgcga caactccgaa ggaatttcac cagtgaagtt gtttgattta aggataagaa    150000
     tcctcatcga aggaaatcct ttcccaatcc aaggaggaat attaccgaag aacttgttat    150060
     tcccaaaatc taaggagacc agtgtcttac atccctctaa agttgatgga aaaactccag    150120
     tgaaaccgtt gccagcaaga tataccgaat gaagagaaca attgtagctt gtcccgagtg    150180
     cagagatttc acctgagaag tcgttgtggg agaggtccat gaactgcaga ttctgcaggt    150240
     tccaccagca gtcgggcagc ttaccagtga gcttgttgtt tgaaaggtct agattctcga    150300
     gggagagcag cctgcagaat gctgagccag agctgcaatt ggaggaattc cctgatgaac    150360
     caactccctg cagcttgaaa ttgtttccca aatttcccat aattggcccc gaaatggagt    150420
     tatggctaag attgaggaat tgcaaattgc tgagatgacc caactcatat ggaatgcctc    150480
     ctgtcagatt attcgctgac agatcaagat acttcaagct tgtcaagctc cccaatgccg    150540
     gaggaatgct gccggataat ctattgtcgt acatggacag catattcagt ttccttgcct    150600
     taccaagctc tggtgggata tttccagtga acatgttgct gtccacaccg aagaattcga    150660
     gctcgggata tcacccgtga gattgttgga tgagattctg aacaccctca ttgcctgcag    150720
     ccgggcgaat gccagcggca agttaccgga gagcttgtta taggcaaggt tcaggacaga    150780
     gagattcata agatcggcca actgcaatgg cagagttgaa acaagctcgg cggccattac    150840
     ttggagctcc tccagcatct ggagctggcc aagaaccggc gggatcggac cgccgagcgg    150900
     gttgttgcca agtacaagaa ctctcaactg ccccatcgac ccgaggaact tggggatgcc    150960
     accggtggga ttgttgtact caattcgcag atgctagagc ttcgtcaacc tcctgagcga    151020
     gtccggaatt cggccggaga acgcattgat ggacaagttg aggtgcgtca gattcgggag    151080
     cttctctggc agcaagtctg gtattgaccc agagaaattg ttcagcgaca ggtcgaggta    151140
     ggtgatgctg ctgctcctga ggaagaactc cgggaagctg ccgttgaggg agttggcaaa    151200
     gagcgacagg aacttgacgg tgggcatcgt cgagaacttg cgataatccg ggttggtcag    151260
     ccaattattc cctaggtcga agtgggtaat cttggggagc cagctgagct ggtgcgggat    151320
     gttgccgacg aagttgttgt tgtagaggcg gagctcgacg aggccggaga ggtcgccgat    151380
     ctgcgacggg atggagccga cgaacccgtt gttgccgagg tcaagcgacg cgagggatac    151440
     caaccgcgag atgctggccg ggatggcgcc ggtgaagtta ttcccgttga ggtcgagttc    151500
     ggtgagcgcc gggagcgccg cgaagtcgag ctcatcgagg ccgccgcgga ggcccaagct    151560
     cgggagccgc agcctcgcga cgaggccggc ggcgtcgcag gccacgccac gccagccgca    151620
     gaccggcgcg gcgcgcgtcc aggcggacag cgcggccacg tcggtcaggc tggccttcca    151680
     tgccagcagc gcgtcggtct gcgacgacgc tgcggcattg gttgatgctg gcatgacggc    151740
     ggccgccacg aagaggagga ggaggaggaa acggtggacg acgccggcca tgcgggcagt    151800
     cggttctttc atggcagagg cgtacgtagc gagcagacac acggaggaag acacgatcga    151860
     tatatcgagc tgatcgtctc cggctgtgca ggtcggtgaa tttttttttt ttgcatggat    151920
     tccatcttcc gaggacagat ctaatagaat ggctgactca tgttccgtcc ggtataccta    151980
     ctacgagttc acggggagta cgtacgtgat gatgtttgtt taattaacag ccaacttggt    152040
     catttatgtc ttattgatcg atttatttgg tttatcacta ctcattcttt gttttaagaa    152100
     gactttgctt aatctaacta gtcaccatca tgtgggtgca aggactatta ttgttgttgt    152160
     tatacttata aactagcatg gtggcctaca cagattgcgc ggttagcatc attatatttt    152220
     ctctcatata atagcatata tgttttctca ttatattatt caaatatatt aaaatgacaa    152280
     cataatttta aattttgcaa taactttaca aaactactaa tgtgtagtaa tattcatatt    152340
     gtattttata tacgtgttag ttattaatta tttttaatat caaattttag ttatttgtaa    152400
     attatatata tttctatatg gactctagac tcgtatttta atatttttta attccgaatt    152460
     ttttataaat tatatttcta tatagactct acgctcttct tccaatatta tttattttta    152520
     tttatgaatt tttattattt ctaattgtat ttctatgtgg actctaaact catctttcaa    152580
     tattctttaa tttttaattt cgaatttgag ttacttttaa attgtattcc tatattgact    152640
     ttaaactctt cttcccatgt ttttattaat tttgaatttt agttatttgt aaattgtatt    152700
     tttatacgga ctctaaactc tacttttaat tttattatgt ttattccaaa ttttagttag    152760
     ttttaaattc ctgtatagac tctattatgt tctaatattc cttatttttt taatttcgaa    152820
     tttcagctat tttctaaatt gtatttctat atggactctg cttttttttt tctccgatta    152880
     atgtgagaat ttctaagcca tgagagtgaa cgtggaagct tctttttcta tttctttaat    152940
     aatataatag atagatatat tgcgtgtgta gaatatgctg cgagttgtac tcggattagc    153000
     gagctcataa ctgcaagcgt ggtatgatag caggaaaagc tccaattata tcaatttttt    153060
     tcttcagctg aatcatgcgt gtccagcaga acgggagaca tgcctgagct gtcacacatg    153120
     tacttagagc aggtacagta agacggtaga tgctggcgat aggatgacca tgtcagcgtt    153180
     gatgcttagc tggaggtgaa aaaggtggtg agagagatta aacaggcgac taattagtcg    153240
     ctagctgctc actctatcca aggcaaagca tttaagtgct gttggctgca cgctatggca    153300
     acgcaagaag ctgggtgggg tcacctcatt ctaccgaatg catttgttca tggttgatgg    153360
     gaactgtgta gcaatagaag atagtagatc tctattgtat gcactagcta ttagcactaa    153420
     ctataatttg ctgatgtggt tatttttata gcttttagct ggctatacta ttgaccttgc    153480
     tctaacaatt agtcaatcat cagtctaact atgggctata atgaagtagt ccatccgttc    153540
     caaaatataa caacttttag ctctcaggat ttatcctaaa atataacaac ttctctacca    153600
     atattctctt ctcaaccaat cacaactctc catcgttcat ttttcccacc tacctttact    153660
     actaatccaa ttacaaccct ccaccattca cttctaccta gtaaccgtgt ctaactttaa    153720
     aacttattat attataggat ggagggagta gtaattaact actgttgcaa aagctagcag    153780
     aaggtgacag gatggttcaa catcgatctg tctctcagat aattcatccg tcattctgaa    153840
     taacttagca gtttagcata gattaaagtt taagaaaaaa ttatactatc cttaaatgat    153900
     actccttctc tcccactcac taagacacgg tcaaacctga tgcactcttc aaaactaatc    153960
     tttgacttta aatttctcat atattataat gtttgtaaca acaaaatcat aatcatataa    154020
     aagtaaatat agatgacaat ccaataatat aattttcatc aaataaaatt taatttataa    154080
     taaagtattt gcagatcaaa tatttaaaga gttaaaattt aaaatatgtg tgcgccttag    154140
     tgagtgggac ggaggaagta catggttagg agtgtagtgg tagttggggg tagaatagag    154200
     agaaatttaa atgaaatgtg atgggataaa tcatacttaa gagtgacatg tactttgata    154260
     tggaggtaat aattaatctc tttgcatgca tgtgactact agatgggttt gtcaaaatta    154320
     atgcaacaaa tggccaaact aaagtcatct gtgccacttg ctgagtgccg gttgggatat    154380
     ccggtaccta tgatcggttc ccaagcggca cataagtgct tttatgtaat agtgaatacc    154440
     aaggagatgg actgtgtttg tatatcagta gtcatgtggt aattaattgc tcatttggtg    154500
     gataattgaa tattactaat ttatcatcgc ttagagcaag taagctacct agaaacaaat    154560
     gtgaaggaga gaggagaaga tgaattaacg agctatacag gcacaagtcc gagtggaggc    154620
     atggcggcgg cggcaaaggc gacggcgtcg actgcttcac cgcctacttc gtggaggcac    154680
     ggaagcggtg gcggcaacgg cgacggtgtc gactgcttca ccgtctactt cgtggaggca    154740
     cagaagcttc agctgctccg ccgcaacgag tccttcgagc tcaccctcga gccgttcacc    154800
     tacgagctct tgttggagcg gcggatcagc ttcgtgccca tcggcctcgc caacatgctg    154860
     aacgtcggcg gcgccgtgca gggctttcag acagtgaaga aggacgacgg cggcggcggt    154920
     gatgtggtgg cggaggtggc ggtgaagggt gccaaggagg catactcgtc ggcgaggctg    154980
     tgggcgggtg cgcgtgggga ggcggccgag gagcggcatg gatggagccg ggcggaggat    155040
     ggtgagcttg atgtccccgc tacggaatcc ggcctcggca aagacgcggc tgacgacctt    155100
     gacggcggcg ggagtctggg cggtggtggc ctagtggtag aagtggaagg tggcctggga    155160
     gcgcttgatg gcggccatga ggaaggagta gaggggacat tcccgtcaat tcgaaatttc    155220
     tctcccctct tttagcccga aaattataaa ataatccctt cggtgtccta taactaatta    155280
     cacaactttt gtagtgtcca tcggcagtgt cacatttttt ggtgtctctc agccaattac    155340
     acgatttttg attgtcctgt atcaaatttt gcctaaaaga aacggggaaa ggaaaaagga    155400
     aaaaaatagg agggtaaaat ggtaatttca aagttgattt aattaagtaa ttaggaatat    155460
     ctttcatgaa ctttattcta gatgctttgg ttctaccata tttattttat aagtttacac    155520
     ttctccctta tatctattta attttattaa tcaaatcaaa acttaattcc tttaattatt    155580
     ttatatagtt tgatttggtt ttgaggactc catgaattaa tttggttggc accaataata    155640
     actacaataa atgagaggtg taccatcggt atgatgcaat ttaataaaag ttttcgacag    155700
     tcgtcaacta tggtccacag tttattagtt gaatttttag agtgttacac tggcttaggg    155760
     acgagaggtg atggaggacg tcaaggttac caaatgtaga ctccgacgag gaggcggaga    155820
     gcagcgacaa agaaggcacc cgtcttaggt atagccccat tcataggcac tatggtcgtg    155880
     gcccataaga agtaggtcga accagcgatg cccactccca cctctccctc actcggccac    155940
     ccccttctcc tccttgaaga cccgtgtgag gagggattct gtgactatgc ggatgtgcca    156000
     tggatgaggc acttgagcca ctgcacacta gaaaccgaaa ctgcctggtg tcccaaggac    156060
     tagtagtggg agggagtggt gggtggatga acaggcggaa ggacacgaca aaaggccaca    156120
     tctagtgcga atattcggcg agtggtaggt ttttggcgag tgtggctgca cggcacggga    156180
     gagagagaga gaggggatga gaggtagtca cttacatttg ggcccgtatc tattttaaaa    156240
     tttttacgat gaccggtccg ccctgtagaa gccatcgtca gctagaacca ccattaaaac    156300
     agttgaggga gttgttttgc acgattttaa tacttggtag aggtgatata accgatttta    156360
     tggctgagag aatcaaattg ggtcaataga gtagacagct aaaatagact ttttcactcc    156420
     cctttcttta tctttctttt cctttctgcc caatctgggc cagagccgag ccgacccaaa    156480
     ttccctactg ccctgcagac gaagcacgag gacgaggaga gcagggtcct atttggtacg    156540
     gctccaaact ctaactctca actctaaact ccaattttaa tgaatattgg tttctataga    156600
     agctgagatg gatatagaga gtattttgac tagattactc agctccatcg ccattcggct    156660
     cggcacgacg tacgcggcga tccccgtgtt gggatcgtct ccggctaccc tagtcttcgg    156720
     atgggtcaac atcatgtgtt agtaaggatt ccgacttccg agggtttttt tggtaaaaaa    156780
     atatgtttat tatgagaacc cacctcacta atcagcaaac cagggagaaa ggcagcacaa    156840
     cacacaacgt atggactaaa cccgactaca ttatttctgg atgtagggct tagcttagta    156900
     ctactaccat ggtttatacg agtatggagt aaattaaaga gcggtgtata ggggtatttt    156960
     tatagaggtt cggactcctc acatcggcaa tactctatac ggtagtagat atatcacaca    157020
     agtaatctaa ccttttaaac tattcggaaa atactcccat tcgggctact gtttggagtc    157080
     tgcttcgttg gagaaaaaaa tttcagcacc acaaccactg catatctaca tgatacaaag    157140
     atctacatga tacattcaca tgaggaccgt tcttttactt cactctaaaa aagagcttag    157200
     caaaatgagt atacaacaaa attaaaaaaa aaaagaccct tgccgaacat gcgcgcacac    157260
     gatgttcatg tgctttagca cccttgtcct ttccactttc caccaaagcc atgccatgtc    157320
     ttaatttttt tatgtcccaa ctgcatgtgc tttggtttgt atagaaaaag atttggtttg    157380
     ttactttata tttatttttt tttctttagt gtgtaatttt gaccaacaag tttgacttgt    157440
     gactaaaaac tttctactac agcgatcaac taaataactt atttgaaaaa gaaaactttc    157500
     aaccagatca tatatactct tgtttagagt cctaaaaaac tttcatatga aaatttttgg    157560
     ggcaatataa cggtgcgaac tgtgcctcaa aacagttaaa ggtatgcact ataattttga    157620
     acagatgaaa taatatatta catgtttgaa acaaatcagg agttgatgcg gagagaaatg    157680
     agaaaattcc ttacgtaccc ataagttttt tctccattcc ttcttgcctc tgaatattac    157740
     atcatcctct ttatattact gtgaggtttt atttttatcc ccgataattg tacccatttc    157800
     gttagttgac tgtaagttta ccattatact ccctccgttt cgaaatgttt gacaccgttg    157860
     actttttagc acatgtttga ccgttcgtct tatttaaaaa cttttatgaa atatgtaaaa    157920
     ttatatgcct acatcaaatg ataggaaaag aattaataat tacttaaatt ttttaataag    157980
     acgaacggtc aaacatgtgc taaaaagtca acggcgtcaa acatttcgaa acggagggag    158040
     tatttgtttt ttttctttca aaaatggcta cgaccctgtt tagatcccac cctaaaattt    158100
     ttcatcctgt cacatcaaac atttgaaaac atgcatgaag tattaaatat aggctaaaaa    158160
     ataactaatt acatatattg tgactaattt acgagatgaa tcttttaagc ctaattgctc    158220
     catgatttgc caatgttgtg ctacagtaaa tatttgctaa tgatggatta attaggatta    158280
     ataaatttgt ctcgtggttt acagacggat tctgtaatta gtttttttat tagtgctcga    158340
     acaccctata cgacaccata tataatacct gatgtgacac gccaaaacta atcacatcac    158400
     accaccacac cccatgtcac actagaccag aggtatgagg acaatgctcc caagacgggt    158460
     tcgcccctta attcttttgc agaatataag tctattttgg ctccatcatc gtaaaaccgg    158520
     gtataaaatc tttcctaact tcgaaataac ctccttttga ggttttagaa gtggtttatg    158580
     ctgaaatgac agtttaacca tggttaacta actaaatcag caagcgagaa ccatatgtaa    158640
     atgacttcct gctcatctca tcctcttctt cacctctccc ttctttctct ccttccctct    158700
     tccctctcac ccttccagcg gcgggagcca ccttacttaa tctattctca gaccttcctc    158760
     accggcgcag acggcgtcct ctcatgttcc atccgctgac cagcctaaat tgccacatca    158820
     acataaacta ctttttaaac caccgaagga gttgatttac accggatttt gaagatagag    158880
     agacattatt gttggaaact ttttttggca agaagaaaac atgattggga cacctaaaag    158940
     tattgcggtg atatggagtc gctaaccacc tcaatcaagc aaaaactagt tcaaaatggg    159000
     ttttgtagaa agaaaagcta aaccggctag cggagccgat tttgatcgat acgatgataa    159060
     ctacccgtct cgtgggcgaa caaaaggttt gcgggacaaa cctacaaagg ggtaatcgca    159120
     ctcttgcagc gacggcggac gatttatggc gcaaaccgat aaagatagac taaactaggg    159180
     taaagtagaa aacatagctg aaaagtaaaa ggtaaaagaa aacgattcaa ttgtagagat    159240
     tgttggggga gagagatttt cttaatcgaa tcgaccttgc cccttaaata ggggttggtc    159300
     ttgcctacta caaatcctcc tccacgtcaa cttgggatag aaaccaatgg aaactcgaaa    159360
     catatatttt tgagtaagga aactcgagac ctgatgaaaa tagactcggg cttagactct    159420
     gccggtctga ccggccacat accgccggtt agaccggctt tcaagccgca atttgaccgg    159480
     ccctgtagag gaaaccggcg actttcctaa atcttggcaa atttccttaa tttgaaccta    159540
     cgtgttaaat ttgagcgtaa acagttagac ccgattttgc ggttgaggga gacgattcga    159600
     tcaaagaccg agagagagaa cgaggaaggc caaaattgac ttttattcgt gtgccaaatt    159660
     ttttttttat atacggatgc acatttgaag tattaaacgt agactaataa taaaacaaat    159720
     tatagattcc acctataaac tgcgagatga atctattaag cctaattaat ccatcattag    159780
     caaatattta ctgtagcatc acattgtcaa atcatggtgt aattatgctt aaaaaattcg    159840
     tctcgcaatt tacatgtaaa ctgtgcaatt ggttcttttt tcatccacat ttaatgttta    159900
     atacatatgt acaaatattt aatatgatgg aaaagttaga agtttgatga gaaaattttg    159960
     aatcaaaaca cagcctttat cttcctcttt tcttcctcgc ttgtggccct gccagctcag    160020
     tctggaccgt gagcagcagc ttgtgctgca tgagaccccc ctccaaagct tcgcagcggc    160080
     agcaagccaa gccgaggagc gaggagctct gccgcatcca cctcaatctc tctcaccgaa    160140
     taactgatca agccgccgcc aacagcaaaa gagacggccg cctccgccca agagccgcac    160200
     aacacttcgc ctcctccacc gccgtcgccc gggcgcaaac gcggcgaata ccctagcttt    160260
     caccggctcc accaaatccc gagaattcgc ccgcacccga gttccttggt ccgaaattga    160320
     ggtgaccatc gtcttctacc cgcgataaat ctcctttacc ctctcttttt actggcaaga    160380
     tcaccgtagc tcgccggagc gactcccgcc cacccgttcc cccgccgccg ggaagggaac    160440
     ggttggaatt tcacagttaa gatgcataaa tgcattgtta gatagattaa ctccaggggc    160500
     aaagcttagg atagtactct attactttaa ctggtgatgc atgtactgaa attattctga    160560
     agactgtcaa tggctcaagt agaagtagag ctccaaacca aagccaaaat ccgaaaacaa    160620
     tgccaaaact cagagagtaa aataagaact tatcaagttc ctgatggtct tcatttctca    160680
     tccaatgtag gtccatggca ggctgttctc aaagagaagc cacctgaaag ctcaatgcat    160740
     aattaagtca agggactccc aagatatagt aattgccaat tctttctgga acacatgcgt    160800
     gatagattat tccctgacaa gtttaaaaac cagaggccct gaaggtatgt cagctatttt    160860
     ggggtttcaa tgtaaagtga aatgctttgt aaatcaatac ctgtcattaa accagctgtt    160920
     ctctgtttct tcaggtccct tccaattaca tttttcttac tcttaataca aaggaagcac    160980
     atacttcatc atcagaaggt taaggaaaca cagctacaga tattgggcag tattccctct    161040
     tgaaagaagt tgattaatac aggacacctt ctgcataacc ttacgctgaa tgtcatcaac    161100
     aaagcagaaa acggcatacc ttaagttccc aattgaaaat aacattccaa accatagcca    161160
     agacccaaaa accactccag ccatcacaaa gtacgataga tactggtcct cgcatgttct    161220
     acaatatctc tcgtctgatg caagtgcata atttgtgcat gagatgttca acggaaggcc    161280
     acatagccca gaattgttgc tgtagattga tgggtcagtg agggtttgaa gttgattccc    161340
     ggtggatatc ttgcctgata gatgattatt cgagagattc agactgctaa gggtagatat    161400
     accggcaagg cttggaggaa tggctcctga aagttcgttt gatgataggt caagagactc    161460
     aagatttttc aaactaccaa tgttctcagg tatgctgcgt gacagatagt ttcttgacaa    161520
     gttcagaaat tgaaggcctt ggaggttcat taattcatca gggatgcatt gtgataatga    161580
     gttacctgac aaactgatac ccgtcactaa ttgaatatct attgcataag tctttatttc    161640
     aaatatttgc tccttcccct tccagattgt attgattcta tcatgattaa aagaccattg    161700
     taataattcc cgactagata taagctttgg attcttcatg gaagtaagtt taccaaaaga    161760
     tctgggaatc aaccctgtca aaccattgtt ggtcatgtct agcagttgaa gttgagaaag    161820
     ctgtgacaac tctgatggaa tttcaccact gaagttgttt gatttaaggc taagaatctt    161880
     caatgatgga aggcctttcc caatccaaat aggaatatca ccaaaaaaat tgttattccc    161940
     aatatctaaa ttgatcaact tcttgcatcc ctctaacgct gatggaaaaa ctccagtgaa    162000
     gtcattgctg gaaagatgaa tcgatataag ggaacaactg tagcttgcct ttgctgcagg    162060
     gatttcacct gagaatgcat tgttggaaag gtccaagaac tgcagatttt gcaagtacca    162120
     taggcagtcg ggcagttttc cagtcagctg gttgttcgac aggatcagaa tctgaagaga    162180
     gagcagtttg cagaaggctg cctgggggat ccaacccgat aaaaaattgc tgctcaaatc    162240
     aagtagggtc tgcagctgaa ccagattacc aagttccctt ggtatcttcc ctgacaacct    162300
     gttcttgctc aaatcaagaa atgtcagagc accaagctt                           162339
//

If you have problems or comments...

PBIL Back to PBIL home page