(data stored in ACNUC8465 zone)

EMBL: AC025294

ID   AC025294; SV 14; linear; genomic DNA; STD; PLN; 124511 BP.
XX
AC   AC025294;
XX
DT   14-MAR-2000 (Rel. 63, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 15)
XX
DE   Arabidopsis thaliana chromosome 1 BAC F19C24 genomic sequence, complete
DE   sequence.
XX
KW   HTG.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-124511
RA   Lin X., Kaul S., Town C.D., Benito M.-I., Creasy T.H., Haas B.J., Wu D.,
RA   Maiti R., Ronning C.M., Koo H., Fujii C.Y., Utterback T.R., Barnstead M.E.,
RA   Bowman C.L., White O., Nierman W.C., Fraser C.M.;
RT   "Arabidopsis thaliana chromosome 1 BAC F19C24 genomic sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-124511
RA   Lin X., Kaul S.;
RT   ;
RL   Submitted (08-MAR-2000) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA, xlin@tigr.org
XX
RN   [3]
RP   1-124511
RA   Town C.D., Kaul S.;
RT   ;
RL   Submitted (19-JAN-2001) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA, cdtown@tigr.org
XX
DR   MD5; 7e0480b3764aa23c1aea7d29d0e5a348.
DR   ENA-CON; AE005173.
DR   GOA; P0CAY5.
DR   UniProtKB/Swiss-Prot; P0CAY5; DF166_ARATH.
XX
CC   On Jan 19, 2001 this sequence version replaced gi:12280782.
CC   Address all correspondence to:at@tigr.org
CC   BAC clone F19C24 is from Arabidopsis thaliana chromosome 1
CC   The orientation of the sequence is from SP6 to T7 end of the BAC
CC   clone.
CC   Genes were identified by a combination of several methods: Gene
CC   prediction programs including Genscan+ (Chris Burge,
CC   http://CCR-081.mit.edu/GENSCAN.html), GeneMarkHMM (Mark Borodovsky,
CC   http://genemark.biology.gatech.edu/GeneMark/), GlimmerA (a variant
CC   of GlimmerM, see Mihaela Pertea,
CC   http://www.tigr.org/softlab/glimmerm_htm/glimmerm.html, and
CC   GeneSplicer (Mihaela Pertea and Steven Salzberg, contact
CC   mpertea@tigr.org), searches of the complete sequence against a
CC   peptide database and the plant EST database at TIGR
CC   (http://www.tigr.org/tdb/tgi.shtml). Annotated genes are named to
CC   indicate the level of evidence for their annotation. Genes with
CC   similarity to other proteins are named after the database hits.
CC   Genes without significant peptide similarity but with EST
CC   similarity are named as  unknown  proteins. Genes without protein
CC   or EST similarity, that are predicted by more than two gene
CC   prediction programs over most of their length are annotated as
CC   hypothetical  proteins. Genes encoding tRNAs are predicted by
CC   tRNAscan-SE (Sean Eddy, http://genome.wustl.edu/eddy/tRNAscan-SE/).
CC   Simple repeats are identified by repeatmasker (Arian Smit,
CC   http://ftp.genome.washington.edu/RM/RepeatMasker.html).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..124511
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="I"
FT                   /cultivar="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /clone="F19C24"
FT                   /db_xref="taxon:3702"
FT   mRNA            join(<1..223,313..457,534..605,699..770,880..951,
FT                   1022..1194,1300..1547,1654..1780,1873..1938,2013..2202,
FT                   2293..2882)
FT                   /gene="F19C24.22"
FT   misc_feature    1
FT                   /gene="F19C24.22"
FT                   /note="TR 31084 nt beyond this point were not included in
FT                   the submitted sequence due to an overlap with another BAC
FT                   (F5D21)"
FT   CDS_pept        join(<1..223,313..457,534..605,699..770,880..951,
FT                   1022..1194,1300..1547,1654..1780,1873..1938,2013..2202,
FT                   2293..2701)
FT                   /codon_start=1
FT                   /gene="F19C24.22"
FT                   /product="receptor protein kinase, putative, 5' partial"
FT                   /db_xref="GOA:Q9C8J0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR024788"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8J0"
FT                   /protein_id="AAG50864.1"
FT                   /translation="EFNVTLNGEYTIGPYSPKPLKTETIQDLSPEQCNGGACILQLVET
FT                   LKSTLPPLLNAIEAFTVIDFPQMETNEDDVTGINDVQNTYGLNRISWQGDPCVPKQYSW
FT                   DGLNCNNSDISIPPIIISLDLSSSGLNGVITQGIQNLTHLQYLDLSDNNLTGDIPKFLA
FT                   DIQSLLVINLSGNNLTGSVPLSLLQKKGLKLNVEGNPHLLCTDGLCVNKGDGHKKKSII
FT                   APVVASIASIAILIGALVLFFVLKKKTQSKGPPAAYVQASNGRSRRSAEPAIVTKNKRF
FT                   TYSEVMQMTNNFQRVLGKGGFGIVYHGLVNGTEQVAIKILSHSSSQGYKQFKAEVELLL
FT                   RVHHKNLVGLVGYCDEGENLALIYEYMANGDLKEHMSGTRNHFILNWGTRLKIVVESAQ
FT                   GLEYLHNGCKPLMVHRDIKTTNILLNEQFDAKLADFGLSRSFPIEGETHVSTAVAGTPG
FT                   YLDPEYYRTNWLTEKSDVYSFGVVLLEIITNQPVIDPRREKPHIAEWVGEVLTKGDIKN
FT                   IMDPSLNGDYDSTSVWKAVELAMCCLNPSSARRPNMSQVVIELNECLTSENSRGGAIRD
FT                   MDSEGSIEVSLTFGTEVTPLAR"
FT   repeat_region   complement(475..504)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(<4438..4541,5354..5829,5913..6057,6139..6210,
FT                   6334..6405,6498..6569,6650..6831,6966..7183,7278..7404,
FT                   7635..7824,7911..>8319)
FT                   /gene="F19C24.23"
FT   CDS_pept        join(4438..4541,5354..5829,5913..6057,6139..6210,
FT                   6334..6405,6498..6569,6650..6831,6966..7183,7278..7404,
FT                   7635..7824,7911..8319)
FT                   /codon_start=1
FT                   /gene="F19C24.23"
FT                   /product="receptor protein kinase, putative"
FT                   /db_xref="GOA:C0LGG3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR024788"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0LGG3"
FT                   /protein_id="AAG50887.1"
FT                   /translation="MLELRPMKKNMYVTQSGSLKYLFRGYISNSSTRIRFPDDVYDRKW
FT                   YPLFDDSWTQVTTNLKVNTSITYELPQSVMAKAATPIKANDTLNITWTVEPPTTQFYSY
FT                   VHIAEIQALRANETREFNVTLNGEYTFGPFSPIPLKTASIVDLSPGQCDGGRCILQVVK
FT                   TLKSTLPPLLNAIEAFTVIDFPQMETNENDVAGIKNVQGTYGLSRISWQGDPCVPKQLL
FT                   WDGLNCKNSDISTPPIITSLDLSSSGLTGIITQAIKNLTHLQILDLSDNNLTGEVPEFL
FT                   ADIKSLLVINLSGNNLSGSVPPSLLQKKGMKLNVEGNPHILCTTGSCVKKKEDGHKKKS
FT                   VIVPVVASIASIAVLIGALVLFLILRKKRSPKVEDGRLPRSSEPAIVTKNRRFSYSQVV
FT                   IMTNNFQRILGKGGFGMVYHGFVNGTEQVAVKILSHSSSQGYKQFKAEVELLLRVHHKN
FT                   LVGLVGYCDEGDNLALIYEYMANGDLKEHMSGLEYLHNGCKPPMVHRDVKTTNILLNEH
FT                   FEAKLADFGLSRSFLIEGETHVSTVVAGTPGYLDPEYHRTNWLTEKSDVYSFGILLLEI
FT                   ITNRHVIDQSREKPHIGEWVGVMLTKGDIQSIMDPSLNEDYDSGSVWKAVELAMSCLNH
FT                   SSARRPTMSQVVIELNECLASENARGGASRDMESKSSIEVSLTFGTEVSPNAR"
FT   repeat_region   complement(5204..5238)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(8428..8470)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(8672..8700)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(9624..9710)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(10309..10345)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(10747..10802)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(10932..10952)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(12910..12944)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(<15142..15359,15440..15921,16116..16260,16335..16406,
FT                   16510..16581,16654..16725,16809..16993,17086..17321,
FT                   17413..17539,17790..17855,17955..18144,18238..>18607)
FT                   /gene="F19C24.1"
FT   CDS_pept        join(15142..15359,15440..15921,16116..16260,16335..16406,
FT                   16510..16581,16654..16725,16809..16993,17086..17321,
FT                   17413..17539,17790..17855,17955..18144,18238..18607)
FT                   /codon_start=1
FT                   /gene="F19C24.1"
FT                   /product="receptor protein kinase, putative"
FT                   /db_xref="GOA:Q9FZB8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR024788"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FZB8"
FT                   /protein_id="AAG50867.1"
FT                   /translation="MWITVNTDNTIKEILHVSKSNTLQVCLVKTGTSIPYINTLELRPL
FT                   ADDIYTNESGSLNYLFRVYYSNLKGYIEYPDDVHDRIWKQILPYQDWQILTTNLQINVS
FT                   NDYDLPQRVMKTAVTPIKASTTTMEFPWNLEPPTSQFYLFLHFAELQSLQANETREFNV
FT                   VLNGNVTFKSYSPKFLEMQTVYSTAPKQCDGGKCLLQLVKTSRSTLPPLINAMEAYTVL
FT                   DFPQIETNVDEVIAIKNIQSTYGLSKTTWQGDPCVPKKFLWDGLNCNNSDDSTPPIITS
FT                   LNLSSSGLTGIIVLTIQNLANLQELDLSNNNLSGGVPEFLADMKSLLVINLSGNNLSGV
FT                   VPQKLIEKKMLKLNIEGNPKLNCTVESCVNKDEEGGRQIKSMTIPIVASIGSVVAFTVA
FT                   LMIFCVVRKNNPSNDEAPTSCMLPADSRSSEPTIVTKNKKFTYAEVLTMTNNFQKILGK
FT                   GGFGIVYYGSVNGTEQVAVKMLSHSSAQGYKQFKAEVELLLRVHHKNLVGLVGYCEEGD
FT                   KLALIYEYMANGDLDEHMSGKRGGSILNWGTRLKIALEAAQGLEYLHNGCKPLMVHRDV
FT                   KTTNILLNEHFDTKLADFGLSRSFPIEGETHVSTVVAGTIGYLDPEYYRTNWLTEKSDV
FT                   YSFGVVLLVMITNQPVIDQNREKRHIAEWVGGMLTKGDIKSITDPNLLGDYNSGSVWKA
FT                   VELAMSCMNPSSMTRPTMSQVVFELKECLASESSREVSMTFGTEVAPMAR"
FT   repeat_region   complement(19191..19211)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(<20136..20208,20304..20829,21542..22020,22110..22254,
FT                   22339..22410,22505..22576,22670..22741,22833..23008,
FT                   23151..23338,23434..23564,23660..23718,23806..23995,
FT                   24131..>24539)
FT                   /gene="F19C24.2"
FT   CDS_pept        join(20136..20208,20304..20829,21542..22020,22110..22254,
FT                   22339..22410,22505..22576,22670..22741,22833..23008,
FT                   23151..23338,23434..23564,23660..23718,23806..23995,
FT                   24131..24539)
FT                   /codon_start=1
FT                   /gene="F19C24.2"
FT                   /product="receptor protein kinase, putative"
FT                   /db_xref="GOA:Q9C8I7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR024788"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8I7"
FT                   /protein_id="AAG50871.1"
FT                   /translation="MESHRVFVATFMLILHLVQAQDQPGFINVDCGLLPRDSPYNALGT
FT                   GLVYTSDVGLVSSGKTGKIAKEFEENNSTPNLTLRYFPDGARNCYNLNVSRDTNYMIKA
FT                   TFVYGNYDGHKDEPNFDLYLGPNLWATVSRSETVEEIIHVTKSDSLQVCLAKTGDFIPF
FT                   INILELRPLKKNVYVTESGSLKLLFRKYFSDSGQTIRYPDDIYDRVWHASFLENNWAQV
FT                   STTLGVNVTDNYDLSQDVMATGATPLNDSETLNITWNVEPPTTKVYSYMHFAELETLRA
FT                   NDTREFNVMLNGNDLFGPYSPIPLKTETETNLKPEECEDGACILQLVKTSKSTLPPLLN
FT                   AIEAFTVIDFLQVETDEDDAAAIKNVQNAYGLINRSSWQGDPCVPKQYSWDGLKCSYSD
FT                   STPPIINFLDLSASGLTGIIAPAIQNLTHLEILALSNNNLTGEVPEFLADLKSIMVIDL
FT                   RGNNLSGPVPASLLQKKGLMLHLDDNPHILCTTGSCMHKGEGEKKSIIVPVVASIVSLA
FT                   VIIGALILFLVFRKKKASKVEAIVTKNKRFTYSQVVIMTNNFQRILGKGGFGIVYHGFV
FT                   NGVEQVAVKILSHSSSQGYKQFKAEVELLLRVHHKNLVGLVGYCDEGENMALIYEYMAN
FT                   GDLKEHMSGKNRFILNWETRLKIVIDSAQGLEYLHNGCKPLMVHRDVKTTNILLNEHFE
FT                   AKLADFGLSRSFPIGGETHVSTVVAGTPGYLDPEYYKTNRLTEKSDVYSFGIVLLEMIT
FT                   NRPVIDQSREKPYISEWVGIMLTKGDIISIMDPSLNGDYDSGSVWKAVELAMSCLNPSS
FT                   TRRPTMSQVLIALNECLVSENSRGGASRDMDSKSSLEVSLTFDTDVSPMAR"
FT   repeat_region   complement(21075..21103)
FT                   /rpt_family="AT_rich"
FT   repeat_region   21131..21166
FT                   /rpt_family="(A)n"
FT   repeat_region   complement(21435..21481)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(24001..24041)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(25378..25398)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(25562..25865)
FT                   /rpt_family="ATLINE1A|ATLINE1A consensus."
FT   repeat_region   complement(27172..27218)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(27718..27777)
FT                   /rpt_family="AT_rich"
FT   mRNA            complement(join(<27893..28307,28411..28666,28756..28882,
FT                   28979..29402,29507..29587,29661..29732,29818..29889,
FT                   29994..30135,30209..30687,30767..31147,31219..31372,
FT                   31442..>31523))
FT                   /gene="F19C24.3"
FT   CDS_pept        complement(join(27893..28307,28411..28666,28756..28882,
FT                   28979..29402,29507..29587,29661..29732,29818..29889,
FT                   29994..30135,30209..30687,30767..31147,31219..31372,
FT                   31442..31523))
FT                   /codon_start=1
FT                   /gene="F19C24.3"
FT                   /product="receptor protein kinase, putative"
FT                   /db_xref="GOA:Q9C8I6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR024788"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C8I6"
FT                   /protein_id="AAG50874.1"
FT                   /translation="MAFSSCFLLVLLQIFSALLLCLAQDQSGFISLDCGSPRETSFREK
FT                   TTNITYISDANFINTGVGGSIKQGYRTQFQQQTWNLRSFPQGIRNCYTLNLTIGDEYLI
FT                   RANFLHGGYDDKPSTQFELYLGPNLWSTVTTTNETEASIFEMIHILTTDRLQICLVKTG
FT                   NATPFISALELRKLMNTTYLTRQGSLQTFIRADVGATVNQGYRYGIDVFDRVWTPYNFG
FT                   NWSQISTNQSVNINNDYQPPEIAMVTASVPTDPDAAMNISLVGVERTVQFYVFMHFAEI
FT                   QELKSNDTREFNIMYNNKHIYGPFRPLNFTTSSVFTPTEVVADANGQYIFSLQRTGNST
FT                   LPPLLNAMEIYSVNLLPQQETDRKEVDAMMNIKSAYGVNKIDWEGDPCVPLDYKWSGVN
FT                   CTYVDNETPKIISLDLSTSGLTGEILEFISDLTSLEVLDLSNNSLTGSVPEFLANMETL
FT                   KLINLSGNELNGSIPATLLDKERRGSITLSIEGNTGLCSSTSCATTKKKKKNTVIAPVA
FT                   ASLVSVFLIGAGIVTFLILKRKKRTKLGLNPNSGTGTTPLHSRSHHGFEPPVIAKNRKL
FT                   TYIDVVKITNNFERVLGRGGFGVVYYGVLNNEPVAVKMLTESTALGYKQFKAEVELLLR
FT                   VHHKDLTCLVGYCEEGDKMSLIYEFMANGDLKEHLSGKRGPSILTWEGRLRIAAESAQG
FT                   LEYLHNGCKPQIVHRDIKTTNILLNEKFQAKLADFGLSRSFPLGTETHVSTIVAGTPGY
FT                   LDPEYYRTNWLTEKSDVFSFGVVLLELVTNQPVIDMKREKSHIAEWVGLMLSRGDINSI
FT                   VDPKLQGDFDPNTIWKVVETAMTCLNPSSSRRPTMTQVVMDLKECLNMEMARNMGSRMT
FT                   DSTNDSSIELSMNFTTELNPGAR"
FT   repeat_region   complement(32408..32474)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(33003..33025)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(33252..33274)
FT                   /rpt_family="AT_rich"
FT   repeat_region   33731..33760
FT                   /rpt_family="(A)n"
FT   mRNA            join(<35155..35233,35337..36362,36443..36581,36655..36726,
FT                   36797..36871,36959..37027,37124..37299,37526..37746,
FT                   38032..38092,38189..38378,38460..>38868)
FT                   /gene="F19C24.24"
FT   CDS_pept        join(35155..35233,35337..36362,36443..36581,36655..36726,
FT                   36797..36871,36959..37027,37124..37299,37526..37746,
FT                   38032..38092,38189..38378,38460..38868)
FT                   /codon_start=1
FT                   /gene="F19C24.24"
FT                   /product="receptor protein kinase, putative"
FT                   /db_xref="GOA:Q9C8I5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024788"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8I5"
FT                   /protein_id="AAG50877.1"
FT                   /translation="MTSKAKALTFICCVALLNLAIAQDQSGFISIDCGLQPENSSYTET
FT                   STDIKYVSDSSYTDTGTSYFVAPENRQNMKQSMWSVRSFPEGIRNCYTIAVNSSTKYLI
FT                   RADFMYGNYDSRNEIPGFDLHLGPNKWDTVELVSPLQTVSKEIIYYVLTDTIQVCLVNT
FT                   GNGTPFISVLELRQLPNSSYAAQSESLQLFQRLDFGSTTNLTVRYPNDVFDRIWFPATP
FT                   NGTKPLSDPSTSLTSNSTGNFRLPQVVMRTGIVPDNPRGFVDFGWIPDDPSLEFFFYLY
FT                   FTELQQPNSGTVETREFVILLNGKSFGEPLSLNYFRTLALFTSNPLKAESFQFSLRQTQ
FT                   SSSLPPLINAMETYFVNKLPQSSTDPNDLSAMRNIKSAYKVKRNWEGDVCVPQAYTWEG
FT                   LNCSFNGTNMPRVIALNLSSAGLTGEITSDISRLSQLQILDLSNNNLSGPAVPAFLAQL
FT                   QFLRVLHLANNQLSGPIPSSLIERLDSFSGNPSICSANACEEVSQNRSKKNKLPSFVIP
FT                   LVASLAGLLLLFIISAAIFLILMRKKKQDYGGNETAVDAFDLEPSNRKFTYAEIVNITN
FT                   GFDRDQGKVGFGRNYLGKLDGKEVTVKLVSSLSSQGYKQLRAENSTTVFSWEDRLGIAV
FT                   DVAQGLEYLHTGCKPPIIHRNVKCTNVFLDESFNAKLGGFGLSRAFDAAEGSHLNTAIA
FT                   GTPGYVDPEYYTSNMLTEKSDVYSFGVVLLEIVTAKPAIIKNEERMHISQWVESLLSRE
FT                   NIVEILDPSLCGDYDPNSAFKTVEIAVACVCRNSGDRPGMSQVVTALKESLAVEVERKK
FT                   HLPVGSTDSLEELALGFGSNPPPRLR"
FT   mRNA            complement(join(<39140..39662,39740..39868,39949..40263,
FT                   40374..40499,40777..>41214))
FT                   /gene="F19C24.29"
FT   CDS_pept        complement(join(39273..39662,39740..39868,39949..40263,
FT                   40374..40499,40777..41124))
FT                   /codon_start=1
FT                   /gene="F19C24.29"
FT                   /product="auxin conjugate hydrolase (ILL5)"
FT                   /note="contains nonconsensus AT acceptor splice site at
FT                   exon 3"
FT                   /db_xref="GOA:Q9SWX9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SWX9"
FT                   /protein_id="AAG50869.1"
FT                   /translation="MSFCKLVSFVLILHLLNSCLISCSSNDLSQIPKNFLSLAKREDFF
FT                   DWMVGIRRRIHENPELGYEEVETSKLVKTELDKMGVSYKNPVAVTGVIGYVGTGHAPFV
FT                   ALRADMDALPIQEMVEWEHKSKIPGKMHACGHDAHTTMLLGAAKLLKEHQEELQGTVIL
FT                   VFQPAEEGGAGAKKIVEAGVLENVGAIFGLHVSNLLGLGQLSSREGLLMAGSGRFKATI
FT                   SGKGGHAALPQFAIDPVLAASNVILSLQHLVSREADPLDSQVVTVATFEGSDAFNVIPD
FT                   SVTIGGTFRALLPKSFEQLKQRIVQVITTQASVNMCNATVDFLEDETPPFPPTVNNKTL
FT                   HLFYKNVSVDMLGIENYVETLPVMVSEDFAFYQQAIPGHFSFVGMQNKSHSPMANPHSP
FT                   FFEVNEELLPYGASLLASLATRYLLDSSSSPNKDEL"
FT   repeat_region   complement(41786..41814)
FT                   /rpt_family="AT_rich"
FT   mRNA            complement(join(<42502..43182,43268..>43786))
FT                   /gene="F19C24.28"
FT   CDS_pept        complement(join(42502..43182,43268..43786))
FT                   /codon_start=1
FT                   /gene="F19C24.28"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9C8I4"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8I4"
FT                   /protein_id="AAG50880.1"
FT                   /translation="MEECVKENGSSTPKSRVTNQSRALLPLRLLQILLLFLVLTLGISV
FT                   VSIHMIKFLKIQRLDPVAPITLLSTYNHESVTLDSFIRPPSNVWHTMNDSELLWRASIE
FT                   PQRNGYPFRRVPKLAFMFLAKGPLPFAPLWEKFCKGHEGLYSIYVHSLPSYKSDFSRSS
FT                   VFYRRYIPSQAVAWGEMSMGEAERRLLANALLDISNEWFVLLSESCIPLRGFSFIYSYV
FT                   SESRYSFMGAADEEGPDGRGRYRTEMEPEITLSQWRKGSQWFEINRKLAVEIVQDTTYY
FT                   PKFKEFCRPPCYVDEHYFPTMLSMKHRVLLANRTLTWTDWSRGGAHPATFGKADVTESF
FT                   LKKLTGAKSCLYNDHQSQICYLFARKFAPSALEPLLQLAPKILELGSNISSTRHSWYLF
FT                   "
FT   mRNA            complement(join(<44080..44706,44787..44915,44994..45308,
FT                   45411..45536,45817..>46255))
FT                   /gene="F19C24.4"
FT   CDS_pept        complement(join(44302..44706,44787..44915,44994..45308,
FT                   45411..45536,45817..46164))
FT                   /codon_start=1
FT                   /gene="F19C24.4"
FT                   /product="IAA-Ala hydrolase (IAR3)"
FT                   /db_xref="GOA:O04373"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:O04373"
FT                   /protein_id="AAG50883.1"
FT                   /translation="MSFFKWVSFVLILHLLNPTLISCSSNGLSQIPSKFLTLAKRNDFF
FT                   DWMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVSYKYPVAVTGVVGYVGTGHAPFV
FT                   ALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEHEEELQGTVVL
FT                   VFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPMLAGSGFFKAKI
FT                   SGKGGHAALPQHTIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGGGAFNVIPD
FT                   SVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVNMCNATVDFIEEEKPFFPPTVNDKAL
FT                   HQFFKNVSGDMLGIENYVEMQPLMGSEDFSFYQQAIPGHFSFVGMQNKARSPMASPHSP
FT                   YFEVNEELLPYGASLHASMATRYLLELKASTLNKSNKKDEL"
FT   repeat_region   complement(46364..46402)
FT                   /rpt_family="(TAAAA)n"
FT   repeat_region   complement(46715..46742)
FT                   /rpt_family="AT_rich"
FT   repeat_region   47817..47841
FT                   /rpt_family="(GAAAA)n"
FT   mRNA            complement(<48577..>50466)
FT                   /gene="F19C24.27"
FT   CDS_pept        complement(48577..50466)
FT                   /codon_start=1
FT                   /gene="F19C24.27"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR026960"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8I3"
FT                   /protein_id="AAG50886.1"
FT                   /translation="MKIDISKAFDSLQWSFLINALSAMNFPGEFIHWISRCITTTSFSV
FT                   QVNGELAGYFRSARGIRQGCALSPYLFVISMEVLSKMLDQAAGGKRFGFHPKCKNLGLT
FT                   HLCFADDLMILTDGKVRSVDGIVEVMNLFAKRSGLQINMEKTTLYTAGVSDHNRYMMIS
FT                   RYPFGLGQLPVRYLGLPLVTKRLTKEDLSPLFEQIRNRIGTWTSRYLSFAGRLNLISSV
FT                   LWSTMNFWMSAFRLPSACLKEINSICSAFLWSGPELHRRKAKVSWDDICKPKQEGGLGL
FT                   RSLTEANVVSVLKLIWRVTSNDDSLWVKWSKMNLLKQESFWSLTPNSSLGSWMWKKMLK
FT                   YRETAKPFSRVEVNNGARTSFWFDNWSGMGHLMDVTGQRGQIDLGISRNKTVAEAWSNR
FT                   RRRKHRTEQLNDIEAALNQKYQTRNLLREDATLWRGKGDVFKTSFSTKDTWNQVRKKSN
FT                   EVAWYKGVWFSHSTPKYQFCTWLALRNRLSTGYRMQLWNNGSDVKCTFCSTSIETRDHL
FT                   FFSCSYASAIWTAIAKNVLQHRFSTDWQTIVNYISETQTDRIRSFLSRYIFQLTVHTVW
FT                   KERNDRRHGEEPRTSANLISWMDKQIRNQLSIIISTGDRRYENGLQVWFSTRL"
FT   repeat_region   complement(49537..49953)
FT                   /rpt_family="ATLINEIII|ATLINEIII ATLINEIII, non-LTR
FT                   retrotransposon - a consensus."
FT   mRNA            complement(join(<51247..52004,52410..53368,53481..53665,
FT                   55115..55246,55331..55576,55683..55826,56132..56236,
FT                   56340..56423,56587..>56664))
FT                   /gene="F19C24.5"
FT   CDS_pept        complement(join(51247..52004,52410..53368,53481..53665,
FT                   55115..55246,55331..55576,55683..55826,56132..56236,
FT                   56340..56423,56587..56664))
FT                   /codon_start=1
FT                   /gene="F19C24.5"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:P59277"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR019529"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59277"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59278"
FT                   /protein_id="AAG50888.1"
FT                   /translation="MSRFRDRTEDFKDSVRNSAVSIGYNESKVASTMASFIIHKPKERS
FT                   PFTKAAFKTLDSIKELELFMLKHRKDYVDLHRTTEQEKDSIEQEVAAFIKACKEQIDIL
FT                   INSIRNEEANSKGWLGLPADNFNADSIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDI
FT                   INRAMPRRKPKRVIKEATPINTTLGNSESIEPDEIQAQPRRLQQQQLLDDETQALQVEL
FT                   SNLLDGARQTETKMVEMSALNHLMATHVLQQAQQIEFLYDQSNDDRNLEAINASVGRLV
FT                   WVRRRNGSWWPGQTLVHDQVPDNSLVGPKVGTPIKLLGRDDVSVDWYILENSKTVKAFR
FT                   CGEYDTCIEKAKASSSKKRSGKCTLREDAINNALKIENEHLAKEDDNLCNLSGEEDSKR
FT                   CLSGKEDEDSGSSDAEETEDDELASAPEQLQSSISSQEMNNVGASKVQSKRRRTPNDSE
FT                   DDGTEGVKRMRGLEDIGKEQAGGIVEHKQDLDLICAVGLSDSVSNGNTIANGNKVCSPS
FT                   SLKRNVSECSKRKNRRRQLTKVLESTAMVSVPVTCDQGVSLDCQGIYDSKVSGMESVES
FT                   MKSVSVVINNNSDSTGVSCEDAYENVVGASHNNKAKDSEISSISVSAEDDSSDRLFDVP
FT                   LTGEENHSEGFPAACRISSPRKALVTDLTRRCGRNSHNVFVKNEASNGSACTSPPASEP
FT                   VNCILSGIEKNTSKWQLKGKRNSRQMSKKQEERRNVYGEEANNNSSTPHSTLYEVKIEV
FT                   KASYTKPRVPLVSRMSELSGKAIVGHPLSVEILEEDYSNGMVMPPVVAKAKSLPKKNGK
FT                   KKKSRGFSWNSKKKSSSLSVKTRRLSTLTSQRLTERSKKQTTEKAKETVVACIPLKVVF
FT                   SRINEVLKGSARQTQHRALPSAAKT"
FT   repeat_region   54121..54201
FT                   /rpt_family="(GA)n"
FT   repeat_region   56783..56878
FT                   /rpt_family="(GAGAA)n"
FT   mRNA            join(56962..57095,57264..57329,57414..57481,57600..57633,
FT                   57721..57790,57871..57928,58056..58184,58307..58398,
FT                   58507..58585,58672..58753,58842..59106)
FT                   /gene="F19C24.6"
FT   CDS_pept        join(57089..57095,57264..57329,57414..57481,57600..57633,
FT                   57721..57790,57871..57928,58056..58184,58307..58398,
FT                   58507..58585,58672..58753,58842..58915)
FT                   /codon_start=1
FT                   /gene="F19C24.6"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q9C8I1"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR040213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8I1"
FT                   /protein_id="AAG50865.1"
FT                   /translation="MTEYKQEQEMEIEALEAILMDEFKEIHSSESGLNTSNRCFQITVT
FT                   PQDDELEELAIPPVQLALVFSHTENYPDEAPLLDVKSIRGIHVSDLTILKEKLEQEASE
FT                   NLGMAMIYTLVSSAKDWLSEHYGQDDAAEFAEVEAAKEDEVIVPHGEPVTLETFLAWRE
FT                   RYEAELALERAKLMPESALTAPKEKKLTGRQWFESGRGRGTVVIADEEDEEEDEEDIDF
FT                   EDEDFEDDEEDMLEHYLAEKSDSSAPPTRT"
FT   mRNA            complement(join(<59225..59505,59635..59708,59797..59877,
FT                   60150..60241,60357..60514,60597..60687,61076..61161,
FT                   61393..61448,61539..61610,61938..62024,62098..62157,
FT                   62238..62324,62482..62683,62771..62900,63425..>63947))
FT                   /gene="F19C24.7"
FT   CDS_pept        complement(join(59430..59505,59635..59708,59797..59877,
FT                   60150..60241,60357..60514,60597..60687,61076..61161,
FT                   61393..61448,61539..61610,61938..62024,62098..62157,
FT                   62238..62324,62482..62683,62771..62900,63425..63947))
FT                   /codon_start=1
FT                   /gene="F19C24.7"
FT                   /product="NADP-specific glutatamate dehydrogenase,
FT                   putative"
FT                   /db_xref="GOA:Q9C8I0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8I0"
FT                   /protein_id="AAG50868.1"
FT                   /translation="MDDMNLIQQAQRHQLVVSNLGEEIDLEIGPGEDDAAFANNSLIGG
FT                   PPREPSTGEHDETKHMVLVSDLPSEDQDISKGTPAKRKKKVVKRWREEWADTYKWAYVD
FT                   MKDGTARIFCSICREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQTASKD
FT                   KIVVDKPIYVKTVMSKSAGSIVEGALKRDPNEIEFVQSVQESVHALERVIAKNSHYVNI
FT                   MERLLEPERMIVFRVPWIDDRGETHVNRGFRVQFNQALGPCRGGIRFHPSMNLSIAKFL
FT                   GFQQTLKNALSPYKLGGASGGSDFDPKGKSDNEIMRFCQSFMNEMYRYMGPDKDLPSEE
FT                   VGVGTREMGYLFGQYRRLAGQFQGSFTGPRIYWAASSLRTEASGYGVVYFARLILADMN
FT                   KEIKGLRCVVSGCGKIAMHVVEKLIACGAHPVTVSDSKGYLVDDDGFDYMKLAFLRDIK
FT                   SQQRSLRDYSKTYARAKYFDELKPWNERCDVAFPCASQNEVDQADAINLVNAGCRLLVE
FT                   GSNMPCTAEAVDVFRKANVLIAPAIAAGAGGVAAGEIEVLRESNSMQWSAEDFESRLQE
FT                   ALKQTYEKALKAANDFGYQKESPEALLHGATIAAFLNIAQAMTDQGCV"
FT   repeat_region   complement(61510..61532)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(65141..65218)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(65303..65334)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(65399..65442)
FT                   /rpt_family="(TA)n"
FT   repeat_region   complement(65501..65525)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(<65833..65842,66103..66248,66367..66402,66506..66613,
FT                   66838..66938,67043..67136,67521..67580,67668..67786,
FT                   68002..68058,68238..68346,68501..68589,68775..68844,
FT                   68935..69015,69092..69184,69265..69313,69498..69617,
FT                   69693..69767,69867..>69922)
FT                   /gene="F19C24.8"
FT   CDS_pept        join(65833..65842,66103..66248,66367..66402,66506..66613,
FT                   66838..66938,67043..67136,67521..67580,67668..67786,
FT                   68002..68058,68238..68346,68501..68589,68775..68844,
FT                   68935..69015,69092..69184,69265..69313,69498..69617,
FT                   69693..69767,69867..69922)
FT                   /codon_start=1
FT                   /gene="F19C24.8"
FT                   /product="tRNA-guaninine transglycosylase, putative"
FT                   /db_xref="GOA:Q949Y0"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q949Y0"
FT                   /protein_id="AAG50872.1"
FT                   /translation="MPTVSVKWQKKVLDGIEIDVSLPPYVFKAQLYDLTGVPPERQKIM
FT                   VKGGLLKDDGDWAAIGVKDGQKLMMMGTADEIVKAPEKAIVFAEDLPEEALATNLGYSA
FT                   GLVNLGNTCYMNSTVQCLKSVPELKSALSNYSLAARSNDVDQTSHMLTVATRELFGELD
FT                   RSVLRKKYPQFSQLQNGMHMQQDAEECWTQLLYTLSQSLKAPTSSEGADAVKALFGVNL
FT                   QSRIKLGVLDNVTDSTVISKCTLHCQESGEESSETESVYSLKCHISHEVNHLHEGLKHG
FT                   LKGELEKTSPALGRTALYVKESLIDSLPRYLTVQFVRFFWKRESNQKAKILRKVDYPLV
FT                   LDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAKSGSKDSDVKMTDAEASANGSGE
FT                   SSTVNPQEGTSSEKETHMTGIYDLVAVLTHKGRSADSGHYVAWVKQESGKWIQYDDDNP
FT                   SMQREEDITKLSGGGDWHMAYITMYKARFVSM"
FT   repeat_region   complement(68445..68466)
FT                   /rpt_family="AT_rich"
FT   mRNA            complement(<70877..>71461)
FT                   /gene="F19C24.9"
FT   CDS_pept        complement(70877..71461)
FT                   /codon_start=1
FT                   /gene="F19C24.9"
FT                   /product="dof zinc finger protein"
FT                   /db_xref="GOA:O82155"
FT                   /db_xref="InterPro:IPR003851"
FT                   /db_xref="UniProtKB/Swiss-Prot:O82155"
FT                   /protein_id="AAG50875.1"
FT                   /translation="MQDLTSAAAYYHQSMMMTTAKQNQPELPEQEQLKCPRCDSPNTKF
FT                   CYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRKSNKRSGSSPSSNLKNQTVAE
FT                   KPDHHGSGSEEKEERVSGQEMNPTRMLYGLPVGDPNGASFSSLLASNMQMGGLVYESGS
FT                   RWLPGMDLGLGSVRRSDDTWTDLAMNRMEKN"
FT   repeat_region   complement(71768..71893)
FT                   /rpt_family="(TAAAAA)n"
FT   repeat_region   71921..72371
FT                   /rpt_family="ATR1|ATR1 An AT-rich repetitive sequence (a
FT                   consensus)."
FT   repeat_region   71925..72746
FT                   /rpt_family="ATREP3|ATREP3 a consensus."
FT   repeat_region   complement(72003..72171)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(72392..72442)
FT                   /rpt_family="AT_rich"
FT   repeat_region   72497..72617
FT                   /rpt_family="ATREP5|ATREP5 An AT-rich repetitive sequence -
FT                   a consensus."
FT   repeat_region   complement(72654..72691)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(72901..72969)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(73085..73120)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(73601..73635)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(74119..74162)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(74203..74233)
FT                   /rpt_family="AT_rich"
FT   mRNA            complement(join(<75373..75889,75979..76046,76134..76211,
FT                   76310..76401,76485..76553,76670..76793,77084..77207,
FT                   77321..77439,77675..77766,78162..78365,78603..78722,
FT                   78809..78904,78994..79097,79398..>79696))
FT                   /gene="F19C24.10"
FT   CDS_pept        complement(join(75753..75889,75979..76046,76134..76211,
FT                   76310..76401,76485..76553,76670..76793,77084..77207,
FT                   77321..77439,77675..77766,78162..78365,78603..78722,
FT                   78809..78904,78994..79097,79398..79509))
FT                   /codon_start=1
FT                   /gene="F19C24.10"
FT                   /product="55 kDa B regulatory subunit of phosphatase 2A"
FT                   /db_xref="GOA:Q38821"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38821"
FT                   /protein_id="AAG50878.1"
FT                   /translation="MNGGDEVVAASADPSLPLEWRFSQVFGERSAGEEVQEVDIISAIE
FT                   FDNSGNHLATGDRGGRVVLFERTDTNNSSGTRRELEEADYPLRHPEFRYKTEFQSHDPE
FT                   FDYLKSLEIEEKINKIRWCQTANGALFLLSTNDKTIKFWKVQDKKIKKICDMNSDPSRT
FT                   VGNGTVASSSNSNITNSCLVNGGVSEVNNSLCNDFSLPAGGISSLRLPVVTSHESSPVA
FT                   RCRRVYAHAHDYHINSISNNSDGETFISADDLRINLWNLEISNQSFNIVDVKPAKMEDL
FT                   SEVITSAEFHPTHCNMLAYSSSKGSIRLIDLRQSALCDSHSKLFEEPEQAGPKSFFTEI
FT                   IASVSDIKFAKEGRYLLSRDYMTLKLWDINMDAGPVATFQVHEYLKPKLCDLYENDSIF
FT                   DKFECCISGNGLRAATGSYSNLFRVFGVAPGSTETATLEASRNPMRRHVPIPSRPSRAL
FT                   SSITRVVSRGSESPGVDGNTNALDYTTKLLHLAWHPNENSIACAAANSLYMYYA"
FT   repeat_region   complement(79511..79542)
FT                   /rpt_family="(GA)n"
FT   repeat_region   complement(79775..79837)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(80239..80302)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(83838..83881)
FT                   /rpt_family="AT_rich"
FT   mRNA            join(84258..85318,85664..86076,86408..86510,86607..86949)
FT                   /gene="F19C24.11"
FT   CDS_pept        join(84263..85318,85664..86076,86408..86510,86607..86720)
FT                   /codon_start=1
FT                   /gene="F19C24.11"
FT                   /product="4-coumarate:CoA ligase 1"
FT                   /db_xref="GOA:Q42524"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="PDB:3TSY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q42524"
FT                   /protein_id="AAG50881.1"
FT                   /translation="MAPQEQAVSQVMEKQSNNNNSDVIFRSKLPDIYIPNHLSLHDYIF
FT                   QNISEFATKPCLINGPTGHVYTYSDVHVISRQIAANFHKLGVNQNDVVMLLLPNCPEFV
FT                   LSFLAASFRGATATAANPFFTPAEIAKQAKASNTKLIITEARYVDKIKPLQNDDGVVIV
FT                   CIDDNESVPIPEGCLRFTELTQSTTEASEVIDSVEISPDDVVALPYSSGTTGLPKGVML
FT                   THKGLVTSVAQQVDGENPNLYFHSDDVILCVLPMFHIYALNSIMLCGLRVGAAILIMPK
FT                   FEINLLLELIQRCKVTVAPMVPPIVLAIAKSSETEKYDLSSIRVVKSGAAPLGKELEDA
FT                   VNAKFPNAKLGQGYGMTEAGPVLAMSLGFAKEPFPVKSGACGTVVRNAEMKIVDPDTGD
FT                   SLSRNQPGEICIRGHQIMKGYLNNPAATAETIDKDGWLHTGDIGLIDDDDELFIVDRLK
FT                   ELIKYKGFQVAPAELEALLIGHPDITDVAVVAMKEEAAGEVPVAFVVKSKDSELSEDDV
FT                   KQFVSKQVVFYKRINKVFFTESIPKAPSGKILRKDLRAKLANGL"
FT   repeat_region   complement(85532..85571)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(86821..86856)
FT                   /rpt_family="(CAA)n"
FT   mRNA            complement(join(<87161..87416,87524..87927,88498..>88585))
FT                   /gene="F19C24.12"
FT   CDS_pept        complement(join(87213..87416,87524..87927,88498..88585))
FT                   /codon_start=1
FT                   /gene="F19C24.12"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q8RY97"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RY97"
FT                   /protein_id="AAG50884.1"
FT                   /translation="MALPPYDPNFTLAFSYGRRDNVFENDPEHDESASAAIVAVELISS
FT                   ARLALKLDSVRTEYSAQYLVDKAGSRNLRRRRKLTVKDCLNFALKKGGIPRAEDWPPLG
FT                   SESKTPSSYEPALVSMKGEVIEPKDMDEVPELLVHQSAVGAKLHVFTPHIELQQDVSAI
FT                   AYARYVGLRDGIVVGTEKIQGKSMAIVKVWYKKKFVVVKVALSRMFYLAGVGPSVLLVD
FT                   FCVPRLSID"
FT   mRNA            complement(<89797..>91404)
FT                   /gene="F19C24.26"
FT   CDS_pept        complement(90052..91152)
FT                   /codon_start=1
FT                   /gene="F19C24.26"
FT                   /product="MAP kinase kinase 4 (ATMKK4)"
FT                   /db_xref="GOA:O80397"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80397"
FT                   /protein_id="AAG50863.1"
FT                   /translation="MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTS
FT                   GGSGGSSGSAPSSGGSASSTNTNSSIEAKNYSDLVRGNRIGSGAGGTVYKVIHRPSSRL
FT                   YALKVIYGNHEETVRRQICREIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLE
FT                   GAHVWKEQQLADLSRQILSGLAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILA
FT                   QTMDPCNSSVGTIAYMSPERINTDLNQGKYDGYAGDIWSLGVSILEFYLGRFPFPVSRQ
FT                   GDWASLMCAICMSQPPEAPATASPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPS
FT                   QNRSPQNLHQLLPPPRPLSSSSSPTT"
FT   mRNA            complement(join(<91868..92114,92864..>93092))
FT                   /gene="F19C24.25"
FT   CDS_pept        complement(join(92086..92114,92864..93047))
FT                   /codon_start=1
FT                   /gene="F19C24.25"
FT                   /product="epsilon subunit of mitochondrial F1-ATPase"
FT                   /db_xref="GOA:Q96253"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="InterPro:IPR036742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96253"
FT                   /protein_id="AAG50890.1"
FT                   /translation="MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREK
FT                   VHFSLSKWADGKPQKPVLRSDTPEV"
FT   repeat_region   complement(93252..93306)
FT                   /rpt_family="(A)n"
FT   mRNA            <93883..>95865
FT                   /gene="F19C24.13"
FT   CDS_pept        93883..95865
FT                   /codon_start=1
FT                   /gene="F19C24.13"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9C8H6"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8H6"
FT                   /protein_id="AAG50889.1"
FT                   /translation="MAESKRLERLKAMRSLLKSEMEKSETFSLVLNKTGSKIEEINHKL
FT                   SSLEADLKVERWKASPFSDHIRHTIAPISAVLRVFATVQELERSLVSSDGVLGYVSDVK
FT                   RLGEAMKLLSSSCVLALNWLEDTIEYLTEKGMPEDHPCGLRFKTSIELLRELQMTESRA
FT                   YLKGGILYTALKNLETEFKRILQEKPVFSEDNLRKLQAIIKRLHAHTRLTSCVPVYIKV
FT                   RTKVIQKRFEISYLEKTITEADNVHDIEGDIDQWRLHMEIAVKEIYEFESKLCYDVFED
FT                   IGEDVPLRCFGEIASNSVILQLLRFGSRISKCKREPPKLIKLLDCFSTMDNFRIEFNRL
FT                   FRGEQCSEIRRVTRELISNLVKGVSEIFWELPCQVELQRPNCPPLDGGVPKLVSVVTEY
FT                   CNKLLGNNNKPILSKVLEIDLGWKNAKYQEELLTGHIYNILREIALNLDAWSSSNKETA
FT                   LSCIFMMNNHSHFCGLRETYLGEMMGESWLNAHEQYRDYYAALYVKESWGHLLSLLTNK
FT                   AQTTSSSSSSSSESSPVKGKRARESIKRTLQAFCKGFDEIYTKQSNWVVEDDKLVWKIC
FT                   QAMVKTVVPRYKSYLQSYIKLLVEEDPTSDSKHLYYTPKGLEMKLKTMFQKKEETEKRD
FT                   KDSHFVNKVMDLEITQNSRSTLEAI"
FT   repeat_region   95446..95477
FT                   /rpt_family="(CAT)n"
FT   repeat_region   complement(96637..96688)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(96715..96756)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(96783..96811)
FT                   /rpt_family="(TA)n"
FT   repeat_region   complement(97423..97451)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(97521..97576)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(97650..97810)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(99215..99358)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(99493..99529)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(100766..100807)
FT                   /rpt_family="AT_rich"
FT   repeat_region   101618..101645
FT                   /rpt_family="(GAA)n"
FT   mRNA            join(<101645..101746,101907..101939,102044..102197,
FT                   102275..102345,102469..102554,102650..103724)
FT                   /gene="F19C24.14"
FT   CDS_pept        join(101645..101746,101907..101939,102044..102197,
FT                   102275..102345,102469..102554,102650..103586)
FT                   /codon_start=1
FT                   /gene="F19C24.14"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q0WPA5"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="InterPro:IPR024709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WPA5"
FT                   /protein_id="AAG50891.1"
FT                   /translation="MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQVQTLERMIDSA
FT                   EKVQGDAHDIEFHGSKVAVEDGLVRAFEAGTKGPWMEDSHELKPCWSISQSDEAVSSKG
FT                   YVTFSLTNGPEYHVSQITDAVMVAKHLGATLVLPDIRGSKPGDEMKFEDIYDVDKLIKT
FT                   LESVVKVVRKLPSHVSLRDIAIVKVPTRVAEDYIKEHIDPIFKSKGNIRVTTYFPSVNL
FT                   RKSSQGAETDPVSCLAMFGSLELQPAVNELVESMIQRLKTHSKKSGGRFIAIDLRVEIL
FT                   EKKNCHETGAVGSKTCYNAQEIALFLRKLGFDSDTTIYLTQPRWESSLNILKDIFPKTY
FT                   TKVRKTLHYLVSEVFTHLLILTFFCKWQEAIMPSDKKTKYLELENSEYENVIDFYISSR
FT                   SDVFVPAIPGLFYANTVGKRIALGKPQVLVPAEISGTSGLPANYISPYISKKNHLAYSC
FT                   FC"
FT   mRNA            complement(join(<104089..104446,104526..104718,
FT                   104795..104857,104948..105074,105144..105364,
FT                   105461..>105509))
FT                   /gene="F19C24.15"
FT   CDS_pept        complement(join(104089..104446,104526..104718,
FT                   104795..104857,104948..105074,105144..105364,
FT                   105461..105509))
FT                   /codon_start=1
FT                   /gene="F19C24.15"
FT                   /product="protein kinase, putative"
FT                   /db_xref="GOA:Q9C8H4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8H4"
FT                   /protein_id="AAG50866.1"
FT                   /translation="MTEATGLRRFFSKFICCDADDSTIEYEPYVYIPANSYSYAEVTKI
FT                   TNKFNRVHGKGGFGVVYRGVLNKQQVAVKMLNRASIYNIVQFTKEVHDFVKVRHKNLVS
FT                   LIGYCDDGEHLALIYEFVANGDLNDQLSGKFGNVPSWETRLKIIIGVAQGLEYLHSELR
FT                   ILHRYVKPTNILLGENFEAKLADFGLSRSSPTNPDIQASNKIYVKPGRDPYLHHQYFNS
FT                   NRLNQTSDIYSFGIVMLEMITNQPVVDNKRESPHISKWVDLKVAKGDTLEIVDLRLNND
FT                   FERDSVRKAMDIACSCAARAHNRPSMSQVVIELNECLALEMARSNGRTGETTQTQ"
FT   mRNA            complement(join(<106106..106236,106314..106374,
FT                   106505..106572,106739..106811,107081..107200,
FT                   107335..107453,107570..107627,107743..107857,
FT                   107955..108010,108112..108244,108649..108703,
FT                   108820..>109102))
FT                   /gene="F19C24.16"
FT   CDS_pept        complement(join(106106..106236,106314..106374,
FT                   106505..106572,106739..106811,107081..107200,
FT                   107335..107453,107570..107627,107743..107857,
FT                   107955..108010,108112..108244,108649..108703,
FT                   108820..109102))
FT                   /codon_start=1
FT                   /gene="F19C24.16"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q8H1G3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1G3"
FT                   /protein_id="AAG50870.1"
FT                   /translation="MQSSHRILSRLLHSPRKGYIRASVGGSVHFLALFDEKDNGFVDTT
FT                   HRSFSSLIRSSSHVRGLISTNCLNKGLGVRCSVSLDRETPLIDTYSSHRNFFTRAKQVK
FT                   RIEINDQHSQRAVTTALWCNFLVFSLKFGVWWTSSSHVIMAEVVHSVADFANQALLAYG
FT                   LSSSRRAPDALHPYGYSKERFVWSLISAVGIFCLGSGATIVNGVQNLWTSSPPPNMELA
FT                   AVVIGGSFLIEGASLLVAIQSVKKGAAQEGMTIRDYIWRGHDPTSVAVMTEDGAAVAGL
FT                   AIAAASLVAVRMTGNPIYDPIGSIVVGNLLGMVVDSLYDCKSEVIGPGSFRFKAEIDFN
FT                   GQMVVQNYLKRTGREEWAKMFREAAKNGDDSAMLNIMSNYGEEVVTALGSEVDRLEKEI
FT                   QELVPGIQHVDIEAHNPTPTDPSL"
FT   repeat_region   complement(109370..109417)
FT                   /rpt_family="(A)n"
FT   repeat_region   complement(109695..109716)
FT                   /rpt_family="AT_rich"
FT   repeat_region   complement(109870..109891)
FT                   /rpt_family="(A)n"
FT   mRNA            complement(join(<110475..110543,110640..110708,
FT                   111288..111423,111517..111648,111757..111851,
FT                   111980..112072,112246..>112551))
FT                   /gene="F19C24.17"
FT   CDS_pept        complement(join(110475..110543,110640..110708,
FT                   111288..111423,111517..111648,111757..111851,
FT                   111980..112072,112246..112551))
FT                   /codon_start=1
FT                   /gene="F19C24.17"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q8H1G0"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR010399"
FT                   /db_xref="InterPro:IPR010402"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1G0"
FT                   /protein_id="AAG50873.1"
FT                   /translation="MDDLHGSNARMHIREAQDPMHVQFEHHALHHIHNGSGMVDDQADD
FT                   GNAGGMSEGVETDIPSHPGNVTDNRGEVVDRGSEQGDQLTLSFQGQVYVFDSVLPEKVQ
FT                   AVLLLLGGRELPQAAPPGLGSPHQNNRVSRLASLVRFREKRKGRNFDKKIRYTVRKEVA
FT                   LRMQRNKGQFTSAKSNNDEAASAGSSWGSNQTWAIESSEAQHQEISNFRSCFCFQPNVA
FT                   SDLVIKLNHPNVEMIGLLSILDVVFGFRNVVEGAFRDLSKASPQTAQNLPLNKNEDANL
FT                   ETDHQIMITVANDISNSQ"
FT   mRNA            join(<113595..113753,114088..114135,114216..114377,
FT                   114637..114749,114870..114935,115076..115250,
FT                   115791..115880,116023..116147,116241..116306,
FT                   116401..116509,116581..116679,116758..116838,
FT                   116919..117089,117194..>117412)
FT                   /gene="F19C24.18"
FT   CDS_pept        join(113595..113753,114088..114135,114216..114377,
FT                   114637..114749,114870..114935,115076..115250,
FT                   115791..115880,116023..116147,116241..116306,
FT                   116401..116509,116581..116679,116758..116838,
FT                   116919..117089,117194..117412)
FT                   /codon_start=1
FT                   /gene="F19C24.18"
FT                   /product="mannosyl-oligosaccharide alpha-1,2-mannosidase,
FT                   putative"
FT                   /db_xref="GOA:Q9C512"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR036026"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C512"
FT                   /protein_id="AAG50876.1"
FT                   /translation="MARSRSISGYGIWKYLNPAYYLRRPRRLALLFIVFVSVSMLVWDR
FT                   INLAREHEVEVFKLNEEVSRLEQMLEELNGGVGNKPLKTLKDAPEDPVDKQRRQKVKEA
FT                   MIHAWSSYEKYAWGKDELQPRTKDGTDSFGGLGATMVDSLDTLYIMGLDEQFQKAREWV
FT                   ASSLDFDKDYDASMFETTIRVVGGLLSAYDLSGDKMFLEKAKDIADRLLPAWNTPTGIP
FT                   YNIINLRNGNAHNPSWAAGGDSILADSGTEQLEFIALSQRTGDPKYQQKVEKVITELNK
FT                   NFPADGLLPIYINPDNANPSYSTTTFGAMGDSFYEYLLKVWVQGNKTSAVKPYRDMWEK
FT                   SMKGLLSLVKKSTPSSFTYICEKNGNNLIDKMDELACFAPGMLALGASGYGPDEEKKFL
FT                   SLAGELAWTCYNFYQSTPTKLAGENYFFTAGQDMSVGTSWNILRPETVESLFYLWRLTG
FT                   NKTYQEWGWNIFQAFEKNSRVESGYVGLKDVNTGAKDNKMQSFFLAETLKYLYLLFSPS
FT                   SVISLDEWVFNTEAHPLKIVARNDPRKPTIALRQRKFGHQINV"
FT   mRNA            complement(join(<117625..117762,117843..117948,
FT                   118074..118156,118241..118326,118418..118631,
FT                   118720..118971,119048..119431,119513..>120115))
FT                   /gene="F19C24.19"
FT   CDS_pept        complement(join(117625..117762,117843..117948,
FT                   118074..118156,118241..118326,118418..118631,
FT                   118720..118971,119048..119431,119513..120115))
FT                   /codon_start=1
FT                   /gene="F19C24.19"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9C553"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C553"
FT                   /protein_id="AAG50879.1"
FT                   /translation="MEFSTSKRPATTATAAESVHFRLLCPATRTGAIIGKGGSVIRHLQ
FT                   SVTGSKIRVIDDIPVPSEERVVLIIAPSGKKKDESNVCDSENPGSEEPKQEKGSECAGT
FT                   SGGDDEEAPSSAQMALLRVFERIVFGDDAATVDGDELDKGESEGLCRMIVRGNQVDYLM
FT                   SKGGKMIQKIREDSGAIVRISSTDQIPPCAFPGDVVIQMNGKFSSVKKALLLVTNCLQE
FT                   SGAPPTWDECPFPQPGYPPEYHSMEYHPQWDHPPPNPMPEDVGPFNRPVVEEEVAFRLL
FT                   CPADKVGSLIGKGGAVVRALQNESGASIKVSDPTHDSEERIIVISARENLERRHSLAQD
FT                   GVMRVHNRIVEIGFEPSAAVVARLLVHSPYIGRLLGKGGHLISEMRRATGASIRVFAKD
FT                   QATKYESQHDEIVQVIGNLKTVQDALFQILCRLREAMFPGRLPFQGMGGPPPPFMGPYP
FT                   EPPPPFGPRQYPASPDRYHSPVGPFHERHCHGPGFDRPPGPGFDRPPSPMSWTPQPGID
FT                   GHPGGMVPPDVNHGFALRNEPIGSENPVMTSANVEIVIPQAYLGHVYGENCSNLNYIKQ
FT                   VSGANVVVHDPKAGTTEGLVVVSGTSDQAHFAQSLLHAFILCGQS"
FT   repeat_region   120697..120756
FT                   /rpt_family="(A)n"
FT   mRNA            <121039..123552
FT                   /gene="F19C24.20"
FT   CDS_pept        121039..123369
FT                   /codon_start=1
FT                   /gene="F19C24.20"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q9C8H3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C8H3"
FT                   /protein_id="AAG50882.1"
FT                   /translation="MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRV
FT                   VKAKELPGKDLTGSCDPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEA
FT                   TVKDKDLVKDDLIGRVVFDLNEIPKRVPPDSPLAPQWYRLEDGKGQKVKGELMLAVWFG
FT                   TQADEAFPEAWHSDAATVSGTDALANIRSKVYLSPKLWYLRVNVIEAQDLIPSDKGRYP
FT                   EVFVKVIMGNQALRTRVSQSRSINPMWNEDLMFVVAEPFEEPLILSVEDRVAPNKDEVL
FT                   GRCAVPLQYLDKRFDYRPVNSRWFNLEKHVIMEGGEKKEIKFASKIHMRICLEGGYHVL
FT                   DESTHYSSDLRPTAKQLWKPNIGVLELGVLNATGLMPMKAKEGGRGTTDAYCVAKYGQK
FT                   WIRTRTIIDSFTPRWNEQYTWEVFDPCTVVTVGVFDNCHLHGGDKNNGGGKDSRIGKVR
FT                   IRLSTLEADRVYTHSYPLLVLHPSGVKKMGEIHLAVRFTCSSLLNMMYMYSMPLLPKMH
FT                   YLHPLTVSQLDNLRHQATQIVSTRLTRAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFR
FT                   IMGVLSGIIAVGKWFEQICVWKNPITTVLIHILFIILVIYPELILPTIFLYLFLIGVWY
FT                   YRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRSIAGRIQTV
FT                   VGDLATQGERFQSLLSWRDPRATALFVLFCLIAAVILYITPFQVVAFAIGLYVLRHPRL
FT                   RYKLPSVPLNFFRRLPARTDCML"
FT   repeat_region   complement(123575..123596)
FT                   /rpt_family="(GA)n"
FT   mRNA            join(<123868..124140,124280..>124477)
FT                   /gene="F19C24.21"
FT   CDS_pept        join(123868..124140,124280..>124477)
FT                   /codon_start=1
FT                   /gene="F19C24.21"
FT                   /product="unknown protein, 3' partial"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C8H2"
FT                   /protein_id="AAG50885.1"
FT                   /translation="MDAAIFTSVYVCNIPKTKKAFFNPNPPALSSSSCWLCNSQAKQII
FT                   KLRIREGSNQGLLRVHALFNNEEASSESEDKNGFGLLPADIFSLPQEKFGSNVSGEKDS
FT                   ENIIDVETSLAVPHGGGTRAGLFRTPISGGVQSATSAHGLPRPALAVRNLMEQ"
XX
SQ   Sequence 124511 BP; 40823 A; 22452 C; 21782 G; 39454 T; 0 other;
     gaattcaatg tgacgttgaa tggggagtat acaattggac cttatagtcc taaaccgcta        60
     aaaaccgaaa ccatacaaga cttaagcccc gagcaatgta atggaggggc gtgtattttg       120
     cagcttgtgg agacgctgaa atcaactctt ccgcctttac ttaatgctat tgaggctttc       180
     actgtgattg atttcccgca aatggagaca aatgaagatg atggtatgtc ttttttacat       240
     cattgagctt atctaacaag tccttgtgtt ttatgttttt tttttatata tcattaagct       300
     ttgccaatgc agttactggt atcaacgatg ttcaaaacac ttatggattg aatagaatca       360
     gttggcaagg agatccatgt gtccccaaac agtattcgtg ggacggtcta aattgcaaca       420
     actcagatat ctctatacca ccaataatca tttccttgtg agaagaatca tttgataatt       480
     tatattattt taaatcattt ttttgtttca tatctcacac tttatgttta tagagattta       540
     tcttcaagtg gtttaaatgg ggtcattaca caaggcattc aaaatctaac ccatcttcaa       600
     tacttgtacg tgtctctgcg gctgaccaaa cctcaaattc tttttaactt tggaactgaa       660
     tcatagttga tatgcttttt ctcctttctt aatggtaggg acttgtcaga taataattta       720
     actggtgata tacctaaatt tctagctgac atacaatcac tcttggttat gtaagtttcc       780
     atgcatgggc cattacattt tttccccttt ttctaacttt tgaattattg ctataaattt       840
     tgcgagaaca tgattgctta tgttttggct cttcaacaga aacttaagtg gtaataatct       900
     cactggatcg gtgcctctct cacttcttca gaagaaagga ttgaaattaa agtaaattta       960
     ttttgttttc ccagcttttt ctaattgatt aatatgtctt taacatcata aaatgttgca      1020
     gtgtcgaagg caaccctcat cttctttgca cagatggttt atgtgttaac aaaggagatg      1080
     gacataagaa aaagagcatc atagcaccag tggtcgcatc aattgcttca atagctattc      1140
     ttataggtgc attggttctg ttttttgttc ttaaaaagaa aacgcaatca aaaggtaatg      1200
     gtgtaattat tacgctcaag agtaatatca ctatatacat aaatatcaaa cttaagttct      1260
     aagtctgact accttttttt cttttttttg taaccttagg gccaccagca gcatatgtac      1320
     aagcgtcgaa tggtagatcc cgtagatctg cagaaccagc aatagtgacg aagaataaac      1380
     ggtttactta ctctgaagtt atgcaaatga caaataactt ccaaagagtg cttgggaaag      1440
     gagggtttgg aattgtttat catggtttgg tgaatggtac tgaacaagta gctattaaga      1500
     tactctccca ttcttcatct caaggatata aacaattcaa agctgaggta aattcacact      1560
     ttcatcatta tctaattgaa acaaaagcat caatgattca aatattttga aggatatata      1620
     tctataactt ctgatttctg gctgggtatt taggtagaac ttcttcttag agttcatcac      1680
     aagaatttgg taggccttgt tggatactgt gacgaaggag agaacttggc tcttatatat      1740
     gaatacatgg ccaatggaga tttaaaagaa cacatgtcag gtaagacaat aatgactaac      1800
     tgtattttat cagttctata gtgcgaatat aagactttag catttatctc aaagtgttct      1860
     ttttaaacac aggaacacga aaccacttca ttttaaattg gggaactaga ctaaaaatag      1920
     tcgttgaatc tgcccaaggt ttgtttcgtt cttttctttt ttcatatact tgaagttttc      1980
     aatattgtaa aaaactaatg tttgtgacat aggacttgag tatttgcaca atggatgcaa      2040
     accactaatg gtgcatagag acatcaaaac aacaaatata ttgttgaatg aacaatttga      2100
     tgccaaactt gctgattttg ggctctcgag atcattcccg attgaaggtg aaactcatgt      2160
     ttcaacagct gttgctggaa ctcctggata tctcgatccc gagtaagtat tacctcttaa      2220
     ttaagggatt ttagtttttc cttcaattac aaagcaaccc acataaaatt tgttttctat      2280
     attattttcc agatactaca gaacaaattg gttgactgaa aagagtgatg tttatagttt      2340
     cggagtcgta ttgttagaga tcatcacaaa ccaacccgtg atagacccaa gacgtgaaaa      2400
     gccacatata gcagaatggg ttggggaagt gcttacaaaa ggagacataa aaaatataat      2460
     ggatccaagt ctaaatggag attatgattc cacttctgtt tggaaagctg ttgagctagc      2520
     gatgtgttgt cttaatcctt catcagctag aagaccgaac atgtctcaag ttgttattga      2580
     attaaacgag tgtttgacat ctgaaaattc aaggggagga gcgattcgag acatggactc      2640
     agaaggttct atagaagtaa gcttgacctt tggtaccgaa gtgaccccat tggctcggta      2700
     gtttacatga agaattcagc ttctttttga atttttgaat ggtttcttct aaacaccatg      2760
     tgagaataag tcatccacat ataaccatac aatgtttttc taagttttct tactctcaaa      2820
     attttgtgtt cagcttgagg ttaatcgagg tatcctagtg gttaatcgaa gtatacttct      2880
     tcagtgattt tttcaattaa aactaataat tttacatagt taatgcaaac tccttttcaa      2940
     tccgaacggt atcatgtttt gagattgccg tttttttttt ttccattttc gtccgtcttg      3000
     ctcttgtaaa tgagtaaatc catttttggc tcccactttt tccttttctt atggtttttc      3060
     gggtgaacac gcataatttt aattgatcat cctgacttat tcatccatag caagtatcca      3120
     cattcttctt ccatatcata aggaattttt tcaaccaaaa atccaacaaa ttatacatat      3180
     aaaatcattg gagattgaat tgagatgcaa aaacactata tatttttatt ttttttgttc      3240
     aaagcaaaaa cactatatat gatgtataaa ttcgaaagaa ttcgagtttc acatatacaa      3300
     gccttttgac caaaaacaca cactacaagc tggatgatgg ttgacttctg acggtggaga      3360
     ttcaattacg aaaacgccat atccatctag aacgaaagac acagaaagac agatcaaaca      3420
     atgacgtgcc atataaaagt caaattcaac aaatctgtaa gattattaac tagaacttag      3480
     aaggttatgg tttaatgcac gtttcctttc tagatattat tcctagtttt tcgacgtcga      3540
     caacatcaaa ataaagcgtg ttattttgcg ttgacggttt agtggtctaa aattagtaaa      3600
     gtacatgaga gtgttttcga cctcttgtca tggttgacca aaaaactaaa gagtttgtca      3660
     ttttctcaca acttgttcta tcgaaatcga attattttcc atcctgaaaa aaaaggtctc      3720
     aattatctat ttatgtagct gacttgagac ttttaaaagt ggctcataaa aatcatatat      3780
     ccttatatgc atagcttgat atctaaagaa aaggctcttt cttttggaca gtaagaagaa      3840
     taatggagag acattttgtg tttattgcca cctatttgct gatatttcat cttgttcaag      3900
     ctcaaaatca aacaggtatg cacaaatttg ttgttttaat ctatataagt gttgttcaac      3960
     cttcaacggt ttcttagatg aaacgtttat attttttcat ctattgtctt attaggattc      4020
     attagtgtgg attgtggttt atcccttctt gagtctcctt acgatgcacc acaaacgggt      4080
     ttaacatata catcagatgc cgatttagta gctagtggca aaaccggtag actcgccaaa      4140
     gaatttgaac cactcgttga taagccgact ttgacactga gatactttcc agagggagta      4200
     cgaaactgct acaatctaaa tgtcaccagc gacaccaact atttaatcaa ggccacattt      4260
     gtatatggga attacgatgg tcttaatgtt gggccaaact tcaaccttta tctcggtccg      4320
     aatttgtgga caacggtgag tagcaatgac actatagagg aaataatcct tgtgaccaga      4380
     tccaactctt tacaggtgtg tcttgttaag acgggaataa gtataccttt tataaatatg      4440
     ttggagctac gaccgatgaa gaaaaatatg tacgttactc aaagcggttc actgaagtat      4500
     ttattcagag ggtatattag caattcaagt actcgtataa ggtaagctcc catgaaaatt      4560
     tcatgttata taagcatatg tctcgattag ttgttttcat acatttatta tctaaaattt      4620
     atttttgcag tttttgtatt gaaatttttc gtttagcaaa aactgcaaaa atatgcatcg      4680
     gatgcattta ttgcaaaaat aattgttttt tttcttaaaa attctttcaa ccaaagatgc      4740
     attttttgta ttttaggggg tgttattggt tgattgattt ctaaatttat atagaatttg      4800
     aaaatttcta ttaattatga aatcaagata tatggatttt gaaataatat gtgtttaccc      4860
     atatatttga atctttctat ttttctcttt caaatccatt caattctatt taaaacataa      4920
     tttggattct caaatccaaa aacaaatgac taaacgaata acaaagaatt ttaactagta      4980
     tttataaatc atcgaatcaa taacacatga ttttaattag aattttaaaa tcaatattga      5040
     ataacaaatg atttttgttt ggatttccaa ttccttataa atctataaac caataacccc      5100
     tccttagtta ttttggtgaa tagaatttta cattcataca aaaatagcaa caaaaaaaaa      5160
     aaaaaaaatg tgcaacatta tattattttg tgttgacaat tactatatat tttcttaaat      5220
     tatttaaaat aaattatact tcttgacaaa ataatattaa aacaatattt cacatgtcaa      5280
     taactggtgc gtttgaaacc atagaaagcc atatgtcaga ttagttatgt catatacata      5340
     catgattgtg caggttcccg gatgatgtct atgaccgtaa atggtacccg ctcttcgacg      5400
     actcatggac acaagtaact acaaatctca aagtgaacac aagtattact tatgaactac      5460
     cacaaagtgt aatggcaaaa gccgcaacgc caattaaggc taacgacacc ttgaacatta      5520
     catggacggt agagccccct actacacagt tttactctta cgtacacatt gcagagattc      5580
     aggctctaag ggcaaacgag acaagggagt tcaatgtgac actgaatgga gaatatactt      5640
     ttggaccttt tagtcctata ccgctaaaaa ccgcatccat agtcgactta agcccagggc      5700
     aatgcgatgg agggagatgc attttgcagg ttgtgaagac gctgaaatct acgcttcctc      5760
     ctttacttaa tgctatcgaa gctttcaccg tgattgattt cccgcaaatg gagacaaatg      5820
     aaaatgatgg taggtcgata tttagattct ttatcttatc tacaaatctt aacgttttat      5880
     gttttgattt ttgacatcat caaactttac agttgctggg atcaagaatg ttcaaggtac      5940
     ttatggattg agtagaatta gttggcaagg agatccatgt gtccccaaac agttattgtg      6000
     ggatggtcta aactgcaaaa actcggatat ttctacgcca ccgataatca cttccttgta      6060
     agataataca atttttatta atttctaatc atgtcaattt caaactgtta tctcacactt      6120
     tttttttttt gtctctagag acttatcttc aagtggatta actgggatca tcacgcaagc      6180
     cattaagaat cttactcacc tgcaaatatt gtaagtatat ttgtggctaa ccaaacatca      6240
     actttttttt tttttttttt tcgtcaccaa acatcaactc tctttgcctt ataatatgaa      6300
     tcatatttga tgggctcgtt cttctttgtg cagggacttg tcagataata atttgactgg      6360
     agaagtacct gagtttttag ctgacataaa atcactcttg gtcatgtgag tttatattgg      6420
     gacactgcaa attgtttttt ttttttactt ggttaacttt tggttaaaat atttttgact      6480
     ctttttgatc ccaacagaaa cttaagtggt aataatctaa gtggctcagt tcctccctca      6540
     cttcttcaga agaaaggaat gaagttaaag taaactaact ttttctttct tttgaatgtt      6600
     atcatggcga ttgatgcaat cgggtatctt taatacttac attttgcagt gtcgaaggca      6660
     atcctcatat tctttgcaca acgggttctt gtgtcaagaa aaaagaggat ggacataaga      6720
     aaaagagtgt catagtgcca gttgttgcat caattgcttc aatagctgtt cttataggtg      6780
     cattggttct gtttctaatt cttagaaaga aaaggtcacc aaaagttgaa ggtatattat      6840
     caataagctc aaacttcatt cctttgttaa catcacatac ataaatatca aatttaagta      6900
     ccaagtctta ctacattttt cgcttgaaac cttagggcca ccaccatctt atatgcaagc      6960
     atcagatggt agattgccta gatcatctga accggcaatc gtaacgaaaa atagaaggtt      7020
     ttcttattca caagttgtga taatgacaaa taacttccaa agaatccttg ggaaaggagg      7080
     gtttggaatg gtttatcatg gtttcgtgaa cggtacagag caagtagctg ttaagatact      7140
     ctcccattca tcgtctcaag gatataaaca attcaaagct gaggtaaact ctcacattta      7200
     tcactttctc agagaaacac gtcaatgact caactatttc taaaccttga acatgtgagt      7260
     tatggtttgg tgtttaggta gaacttcttc ttagagttca tcacaagaac ttggttggtc      7320
     ttgttgggta ctgcgacgaa ggagataact tggctcttat ctatgaatac atggccaatg      7380
     gagatctaaa agaacatatg tcaggtagaa aacaaaagtg tgttttttgt ttgttgttgt      7440
     cttgaggtaa aacataagac tttgacaata atatgttctt tgaataaaca ggaacacgta      7500
     accgctttat tttgaattgg ggaactagac taaaaatagt catcgagtct gcacaaggtt      7560
     tgtttagaga ttgccccctt gtatttttca atttttgttt ttttgtatta attaaaatta      7620
     ttgttgtggc ctaggactcg agtacttgca taatggttgc aaaccaccaa tggtacatag      7680
     ggacgtcaaa actacaaata tattgttgaa cgaacacttt gaggccaaac ttgcggattt      7740
     tgggctttcg agatcattcc tgatcgaagg tgaaactcat gtatcaacag ttgttgctgg      7800
     aactcctgga tatctcgatc ctgagtaagt attactgctt aagaaatact ttttttcttt      7860
     agtaataaag aaacttgaca aaaaaaaagt tataatattt tgttttccag ataccataga      7920
     acaaattggt tgacagaaaa gagtgatgtt tatagttttg ggattctatt gttggagatt      7980
     atcacaaacc gacatgtgat cgaccaaagc cgtgaaaagc cacacatagg agaatgggta      8040
     ggagtaatgc ttacaaaagg agacatccaa agcattatgg atccaagtct caatgaagat      8100
     tatgattccg gttctgtttg gaaagctgtt gaactagcaa tgagttgtct aaatcattct      8160
     tcagcgagaa gaccgaccat gtcccaagtt gttattgaat tgaacgagtg tctggcttct      8220
     gaaaatgcaa ggggaggagc aagtcgggac atggaatcaa agagttctat agaagtgagc      8280
     ttgacgtttg gtactgaagt gagcccaaac gctcgatagt ttgcatctta tataataaga      8340
     gaaggttttt tcaaactttg cctaccaatg cgacatttgg cactttactt tgatgacacg      8400
     tgtatttatc attaattgta gtttgactaa aataatttat taatagatat atcatatatt      8460
     tagaaaaata gtcataaact ataaaattac tacatattaa actacaattt gaaatgattt      8520
     tttttttacc ataattgcaa ctctcttaac taattacaaa atcaaatctt ttaaattttg      8580
     acatgatatt atgttttaga ctgcacatta atagttaaca actataaata gttctccaat      8640
     tttataagag ttttttttcc gtttttagtt cttttaaaca ataattaatt aaaatatttt      8700
     ctctaatata aatagcaaat atttacacag atacaacaca cacatattca caagtgcgtt      8760
     tgtttccttt gacaattgaa gttactcaat tactgaaaga aaaatggaag atggcttgct      8820
     gtatcaccaa catttacggt atcaccaatg tttacggcaa gagtcataac cttatcaatt      8880
     tgtctctttc atttaaggtt tggactcata ttagctttca gttttttttt ctttttcttt      8940
     tgttttttga gaatgatttc agtttctaaa atggttatat tgagtcttac ttacatgttt      9000
     ttgttttgtt ctaaatgtaa atcgagaact ttttttttct tttttttttt tgtagtaggc      9060
     atcaaatgca cttcaaacca taaatgtata tgaaagaaga ggcaaaacgg gcaagagtct      9120
     caaccttatc attttgtctc cttcatttaa ggtttggact cataatagct ttcagatttc      9180
     gttttttttt gtaagttttt gtaaatgatt tcacattgtt taaagtttct aaaatggtta      9240
     tattgagtct tacttatata tctttgttcg tttttttttt ggtaggcatc aaatgcactt      9300
     taaaccattt aaatggatat gaaagaaaaa gttagcatac taagtttcta aaatagttat      9360
     attgagtctt acttatatat ttttgatagt ttttcttttt ggtaggcatc aaatgcactt      9420
     taaaccattt aaatggatat gaaagaaaaa gctaccatac tatggatagt agagtcaatt      9480
     gcaagagaaa acaagaatca aagttttgat cattcataaa atacaaaaat tgaggcaagc      9540
     gttttagtta agtctcaaaa aatgatggag cgataataac aggtatgacc acaataatta      9600
     tataactatt tatttgtctt tccaaattaa atattatctt tgttaattaa attaaattca      9660
     aattatttat accttctatt tatattttaa aatttttaaa tcaaaattat cattcattta      9720
     cccaatatcg ctataaatag ttactccctc cgtttcacga tataaattat tttagctaaa      9780
     agcacgtaaa ttaaaaatat ttacttttaa aaagttcagc caattataaa agaaactgta      9840
     gaatataaat aatcataaag tattaaagta atatataatt tgcatagaaa cttgaaaaca      9900
     acttatattg tgaaacaaaa aatttggtct aaaacaactt atattgtgaa acggagggag      9960
     tgccaaattt tgttgactta tatgctctct aaaacaaaac ttaatttttt ctgtttttta     10020
     gtataaggaa gctcaattct tagtttctga agaagacatg atcaacatta gttcactcat     10080
     attaggaaat tgtttaattg ttttctatca ttacttacat ttagtgacct ttccaataat     10140
     tgtctctata atacaaatta caaaaatcta tgtctataat acacattaga aaactatatt     10200
     taagaccgaa taatacatta taaaagactc tattatattg aagcaaaaaa aatagattct     10260
     tttatatgag tgacatattg aaatgattta agatttatct tctccaagtt tatattttct     10320
     taaattttag ttttttttta tataagagta tttgagaagt catcatgtac agtcttttat     10380
     ctatatacac tatatcctta attatatttt aaatttaggt tgtttaattt ttctatcgtt     10440
     tatttaatga tctttccaat cattgtttta aaacctataa gtcaaaatta ttgaaaggcc     10500
     ctataataca aattacaata atctatgtta tatacacatt aaaaaaaagt taggaccaaa     10560
     taatacatta taaaagactc tattatattg atgcaaaaaa attagattct tttatgtgag     10620
     tcacatattg aaatgattta atatttatgt tttccaagtt tatcttttcc taaattttaa     10680
     gattttttat ataagagtat ttgagaagcc atcatgtgcg gtcttttatc tatatacatt     10740
     gtatccttaa ttatatttta aattgaggtt taattatata ttttatcaag attaaataaa     10800
     atgtatcttt ttacgaaata tgagacaaac attttttcta tatttttctc tagattggca     10860
     gtgtagttac aattactttt gggtaaactg ttaatgtata gtggtgtgct tgacatgcta     10920
     aaaatgtgta gatatttaat ataaatatta ttctatattc aaaactaaaa ccgaatataa     10980
     aatccacgca tcgcgtggat aacttctagt aaataatata ttgatcatct ttgttatata     11040
     tcgagctata aactccatat taatacatgt tacacaaaat ctttttttgt cttagtgtga     11100
     tacttcagtt taaattccgc tgagatatta gtgttgaaag aattgcatca tcactttcac     11160
     atgcggtaac ttttagtcaa agcagtgttt tttgttgaat atttaagtag tgtttattgt     11220
     tgaaaataag aagtggtggt tgctcattta gtcaacaaaa gtaggttgcg aactctctat     11280
     aaattgagag gaattaaacg agagcaatca tcccataaca tacaatacaa gagagagaga     11340
     gaagttgcaa tatcatgcaa cgtagaaata gagtgtgagg tttgagaaaa ataaagagtg     11400
     gtgtgagatt tgagtgtatt tgttattaag ttataaactt tgtattgtga gtgatttaca     11460
     aataaatata agagtgtttt cttattttgg tttatatatt tgtggttaat ttattaattg     11520
     tgtatttaca ctataccaaa tataatttaa cccaatattt aaccaactat tctctacaat     11580
     tagaatgtga agatgaaaag taaaagttat tgtatctgag gaaagaaaag aagagacaag     11640
     gactttgtat tcataattga atggacaacc atgtgtcgtt agctcaactg gtaaaagttt     11700
     taggcgaaat ttagaagtcg cagattcgag tgatgttcgg gacgaaacta atattacatg     11760
     ctattgtttc aggtctgtgg agattacggg ctataaccta aaaaaaattg aatgggcaaa     11820
     tttaaagata aattacagca aaatagagtc tcggtatcaa acagagtgat ttgatgaaaa     11880
     cagaatggag aggctctgca gttgctagcg tttgacaaca atcacgaaaa ttgctttata     11940
     acgttttaga ccaagagaaa ccgctacaat tcataatctc cttttcctca acatcaaggt     12000
     ttgcgttaac caaaacatcc caattctgaa aatttaaaaa cgaaaacaaa atcatgacgg     12060
     agttagcgtt tgaaagttgt atgcacgttc cagtgtctct cttgaaaaac tattgagagc     12120
     tcgtaatctc tcaatatacc aatgtctaca tgtaattgac attttcaaac acttaaaacc     12180
     tattttccta acctgccgta cattattttt ttattgtcgt acataatcct caaaatattt     12240
     taacatagat taaaactata ggagtctagg aaggttgaca gtacacgaga ggaagatgaa     12300
     gttgacttac ttaatggcac cagcatggca caatagtttt ctatcccaaa cctgtacgag     12360
     attcttatat gtgtacggat ttgttaattt tgaaaaaggt gtgtagaaaa cctcaaagtt     12420
     tgtaaatttt gcgagataat taagccttaa ttcttttttt ttttgaaaga atgtaaaatt     12480
     atattccaca agaaaacttg tttacaatga atgcatctgt ttagaaaaaa atttgcgaga     12540
     taattaagcc ttaattcatt atgaaaaata tattaaaaag acaacatgtg tccggcaaaa     12600
     attgtaaaat gcatagaaaa ccccaagtgt tccacgtctt cgtgcatatt gtcagaaact     12660
     ttatctgcct agttttctag ttttatgctg ttgtcaacta caagtaggat tatacatttt     12720
     ctaaattaga atggtgtcgc ttcggtttag gttaagacat gatcatttgt tttttttccc     12780
     taataaagac cttaatcatt cgttcgtttg catttactgt tacatttaac gtgtacattt     12840
     ttccatattt atgccacata aaaatggaag gagatcctgc tgcttgcatt tgtattttgg     12900
     aaagcaaagt aaaatatatt ctacaaatat aaaattaaaa aaatgttcac atcgatcggt     12960
     tcaatttggt ttagttaggt taatggagat ggatggcctt taatctgaga acaagtacaa     13020
     cgtgtaagcc taggaataaa cgtgagggat ttagaaggaa gaagtagctg gaacataatt     13080
     gttcaatgag tcaatggtct tctattaatg tggacatgag ataatcttcg agcactactt     13140
     tgtgtcatcg ttgaagatta aatttctccc attttgctct ctgccgttat caggttgcac     13200
     aaggaatttc gtatttttaa taactcatca gtgtgttagt tttttttttt taatattccc     13260
     atttgggaag tggctcatat aatatccatg gattgatatt ataaattgaa agctaatctc     13320
     agtttgttaa atgttgaaat ctccttttag aaagtcaagc agaaaaatgg agagacattg     13380
     tttgttcttt gtgatttttt cccttatact acatcttgtt caagctcagg acccaatagg     13440
     tacgtaacct gtacccatat ttgtttatcg tagtgatatt gatttaaagt taagtgaata     13500
     aatgacaaaa tacaaagatt ttttttaggt tagttattgg caaaacacaa cacattatat     13560
     attattaaat gcacttctaa accagattta tttaggaaaa ttggttttag cgtgcttgca     13620
     tatagtaatt ctgaatatat aaagatcaca tatttatgtg gcgtagatag atactccctc     13680
     caaaaaaaaa aaaaatagat accccctcca ctttataatt gatgatttaa agaaaataat     13740
     ttgttctaaa ttatatgatg ttttcagttt ttaatacaaa attaattaac atgtgcagat     13800
     tttttttttt tattattggt tatattctta gatggtacat aattgatgtt ttagtttaga     13860
     aaaaaaaaat aattgatttt taatttgtac acaatcctaa aacatcaatt ataaaaaaga     13920
     tatcgattta ataaattaga tgtccatata tagaaacagg tacagtaaaa aaaaaatgac     13980
     atattctgca acacttaaat gacatgaaca aaaagtcaaa aacttttatc aaaactatat     14040
     ttgacaaatc tccaatatat taatagagaa acacttaaaa cacacaaatt ttattttgat     14100
     ttgttattaa cgagaatgtc atgctaacat gttgctctcg caatgattct tcgccaattt     14160
     caataattat ccaactttta ctagattatt tacagatttt gccattagtc ttatatacaa     14220
     aattctaata aagagtaaca attaagcaat ctaatctttc caaaataaat atattacaca     14280
     accttaagca aaataatcaa gtaactaatc ctttctttat aagaaacata aaacaaaggt     14340
     tatgattact tgataaaaca taaaagatat gaatttgatt cttaaaaaca tagaaagaca     14400
     tattatcata aatggtaaca ttttgtcaat actttctcca tcacgttgaa gttttattcc     14460
     atgttcaaat atttataggt aaaacatatt cttataataa aaaaaacttt aattacatgt     14520
     tatggatcat aaataataat tttacttgaa ttgttttatt ccgcacaaat tgtgcgagtt     14580
     cttatctagt tagatattat aagtaaaaca aataacacgt tgcagtaaaa gaaaaacact     14640
     cgtccgaaag tgaaagaggt aaaattttca gtcaaaacaa agaaaataaa gaaagcggta     14700
     acatcgtcca aaatgctcaa aatccactat tgttcaatgt tcactacttg tcattttcct     14760
     aatacttatt gcgtattctt tagtcatagg aacctaataa tcgcctatta atgtagtctc     14820
     ctacatacta taggattcat caatttggat tgtggtttgt caattcaagg ctctccttac     14880
     aaagaatcct cgaccggtct aacatatacg tcagacgatg gtttcgtcca gagcgggaaa     14940
     attggtaaaa tcaccaagga actcgagtca ttatacaaga aaccggagcg gacgctaaga     15000
     tactttcctg atggagtaag aaattgtttc agtctgaatg tcacaagggg aacaaagtat     15060
     ctaatcaagc caacctttct ctatggaaac tatgatggtc gtaatgtcat cccggatttt     15120
     gatctttaca tcggcccaaa tatgtggatc acggtgaata ctgataacac tatcaaggag     15180
     atcctccacg tatcgaaatc aaacactttg caagtgtgtc ttgttaagac aggtacaagt     15240
     ataccttata taaatacatt ggaactacga ccattggccg acgatatata caccaacgaa     15300
     agtggctccc tcaactatct ttttcgggtt tattatagca atttaaaggg ctatatagag     15360
     taagaatcgc ttgcttgatc attatatttt ttgctctaga gtagacaaac atattatgtt     15420
     taatgtaagt ttgtgccagg taccccgatg atgtccacga tcgcatatgg aaacaaatcc     15480
     taccttacca ggattggcag attttaacta cgaatctcca aataaacgtt tctaatgatt     15540
     atgatctacc ccaacgtgta atgaaaacag ctgtaacacc cattaaagct agcacaacga     15600
     cgatggaatt tccctggaac ttagagcctc caacttcaca gttttactta ttccttcact     15660
     ttgcagagct tcaaagtcta caagccaacg agacgaggga attcaatgtg gtgttgaacg     15720
     gaaatgttac atttaaatct tatagtccta agtttttaga aatgcaaaca gtatatagca     15780
     cagcaccaaa gcaatgcgat ggagggaaat gcttgttgca gttagtgaaa acgtcaaggt     15840
     ccactttgcc gcctctaatt aatgctatgg aggcttacac tgtgcttgat ttcccacaga     15900
     tagaaacaaa tgtagatgaa ggtatgtgtg tttttcatat acttatattc ttttcgggtt     15960
     ttaatgttaa gctttaaata tataccgaac ttgaatagaa actagactaa ccatatatat     16020
     agtagctcaa gaaagaaaga tagaaacatg gaacctttga agacagttac aaaatatgaa     16080
     tattgatatc aactaacttt ataaataatt actagtgatt gctatcaaga atatacaatc     16140
     tacttatgga ttgagtaaaa caacctggca aggagatcca tgtgtaccca aaaagttctt     16200
     gtgggatggt ttaaactgca acaactcgga tgattctacg ccaccaatta tcacttcctt     16260
     gtaaggacat gatttcatcg ttttcctact tttcttttgt acacttaaca tactcattat     16320
     tttttcatca ctagaaactt gtcttcaagt ggattgactg gaattatcgt gctgaccatt     16380
     cagaatctcg ccaatttaca agaactgtca gtatcagata actatataga taagcatcat     16440
     tagtttttaa aaaaaaaatg ttggtagaaa ttactaagat gaatggttat tttatcttaa     16500
     tcgttatagg gacttgtcaa ataacaactt gtctggaggt gttcctgaat ttctagcgga     16560
     tatgaagtcg ctcttggtca tgtaagtttc ccatgagaat gatgtctatt agcccttgat     16620
     ccttgtgctt gatctatgtc tctatctaaa cagaaactta agtgggaaca atctcagtgg     16680
     tgtagttcct caaaagctta tagagaagaa aatgttgaaa ttgaagtaag aatttgtata     16740
     ttgtatttgt ttgatactaa catgtttttt tatgataaac taattttttc ttgacttgca     16800
     atccaaagca ttgaaggcaa tccgaagctt aattgcacag tggagtcatg tgtaaacaaa     16860
     gatgaagagg gtggacgaca gataaagagc atgacaatcc caattgtggc atcaattggt     16920
     tctgttgttg ccttcacagt tgcattgatg atattttgtg ttgttcgaaa gaataacccg     16980
     tcaaacgatg aaggtattca cattatattc atcgatcaag atacttatga atacacacac     17040
     attaaacttg catagtttca ttgaatgttt tcatcacaac tttagctcca acatcatgta     17100
     tgctacccgc ggatagtaga tcatctgaac cgacaatagt gacgaagaat aaaaaattta     17160
     cgtatgcgga ggttttaacc atgacaaaca atttccaaaa aatccttgga aaaggaggat     17220
     ttggaattgt atattatggt tcagtaaacg gtacagagca ggttgctgtg aaaatgcttt     17280
     cccattcatc agctcaagga tataagcaat ttaaagctga ggtattcata ccacaactca     17340
     taatggaatt ttgtgtgaaa cattccagag tttctttcaa agctaatttg gtgtatcatt     17400
     atggtacgtt aggttgaact tcttcttaga gtacatcaca agaatttggt aggccttgtc     17460
     gggtattgcg aagaaggaga taaattggct ctcatctacg aatacatggc caatggagac     17520
     ttagatgagc atatgtcagg taaacataat atttgttttt actagaaagg caacatattt     17580
     ggttttcata acaatacatc atggtgaaac tataacatac caaatggtaa ctctttaaga     17640
     aaaagaaaaa caaataataa ctcagaataa tatatttttt tgtcatttac aattcactca     17700
     ttagttattt ttttgaatat aattttgaat atttgtctat tgaatgtaag aatctaacac     17760
     acattagtta tttttttaac aatacatagg aaaacgaggt ggttctatat taaattgggg     17820
     aacaaggcta aagatagctc tcgaggctgc acaaggttcg tattgatttc tcaaatacct     17880
     aacctcatca tattctttct ttgtttcttt tgctttgact gactgaaact ttgtgaaaat     17940
     aatatttttc ataggattag agtacttgca taatggatgc aaacccttaa tggttcatag     18000
     agatgttaaa accacaaata tattgttgaa tgaacatttc gataccaaac ttgctgattt     18060
     tgggctttcg agatcattcc cgatagaagg ggaaactcat gtatcaactg ttgttgctgg     18120
     aactattggt tacctcgatc ccgagtaagt attacttctt caataagaaa atatattttg     18180
     tagatatttt gtctccaatg attacgtaat attcttgcac tttgaactat tttatagata     18240
     ttaccgaaca aattggttga cggagaaaag tgatgtgtat agttttggag ttgtattatt     18300
     ggtgatgatt acaaaccaac ccgtgataga ccaaaaccgc gaaaagagac atatagcaga     18360
     atgggtggga ggaatgctta cgaaaggaga catcaaaagt attactgatc caaatctcct     18420
     tggagattat aattctggtt ctgtttggaa agctgttgaa ctagcaatgt catgtatgaa     18480
     tccttcttcg atgacaagac cgacaatgtc tcaagttgtt tttgaactga aagagtgttt     18540
     ggcctctgaa agctccaggg aagtgagcat gaccttcgga actgaagtgg cccctatggc     18600
     tcggtagagg tcctgattat atttcctatt gtatcgcgtg gatcattatt ttaccctata     18660
     tatcctttac aactatccta aattttgtgc atcaatttta ttttttgtaa gcaatgaact     18720
     tctaattaca atagaagttc aaagtctttt ttcccccatg tttcagttta ttccaactaa     18780
     ccatgaatta aataatgggt ggtggtgcat gtttctttta ccaaaaataa ccatgaatta     18840
     ataactatag catttgctta tgacccttca acttctaaca tgcagagtga cctttgtata     18900
     taagcagcgt cacctaagag atccagtcac cagtacggaa acagaagaaa ttcctgacaa     18960
     taaaagaagc aaactcacct cctagctttt caaattacaa aattgatgaa atttggttta     19020
     tagattctct tcattggggc aaatcataga aatagtttgg tcgacattgg ggcaaaacat     19080
     ggaatagaac gggacaattt tggaaataac agattgagag catcagcaac ggcaacttct     19140
     caacttccga ttctcaatat atgtgtgaac ataaatataa gtgtgaacac aaatattatt     19200
     aatatttaat tggaaagtat tttaattaaa ccaatgattg aatgacaact gtgagaaacg     19260
     ttgtcgatga gtttttcttg gtttctctaa agaaaacttt cccttacctc tctcctcctt     19320
     ttgacatttt tttcttattt tattggtgag agattttatg agaaactccc gttggagttg     19380
     gtctgagtgt ccttcaaaca tttttaaaat aaatatcaca cattcacact ataactgctt     19440
     attctacttt taaaaccata aaatgattgc tccaagccat tgggaatata atcaaatata     19500
     tatacttaat ccaaaaggta cataaaattt ggtgacaaaa atttactttt tgttggaaaa     19560
     agaaagtatc tgagcagaat attggacgga gcaaagaaac aagagaagga tatcaagtag     19620
     cacaacttga caaattgaca aaggatcaaa caagattcat atgttgtaat aatctatagt     19680
     caactaaggc aacacattgc ttacaaacta caaagtgaag tcattgtcat taatggttat     19740
     cagatgatta cttatgtcca cataatatag aaaaaagcat atccttgaca atattgaaga     19800
     taagaaaatt caaggagaat ctaaagactg attgttcttt cgagttgact tagtcaacgg     19860
     ttttgtggtt ccaacttgta agctgtaatt acggctgggc aaggtaacgg accactcttg     19920
     tcattttctc tcaaccaaat cattttacac catcgaaata atatcctcat taaatgtgtt     19980
     ccctcaatta tttgattcat taatgtgaca cttataagaa tttgacttag gactttgaga     20040
     aatacctcat atacataatc ataaacttat atgcatagct ttgctaactc aaaaaaaaaa     20100
     acagatccct tctttgcata gtaaggaaga tattaatgga gagtcatcgt gtgttcgttg     20160
     ccacttttat gctgatactt catcttgttc aagctcaaga tcaacccggt acatacaaaa     20220
     ttgttgtttc aatctataca tatgtgttct tcaatggttt cttagactat aagatatata     20280
     ttttccatct attatttcat taggattcat caatgtggat tgcggtttac tccctcgtga     20340
     ttctccttac aacgcactcg gaaccggttt agtatataca tcagatgtcg gtttagttag     20400
     cagtgggaaa actggtaaaa tcgccaagga attcgaagag aacaacagta caccgaattt     20460
     gacattgaga tactttccag acggagcacg aaactgctac aacttaaacg tgagccgtga     20520
     caccaactat atgatcaagg ctacattcgt gtatggaaat tacgatggtc ataaagatga     20580
     gccgaacttc gacctttact tgggtccaaa tttatgggca acggtaagcc gcagtgaaac     20640
     tgttgaggag atcatccatg tgacgaaatc cgattcgtta caggtttgtc ttgctaagac     20700
     gggagatttt atacctttta ttaatatctt ggagctacga ccattgaaga aaaatgtgta     20760
     cgttacagaa agtggctcac tcaagctctt atttaggaag tattttagtg actcaggtca     20820
     aacgataagg taatacttgt ttgttaaaaa ttctattgta aatttaaatt taccattata     20880
     tttatagttt actagattat atcccacatg atacgtagat aatatataca atatttagat     20940
     tctaaattgc taacccgtat aaataggttt taaactaaaa acctctttta gttatctgta     21000
     aattatgttt tataattcgt gattattaaa attcaaaaac tacccatatt acccttaaat     21060
     aatcccttta ggtgaataaa tatatatttt tgaatattat tttctgaatt tagttgttct     21120
     aacatgctgc aacaaaaaaa agaaaaagag aaaaaaagaa aaaaaatcta acgattgaga     21180
     aatgttttgt tttaatgtaa taagtcagat ttaaagttat accctgaatt tttgtcatgt     21240
     aagaattcta aagcacacga taacaaactc ttattttcta attttctata ttatgagtct     21300
     tatgtaaatt ttatagttta catattttca atttctaggt tctatatttt tatattgtac     21360
     cttacttttt cgatttgatt agttttcatt ttttcaaatc acaatttcct ttcaatttgt     21420
     tttgctgttc tgtctattta aaattaaaaa actaataata attagaaata ctatattatt     21480
     acattgacag taaacataac tttttatttg tgtaatgtgg tctaacattt acttgtggca     21540
     ggtatccaga tgatatctat gaccgtgtat ggcatgcatc cttcctggaa aataattggg     21600
     cacaagtatc gacgactttg ggtgtaaacg ttactgataa ttatgattta tcacaagatg     21660
     taatggcaac gggcgcaaca cctctaaacg atagtgagac attgaacatt acatggaacg     21720
     tagagcctcc tactacaaag gtttactcct acatgcactt tgcagagctt gagacactaa     21780
     gggccaacga tacaagggaa ttcaatgtga tgctgaatgg aaatgacttg tttggacctt     21840
     acagtccaat accgctaaag accgaaacag aaaccaactt aaaaccagag gaatgcgaag     21900
     atggggcatg tattttgcag cttgtgaaga cgtcaaaatc aactcttccg cctttactta     21960
     atgctataga ggctttcacc gtgattgatt tcctacaagt ggagacagat gaagatgacg     22020
     gtatgtcaat ttgacattct tgatcttatt tcaaaatgtt tagcgtgttg tgtgttgatt     22080
     cttgatatca tcaagcttta caatcgtagc tgctgctatc aagaatgttc aaaatgctta     22140
     tggattgatt aatagaagca gttggcaagg agatccatgt gtccccaaac agtattcgtg     22200
     ggacggtcta aagtgcagtt actcagatag tactccacca ataattaatt tcttgtaaga     22260
     tgaatcattc aatagatttt cttgattttt ttaatcatgt caattttgaa ctagatatct     22320
     cacagtttct ttctccagag acttatctgc aagtggacta accgggatca tcgcgcctgc     22380
     cattcaaaat cttactcacc tagaaatatt gtaagtctat ctcaactgct gaccaagcca     22440
     aaatttttgt aaccattgga aacagataat gtttaatgag ttatttcact tttgttaatg     22500
     gaagggcctt gtcaaataac aatttgaccg gagaagtacc tgaatttcta gctgacttaa     22560
     aatcaatcat ggtcatgtaa gtttttcatg agacactaca atatattcta ctcttgacat     22620
     tctcctgaac atgtttgttt atcctttaac tatttttcta cttcaataga gacttaagag     22680
     gcaataacct cagtggcccg gttcctgcct cacttcttca gaagaaagga ttgatgctac     22740
     agtaagctat atttttgtta ctttcaacct gttatatata tatcagggaa attgatgtat     22800
     tttgtttctt taacaacact cacattctgc agtcttgatg acaatcccca tattctttgc     22860
     acaactggtt catgtatgca caaaggagaa ggcgaaaaaa agagtatcat tgtaccagtg     22920
     gttgcatcaa ttgtttcatt ggctgttatt ataggtgcac tcattctgtt ccttgttttc     22980
     cgaaagaaaa aggcatcaaa agttgaaggt atcaataaat aaactcaaga ttaatattag     23040
     agcatacatg cacatcaaac ataacaagat tttgccttat ataaccttag ggacactacc     23100
     atcttacatg caagcatcag atggtagatc gccgagatcc tctgaaccag caatagtgac     23160
     gaaaaacaaa aggtttactt actcacaagt tgtgataatg acaaataact tccaaagaat     23220
     ccttgggaaa ggagggtttg gaatcgttta tcatggcttt gtgaacggtg ttgaacaagt     23280
     agctgttaag atactctctc attcatcatc tcaagggtat aaacaattca aagctgaggt     23340
     aaattctaac tttcatcact gtctcgaatg aaaacatcaa tgattcaact atctttaaaa     23400
     gcttaaacat atgcattttg gcatggtatt taggtagaac ttcttcttag agttcatcac     23460
     aagaatttgg ttggtcttgt tgggtattgc gacgaaggag agaacatggc tcttatctat     23520
     gaatacatgg ccaatggaga tttaaaagaa catatgtcag gtaagcaaac aaacatgacc     23580
     taaccatata ttgctgtaga tttatcgtga tagcatcaga cattgatatc tttctctcct     23640
     tttaaaacat aggaacaaga aaccgattta ttttaaattg ggaaactaga ctaaaaatag     23700
     tcattgactc tgcgcaaggt tggtttacct agtatcccta ttatttctct tatatatgtt     23760
     tttttgcttt tcatttgatt gaattttatg gattttgttg catagggctt gagtatttgc     23820
     ataatggatg caaaccacta atggtacaca gggacgtcaa aactacaaat atattgttaa     23880
     atgaacactt tgaagccaaa cttgctgatt ttgggctttc aaggtctttt ccgattggag     23940
     gtgaaactca tgtgtcaaca gttgttgctg gaactcctgg atatctcgat cctgagtaag     24000
     tattattatt attatttttt tattatatat tgtattattt tggtaaaaga gagtaagtaa     24060
     tatagtttaa aagaattttg ttttattgga aaggtaaatt gataaaattc tatgctccta     24120
     aattctccag atattacaaa acaaatcggt tgacagagaa gagtgatgta tatagttttg     24180
     ggattgtatt gttggagatg atcacaaatc ggccagtgat agaccaaagc cgtgaaaagc     24240
     catatatttc agaatgggtg gggataatgc ttacgaaagg agacatcatt agcattatgg     24300
     atccaagtct aaatggagac tatgattctg gttctgtgtg gaaagctgtt gaactagcaa     24360
     tgtcttgtct gaatccttct tcaacaagaa gacctaccat gtctcaagtt cttattgcat     24420
     taaacgaatg tttggtatct gaaaattcaa ggggaggagc gagtagggac atggactcaa     24480
     agagttccct agaggtaagc ttgacatttg atactgatgt gagcccaatg gctaggtaga     24540
     ttacatgaaa tattatcatg cggtatcaca taaatttgtt tatatgtttt tatttacaga     24600
     actatcctca aattagtatc tctcttatag gccacctttg ttaatgaact ctgaactttt     24660
     tgtcattgat acatgtgtga ataacagtcc aaagtctatt attgttccgc cgtaatgtat     24720
     cagtttcaaa tcagtgcatt ttttgtttgg agaatttaga tttactcttg ttcttgatta     24780
     ctattggaac acctccactt cggaagctcc tacgttggaa tgaaatcacc catttctatg     24840
     taatatagtc tccaccattt ttaccatagg gataatctat catcatttga cgatttatcc     24900
     ttttctttga tttcacacca tttaaacaaa ctctaatgcg gattatttat ctatatattt     24960
     ggctcgagtt aaattttcag atttttattg gtaattttct ctctcttttg attgaatcac     25020
     caatagtaaa tcttgatatt tcaatttaat gttgtagtta acagaaataa ttgtgtgatt     25080
     ctaagacttt cacgtactta gttagaaaag caaaaaacta gaatcagtgg agaaccttgg     25140
     aattatgaca aaattgaagg agatgtacta gaaatagaca aatgtaactt ttgttataaa     25200
     tactcgtaag ctttgttcat gtttattaaa cttttaaaac atcaacagtt tttccattga     25260
     aaatgagaag taaacccaat cctctctggg ccaccattat cactatcttc accatccttg     25320
     ttataggttt gtaattgtag ttacatttac aactatttaa atgttttttg aacagcgttt     25380
     aaataattta tttattatca ttcgaatcta aattaattgt cgaaaacatg ttatttttct     25440
     ctatataaac aaattcaatt atcttatgtt aatttttttt ttatctaaaa cgacggaact     25500
     cttttttttt gtcatccgat attaattaga ggtcaaaatt cctgagaaat attgtttata     25560
     ttgatatgat gtagtttgac acaaactttt tgtgtcaaat tatctgtttt aatatttgca     25620
     ctaagtgaaa taaaagataa ataaaaactt ttgaattcct ctttgtcact ctgtaattcc     25680
     tccaaatagg ctgagaatgt tggtcatctg gttggggaag acactatctt caccagatct     25740
     aaacagtctg ttagaaaaac tgcttcttaa ttgttatcgg taatcataca ctttatcgcc     25800
     cagagaaaag cttgcacttc tgaatgtagt agagatagac tttttctggg attgccagct     25860
     cccattgtgg cgtctctcca tttaatgatg tacaatatca tcatgttcca cagaacttct     25920
     ctttctttcc atgatccatc catatagcat cgatttcttg aataattgat atcgtttgag     25980
     atattcctca ctcgattcca agtttctaaa tttgaaaacc atgattttta ttataaaact     26040
     cattttgagc taactgccac gattgtgcca taaaatgctt ttcacattca acttatgatg     26100
     catctatttg gcatccccta ttatcgaata tatatatatg gtgatcgaga acatacttta     26160
     acgggctttt caataccaat tttttggtag cgtccaccaa gtaaaactca agagagtaat     26220
     aattgatgtt aaactaattt ctatattttt tagaacattt aatgaaaagt ccctcatggg     26280
     ctgattaaac ccttcaagta tcaatctatg caatttaaac ccttgcacta aatttttttg     26340
     gtaaggaaac ccttgcacta aatcattagt gaaaaagcct ttgttcaact aaagacccat     26400
     tacaaaaata agcctttgtt tgtattattg tcgaaatact tccattgaat caatacttac     26460
     attttggttt tttaaaagct gacgattata gttttcacaa aaataagaga gaatgatgtt     26520
     tggttaaaat acatcataaa tatgattgaa aatctcaaac gatcatgtca atgtaactat     26580
     gatatcactt cataggctgc ataaaacgac tgttaccaaa tccatctaca gtcttagaaa     26640
     ttcagcgcat ttgaagagaa gaagtataag aacgatatac ggtttctact ttctcacaaa     26700
     ggtttatgtt ttatatatct tatctagaat tatatgatta ttgttattat atttctagtg     26760
     atatatttca acaatcaact ctatatgtgt gtgtatttta ctaatataca caaatttagt     26820
     taaatatgta tataatatat ttgttcaatt gtcaaaaaga aaaactgata ttttttgtgt     26880
     taaatattaa ccataatagg gttgatggta atggaaacaa tggggctgaa actgtgtttt     26940
     gaagttctac caaatacata tgggattatg gggtatcttt gagttcatca acatgtgtca     27000
     ttcaatggtg tgccattcaa tgtaagagga aagaagctaa tgggatcggt acttgcaagc     27060
     caaggcccaa tcaagggaaa atacaatata gaaaactaaa agaagaatgc cactgcgttt     27120
     ataaatgttc ataaaactat attaaatggt gaacattaaa tcacattttt gtttatttta     27180
     taaaaaatcg taatatttat atttataata ctaaataagt agaccgccaa ttttggtatt     27240
     ctgccaaatt aaaattctga aattcgtaca gatttccgat ttactgttgg aaatatccga     27300
     tatttttaaa tgaacatatt ttcgtcggac aattttatta ccaagaccga gtgaacatct     27360
     ccgcacaacc taaaatcact acaaaaaaaa aaaacagtgc ggcttttcta ccgaatctcg     27420
     acagacatca atttggcaaa attctaatga tttaccgaca aaaatatgtt cattaaaaaa     27480
     gaaaaaccta gaagttacct catataaaat ttgaagaacc aacactgtgg ggttgggcta     27540
     actcatatat atactttcaa aatttacata ccttgttctt ttcactgaaa gagaaaccta     27600
     gtaacctcat ataaacttct ttggctaacg tttcatgaag aaaagtattg tgctactata     27660
     agaaatattt gtcgtcattt tcaccacata catctaccaa cactaaattt cattcagatt     27720
     atataaaaaa taaaatttta aataacaaag aactataaaa aataaaattt tatataacaa     27780
     agaaccggaa tagaatacaa gtaacactca ctctgttcat cacaaacaga acaaaagaaa     27840
     cgtgtgtacg aagaaacttc tagcttcaaa caaattatac ataagatttg attcatctag     27900
     ctcctggatt aagctctgtt gtgaaattca tggacagctc aattgaagaa tcattagttg     27960
     aatccgtcat acggcttccc atgtttcttg ccatctccat gttcagacat tctttcagat     28020
     ccattacgac ttgagtcatt gtcggtctcc gtgaagaaga cggattcagg caagtcattg     28080
     cggtctcaac aactttccat atcgtgtttg gatcaaagtc tccttgaagc ttaggatcta     28140
     caatgctgtt aatgtctcct cttgatagca tcaaacctac ccattcagct atgtgtgatt     28200
     tttctctttt catgtctatc acgggttggt ttgttactag ctctagtaga acaacaccaa     28260
     agctgaacac atcacttttc tcggtcaacc aattagttct gtagtatctg gaaaataaaa     28320
     acaagagaaa aaggaaaagc cacaatgttt agagttaaca cgaaaaagaa aaatcaatag     28380
     ttgttttaaa gaaaagtgtt taaggtttac tcaggatcaa gatatccggg agttccagca     28440
     actatggttg agacgtgagt ttcagttcca agtggaaaag accgtgaaag cccgaaatcc     28500
     gcaagcttag cttgaaattt ctcgtttaat aagatgttag tagtcttaat gtcgcggtga     28560
     actatttgcg gtttgcatcc attgtgcaaa tattccaatc cttgcgctga ttccgctgct     28620
     atacgaagcc ttccttccca agttagtatc gacggtccac gcttccctga aatcaaattt     28680
     ttgaaacaat atatatcaga atcataaaac taaaaaccac aatgttaaaa cattgatttt     28740
     gtataaaaac catacctgat aagtgctctt tcaagtcacc attcgccatg aactcataga     28800
     ttagagacat tttatctcct tcttcacaat atccaacaag acatgtgaga tctttgtgat     28860
     gaactctaag aagcaactca acctaaaaag taaacaaaac aaaaacagat ccaagacgca     28920
     atcaaaacac catttctaat aatagttaag agaaacattt ggttcaatct gttattacct     28980
     cggctttaaa ctgtttgtaa ccaagtgcag tggactcagt gagcatcttt accgcaactg     29040
     gttcattatt caagacgccg taataaacca caccaaaacc acccctacca agaaccctct     29100
     caaagttgtt tgtgatctta acaacatcaa tgtaagtcaa tttccggttt ttcgctataa     29160
     cgggaggttc aaaaccgtgg tgagacctcg aatgtaacgg tgttgtacca gttcctgaat     29220
     taggattcaa accaagcttg gttctcttct tcctcttgag gataaggaaa gtaacgattc     29280
     cagctccaat gaggaatact gaaacaagtg atgctgcaac aggtgcaata acagtgtttt     29340
     tcttcttctt tttcgtggta gcgcatgatg tagatgaaca aagcccggta tttccttcga     29400
     tactagagtt ttcacataga ttaaaataaa attttgatta ttagaaaact cataagcatt     29460
     tcattcttct tttgatattt gtttcctcat aagcacggat tattacctta acgtaataga     29520
     tcctcgtcgt tctttatcaa ggagagttgc agggatagag ccatttagct catttccaga     29580
     tagatttcta tacaaaacag agtgaatata ggttaacgtt tgttaacctt ttggtgttaa     29640
     taaaatgcgt ttgagcttac atgagtttta aggtttccat attagctaga aactctggga     29700
     ctgaaccagt taaagaattg ttagacaagt cactgcaaga aaatcaaatg taacccatca     29760
     aaacatacga cttaaagcaa aactttaatg cattttctga gcatgttaac tacttacaga     29820
     acttctaaac tggtaaggtc tgatataaat tctaagatct ctccggtcaa gccacttgta     29880
     gacagatccc tgtttccaaa aatcaaaaaa caattaaaaa ccttttgtga aaatcatatg     29940
     aagaagaaca aatcaaaact ctgctttaaa aacagaacaa actctatact tacaaagaaa     30000
     tgatctttgg ggtctcattg tcaacataag tgcaattaac accagaccac ttgtaatcca     30060
     gcggcacgca aggatctcct tcccagtcaa tcttgttcac gccgtaagcc gacttgatgt     30120
     tcatcattgc atcaactgaa aacatatttt cattaggtaa gtaaaagttt ggttcttaat     30180
     caacaataaa gaaataagtt ttaccaacct tcttttctat cagtttcctg ttgcggcaac     30240
     aagttaaccg aataaatctc catagcgttg agcagaggag gtaaagtcga atttcctgtt     30300
     ctttgaagcg aaaatatgta ctgcccattt gcatcggcga caacttcggt aggtgtaaat     30360
     acggaagacg tggtgaaatt aagtggtcta aaaggtccat agatatgctt gttattgtac     30420
     atgatgttga actctcttgt atcattggat ttgagctctt gaatctctgc aaaatgcata     30480
     aaaacgtaga actgcacagt acgttccacc ccgactagcg aaatgttcat agctgcgtcc     30540
     gggtctgttg gaacagaggc tgtgaccata gcaatctctg gtggttgata gtcattgttt     30600
     atattcactg actgattggt actaatctgt gaccagtttc cgaaattata cggagtccag     30660
     acacgatcaa acacatcgat tccgtaccta agacaaagaa aaacagagta tatttagaag     30720
     ccttttcaga ctaactttta acattagggt tttgaaactt ataaacctgt agccttggtt     30780
     aacagtcgcg ccaacgtctg ctctgatgaa ggtctgcaag gaaccttgtc gagtcaagta     30840
     agttgtgttc atgagtttac gaagctctaa agcggagata aaaggcgttg cgtttcctgt     30900
     cttgaccaga cagatttgta aacgatcagt ggtcaagata tgaatcatct caaagattga     30960
     tgcttcggtc tcgttcgtgg ttgtaactgt agaccaaaga ttaggtccga ggtagagctc     31020
     gaattgcgtt gagggtttgt cgtcataacc gccgtgaagg aaattggctc tgattagata     31080
     ttcgtcgcct atggttaggt ttaaggtata gcagtttctt atgccttgtg gaaaactccg     31140
     taggttcctt gtggaagaag taaaagtgtt aggttttaag ataacattca ttgatcttga     31200
     gaaagctatt tattatacca tgtttgttgc tgaaactgag tccggtatcc ttgtttgatg     31260
     cttccaccaa caccggtatt gatgaaattc gcatcggaaa tgtaagtaat gtttgttgtt     31320
     ttctcacgaa agctagtttc tctaggcgaa ccgcaatcca aactgatgaa tcctgagaac     31380
     aaagcaaaga aaaagcttta gaagaaactt ttgaatcaat gaagatgtta tattttttta     31440
     cctgactgat cttgagcaag acaaagaagt aaagctgaga agatttgcag aagaactaag     31500
     agaaaacaag aagaaaacgc cattaatatt cgtcactttg gttttaattg tttccttgtt     31560
     tttgtgagac tagaaagtga agaatcaaaa gaagatatat gtggtgtaat taaagaaatg     31620
     aaagatggaa ttgttttctt tttgtctgaa ccgcgttagt actggttact attatgatga     31680
     gctcaaagtc aaccttttgg tagaggtgac caattgtgaa tttttttacg ttaagaggcg     31740
     ttgacgtata acaaaaatgc agaatttcta aattcgagtt agacaatgac attacgggga     31800
     aaatttagct aatcttaaaa tttcaccaat aatttcgatt ttaaaatatt taaactattg     31860
     ttttaactaa atattcatct ggttaagtca ttgaagaaga ttgtctttct gccaataagc     31920
     tacacttcat tgatctgtaa taaatctgac gagggtatgg agcttactga aaaatatatg     31980
     ttgattgttc accagaaaaa aaggcaagaa aaacattaga aatatgtttt gatttaatga     32040
     aagtttataa gttataacca taattcagtt gaattttttt acgaaaacta aaacgaaacg     32100
     aaacattaaa ttttgagaag tcagaaggaa agtggttggt gacttggtga ggagctaata     32160
     atacatgcac caataaaaca actctgatta tggagagacg accacgactt cactgaacca     32220
     aaaaaaaaaa aaaatgagag aaaaatatat ggtcaatatc aatttggcat cattattaca     32280
     agaatcatag cctagtgggg cgatatacat gcatcttcta tatattaata gacatgtaac     32340
     aattgaaaca gttttttaat tcgtaaatgt ctcatgttaa ttattgatat ttagtataaa     32400
     gctgctgtaa attaatttgt atttatattg aaaatattac ataaatagaa aatatttctt     32460
     aatttaaata atttccttta gagaactcga aagttataat tttggttgta atttattttc     32520
     ttctttacta tattatcatc ataaatatcc taatctaatc ctactatata tagtaggatc     32580
     aatcattcgg atttcaaaca attccacgat gttcagtttt ctcagcaaaa cgtgatcttt     32640
     tactgacgat tattatatac atgtgtcata ccaacgataa acagtcttat ctctagcatt     32700
     tgtaaccact ctctaatgta aaaacctcta aaacttgagt accgatcaaa gaggcttcca     32760
     caattggttg tttattattg aaaattaact acagtaaaag attctcaaaa ttcaccatta     32820
     aacgtattat tgtcatgaga atattgttga agaaaaaaaa agtcatgaga atatcaaaaa     32880
     ttcaaatata cgaactttaa aaatcgatta attttttatt tattacgata tgtttaacta     32940
     catatgttat cttcttgtta attctatagt gaaatctttt tcaacatata ctaatgtata     33000
     agtaattaat ttaatttatt tttttggcaa aaaagtaatt tttattttgt tacgaactgt     33060
     taaatcatgc gaaaaatcta ttttctaaag aagttggtat ctctacattt tctgagaaaa     33120
     tgatttaaat cgataaatta atcaattttt aaaaatttgt ggattatttt gttcgaaaga     33180
     aaaaaagatt tggatcttct aaaccctact gattccgcac tagctaatag cttttagatg     33240
     ccctaaactg ctttaatttt atttaaaaaa ttttcagcca cgacacattt attatcaaca     33300
     tgtttaaaag aatatatagt tatacataaa tacaaaagga aacaaaaaat caaaaaccaa     33360
     aatcaagtgg tctaaatagt atacttttgg acatgatcgg cgaatgtcga tatccgattt     33420
     ccaaatatct cgagaagaaa cgagtgcaca tggcctaacc ttattaaggt ttgactgttg     33480
     actttggttt gttttgatgt cagccgttga cttttcgttt tttgtttctt ttcctgaaaa     33540
     caaaatttaa agtaaattct ataaatgtat gttagaactg attatgcgta tttgcttagc     33600
     gacgcgaaat cttgtttatg gacttttagt ttcttacttc tagacttcta gtataaaata     33660
     tcttatttag aaataatagc attttagtag aaaatgttga agtaaagaaa aatcatatca     33720
     ttagctgttg aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa caggttttga ccaaaaaaat     33780
     catcatactg tattactgta cagtgtacat gtactttaat tataaatcag aatcatggat     33840
     gattcgataa ataatacttt cttaatatgc atatatcaag taacaggagg agaggagact     33900
     ttaatttcaa tggcacaacg agtccattgt ctacgatgtg ggacagatta gcctaaaggt     33960
     atgaaacaaa tctgagggtg aatttctgaa aacaatgaaa actatgagaa accctgatag     34020
     ccattacatt cacaggacgt ccaagtggaa gaatgacctg ttttataaca tggaagtcgc     34080
     tcaggaatct atggatccaa tactgctgca cctttcatta tcgctgccac gtttttcttc     34140
     ttctcctcta cttgtcttgt cttcttaact tttttgtgtg tttttattgt ctttctcttt     34200
     aggtttagtt gcaaagcctc ttgtgaaatt agtaaagaca ttgtgagaat aatggttgtt     34260
     taaggatgta cgaagaatcc tatgagacat aactccagca cctgctggtg aagtcaaacc     34320
     acaaccggtg gtgaagacct ttctcatcag ccaaaaacgt tgcaaattcg ccattattcc     34380
     gacagacttc aggagaagga aaaaaaaagt aagcgtgtag ctaggtcaac ttacgtgaag     34440
     atcttaatta ggttttctct tttgtactag tcgtaggcat aacaactttt ttctatcaaa     34500
     aaaaggaaat ttgcaagaat ttacaaaaaa taaactaatc acttcaaaat aacccttaat     34560
     ttactacaat tttaactatt ttcggtatca gaatatcgat ttgatacaaa ttctcagcaa     34620
     caatctccct ttatattgat tcttccgaca caagtttctg atttacacac catttaccaa     34680
     gtggttttgt tcaaacaaat catggtgcaa gacacttttt acccaattgt cttgttaggt     34740
     tacaaagtta tagattttct gacccatttt ttacagaaca attacagagt agagaaccca     34800
     tgtgaacata agcattttgt tttggtcaaa ccaaagaaat taagaaagtc tctggttttt     34860
     gtctacacat atcgttgact tgttcattaa catatacaca agttatctaa agaaatcaac     34920
     taaagaaaaa acaagttggc tttcttgttg attagtgttc tacttgctgt tagataatga     34980
     tttatacgtt gtgacttgtg agcacacaaa attgatatct accaaagagt tgacattgtc     35040
     ttcaagttgt tgactttgaa cccaaaaaaa actctggtgt ttctcagaaa tggataaacc     35100
     agttttaaga aataggagat gatggttgtt tctgctgttt gaagaaccga aatgatgaca     35160
     tcgaaggcga aggcgcttac gttcatttgt tgtgtggctc ttctcaatct tgccattgcc     35220
     caggatcaat caggtttggt caaattatag attatgctct tctttgatct tttatctaca     35280
     tgatgaaaaa acagagaaat tttaagttaa aaactggttt ttaaacatct gaatagggtt     35340
     cattagcata gattgcgggt tacaaccaga aaattccagc tacacggaaa catcgaccga     35400
     tattaagtat gtttcggatt caagttatac ggatacaggg acaagctatt tcgttgcgcc     35460
     tgaaaataga caaaatatga agcagagcat gtggtccgtc agaagttttc cagagggaat     35520
     cagaaactgt tacactattg ctgttaatag cagcaccaag tatctgatcc gggcggattt     35580
     tatgtacggt aactacgatt cgagaaacga gataccgggt ttcgatcttc acttaggtcc     35640
     aaacaaatgg gacactgttg aattggtgtc tcctctgcaa acagtgtcca aggagatcat     35700
     atattatgtg ttgacagata caatacaagt gtgtttagtg aatacaggaa atggtacgcc     35760
     ttttatatcg gtattggaac ttagacagtt gccgaattct tcctatgcag ctcaatctga     35820
     atcacttcaa ctatttcaac ggttggattt tggatcaacg acaaatctaa cggttaggta     35880
     tccaaacgat gtttttgatc ggatttggtt tcccgccacg ccaaatggga cgaagccgtt     35940
     aagtgacccg tcgacttctc tcacaagcaa cagtaccggt aatttccgtc ttccacaagt     36000
     tgtaatgaga actggaattg taccagataa tccaagagga tttgtagatt ttggatggat     36060
     tccagatgat ccgtctcttg agtttttctt ttacttgtat ttcacggaac ttcaacaacc     36120
     taattccgga accgtagaaa caagagaatt cgtgatcttg ttgaacggga agtcttttgg     36180
     ggaaccgtta agtcttaact acttccggac cttagccttg ttcacttcaa accctttgaa     36240
     agcagagagc ttccagtttt ctcttcgtca gactcagagt tcatctcttc cacctctgat     36300
     caatgctatg gagacttact ttgtaaacaa acttccacaa tcatcaacgg atccaaacga     36360
     ccgtaagctc tctcattcct ctgcttttcc atttcagacc tctgcatttt ctcattctcc     36420
     cggtcttttt gaatgtttat agtttctgct atgaggaata ttaagtctgc atataaagtc     36480
     aagagaaact gggaaggaga cgtgtgtgtg cctcaagctt acacatggga aggtctgaat     36540
     tgtagcttca atggcacaaa catgccaaga gtaatagcat tgtaagtgtc ttataaacag     36600
     tttccttctc tcaatcttga gtgagtctca gaagttatta gctctatgca acagaaactt     36660
     atcgtccgcc ggattgactg gagagataac gtctgatata tcgcgtcttt cgcagttgca     36720
     aattctgtaa gtttattctc ttattggtat aaaggtatga aaaatagtag aagtttctca     36780
     tatatttaac tttcagggac ttatcaaata acaatttgag tggacctgca gtaccagctt     36840
     tcttagcgca actccaattc ctgagagtcc tgtatgtatt ttctcaaaga actaatctta     36900
     aaagaactca cagcttatag tatgtagtaa atgacattat ctactgtggg ttttgtagac     36960
     atttggcgaa caaccagctt agtggtccta taccctctag tctcatagag agactagact     37020
     cgtttaggta cttcaaaaaa aaaacacttt tctttctcat cctatatatg ttttgagaaa     37080
     ccgacggtta actcataatc cttagtatct aatgcagtat cagtgggaat ccaagtattt     37140
     gttctgcaaa tgcgtgtgaa gaggtctcac aaaatagatc aaagaagaat aaacttccca     37200
     gctttgtcat tcctttagtt gcatcacttg cagggctgct tcttcttttt atcatatctg     37260
     cagctatatt tttaatcctc atgagaaaaa agaaacaagg tatgttttag tgaagttaca     37320
     tgttttcaag tttatgggaa gaggttgttg gtgatgtgta tggtttttgc tgcaggtcga     37380
     acgattaacc ggacagttac agctacgagt aatggaccgt cattacagag gagagatact     37440
     ggttcaatgc gtccatctat gcagcgaaga gaaaccggtt tttcaacaag accatcttta     37500
     cagagaatag agagcggaat gacagactac ggagggaatg aaacagcggt tgatgcgttt     37560
     gatttggaac catcaaatag gaagtttaca tatgcagaga ttgtgaacat tacaaatggg     37620
     tttgatagag atcaagggaa ggtaggattt ggaagaaact accttggaaa gttagatggt     37680
     aaagaagtaa ctgtcaagct tgtttcttca ctatcttctc aaggctacaa acaactcaga     37740
     gcagaggtat atgctctgtt tactaaccaa tttttttgtt ttttgttgag agttaatgaa     37800
     aagagactta gaagagttta ttgtaggtca aacatctttt cagaattcat cataaaaacc     37860
     ttataaccat gcttggttac tgcaacgaag gcgataaaat ggcggttata tacgagtaca     37920
     tggctaatgg aaacttgaaa caacatatct caggttttga aatcttgttc tgccttacat     37980
     acttcttcaa gtaagaccaa tatctcagtt atgatcttct cttgtgcaga gaacagtaca     38040
     actgttttta gctgggaaga taggctcggt atcgcggttg atgtcgcgca aggttagcat     38100
     ttgaaactct ctcctgtatt ggactgaaac aatttctatt tggagttctg tttataaaac     38160
     atgttctgtt attgcgactg aattatagga cttgagtatt tgcatactgg ttgcaagccg     38220
     ccgatcattc atagaaacgt caagtgtaca aatgtattct tagatgaaag tttcaatgcg     38280
     aagttaggcg gttttggcct ttcgagagcg tttgatgcag ccgagggaag tcatttgaat     38340
     acagctattg ctgggactcc tggatatgtt gaccccgagt aagctcaaaa cttcgtaaaa     38400
     taataaatgt tcttcctttt tttggttttc ttcaaatgaa gattgatctg tcattgcagg     38460
     tattacacat caaacatgtt aacagagaag agtgatgtgt acagtttcgg tgtagttcta     38520
     ttagagatcg ttactgcgaa acccgctatc ataaagaatg aggaaaggat gcatataagt     38580
     caatgggttg agtctttgct ttcaagagaa aatattgtag agattcttga cccgagtctt     38640
     tgcggagact atgacccaaa ctcggcattc aagaccgtgg aaatagccgt ggcttgcgtt     38700
     tgtcgaaatt cgggcgacag acctgggatg agtcaagtgg tgacggctct taaggagagt     38760
     ttagctgtag aagttgagag gaaaaagcat ttgccggttg gatcaacaga ttcacttgaa     38820
     gagcttgcac ttggctttgg atctaatcca cctcctcgtt tgagatgatt atttattgat     38880
     tttgtttttt gtaatgtttt gtggtctctg aaaataattt gttatatatg tcttcttctt     38940
     tttttgtgag ttgatataac caaaaaaatc gttgtgcata caggcttgat ccagatatga     39000
     ggatttttct taccgtttat agtttgggtc tgactagggt tttgtatggg gaaattttgc     39060
     aaggccttta cttgtgacct aaggaacttc cagttttctg tcctcctctg tttctctttg     39120
     gtgacttaga ctccgtaact aatagaactt gacactgccg tttattttat tgattgacaa     39180
     ctgagaatta cagggaataa ctgttaccat gtaaccatgg ttgacatttt cgataggtac     39240
     atgagatgaa gaagagagat ccaaagttgg catcaaagtt catctttatt tggcgatgaa     39300
     gatgagtcaa gaagatatct tgtggccaaa gaagcaagaa gggaagcacc ataagggagt     39360
     aattcttcat taacttcaaa aaacggagag tgagggttcg ccattggtga atgagatttg     39420
     ttctgcatcc caacaaagct aaaatgtccc gggattgctt gttggtagaa agcaaaatcc     39480
     tctgatacca tcactggtag cgtctcaaca taattctcaa tccctaacat atccactgaa     39540
     acgttcttgt aaaacaggtg caaggtttta ttgttcacag tcggcgggaa aggaggagtc     39600
     tcatcttcaa gaaagtcaac tgttgcatta cacatattta cgcttgcttg cgttgtgata     39660
     acctgaaaca ttggatctcg cgttttaaag tttggtctcg agaggagagg aagacacatc     39720
     agagtgcaaa gttactgacc tgaacaattc tttgcttgag ttgctcaaaa cttttaggta     39780
     aaagggctcg gaatgtgcca ccgatagtaa cagagtcggg aatgacatta aaagcatcac     39840
     tgccttcaaa tgtagcaact gtaaccacct gtaagcactc aaatcaacca acatcctata     39900
     atataagaga cacttttctt gaagagccaa aagagtaact atatatacct gcgagtctaa     39960
     aggatctgcc tctcgtgaaa cgaggtgttg taagctcaga ataacatttg aagctgccaa     40020
     tactggatct atggcgaatt gaggaagagc tgcatgacct cctttcccgc ttatcgtagc     40080
     tttgaaacgt ccactaccag ccatcaatag accctctctt gagctcagtt gacctaatcc     40140
     caatagattc gaaacatgta atccaaagat tgcacccaca ttctccaata ctccagcctc     40200
     cacgattttc tttgcacctg ctcctccttc ctcagctggt tggaaaacca gaatcactgt     40260
     accatgatga ataaaatgtc caacaagtgt taataagaaa ccaaacaacc tgatgattgc     40320
     aacagtttga aaatgttatt agctaaaaaa tacagcacaa tacaatacta aacctgtagc     40380
     tcttcttggt gttctttgag caactttgca gcaccgagga gcatcgtagt gtgagcgtca     40440
     tgtccgcaag cgtgcatctt ccctggaatc ttactcttgt gttcccattc caccatttcc     40500
     tacacaattc catcattacc atgttcaata agaatccact agcttgcaac tcaagtaatt     40560
     taaaatcaca taagaaatct gatccataag tcaaatgata atggttatat cttaaatgcc     40620
     agttagtatt gtttgttgta ctaaaacaaa tattcagaaa aaaaacaaat ttaaaacatg     40680
     acaccatttc gactagcaaa atatgatcag tgattaaata atttgggctt gaagggaata     40740
     gattcaaaaa ctttgtaaat gaaaacctta ttatacctga ataggaagtg catccatatc     40800
     agccctcaaa gcaacaaagg gggcatggcc agttccaaca tatccaataa caccagttac     40860
     agcaactgga ttcttataag acacacccat cttgtccaat tctgtcttga ctagcttaga     40920
     tgtctctact tcctcgtaac ctaactctgg gttctcgtgg atcctccttc ttattccaac     40980
     catccaatcg aaaaaatctt ctcttttagc tagactaagg aaatttttag gaatttgaga     41040
     caaatcattc gaggaacatg aaatcagaca cgagtttagt aagtgaagga tcaaaacaaa     41100
     agaaaccaat ttgcagaaac tcatcgtgaa tcaagagatt gcgtgatgat gaagtaagaa     41160
     accatgaagg aagaagcggc atttataacc aagaactcac ataatagcaa gcgaaataca     41220
     acacggaaac ttaataaaaa tcttcatatc ttttgtaatt ttcttcggtc ccaagtcacc     41280
     ataaaatata ttcttttcca aattgattac catcaactac cgaaggtttc ttgttagtat     41340
     ctcaaattat tttgacgttg gacagaattt aaatatttca ttttaagcgc tcaataaata     41400
     tcggttcgag tttgaaccca ataaacatgt ggaacatatt tcaccgtgaa gttgaaccta     41460
     agacattaat tgtattttcg gttaaaatgt aaatctgctt gtttgcaaag taattaaatt     41520
     ataaaatgaa atttaaagga ttgtttagaa gatacaccgt aaataaaagt ttcgagttat     41580
     ctgatttgca agatctttcc tcttttgttt ggaaaatcat ttcgttttca tttcaagttt     41640
     tcgtgacacg tgaagaaaaa agaactagaa attgaacggt tgtagttgtt ggacggtgtg     41700
     gtgtggtaca tttgctcttg ctacaaatag ctataaagca cggctataac gtgtttgatg     41760
     gattctttca taaaatttat ttccgtattt aaaataaata cattaaataa aatagaaaca     41820
     ttttgccgaa ccatttccgt gattggttta aaatgctagc aatcagagcc ggctctgacc     41880
     tgaagcagct aaagctcata tatgctttag gcacatgatt ttcttcgtaa ttttatgggc     41940
     atctatttcc agttttgatc gtagaatcat ccgttatgcg ccgcataagt tgtttaatta     42000
     acaacatggg cctattgggc tactctcttt tttcttttgt tgctttaaat gggttatttt     42060
     gggttcttaa ttgttttaaa tgagactgaa cttttggatt tggtatttta tagtttttta     42120
     tcccttaaat ccaaaagttc agtctcatgc atagtttttg caaaaacaat tccaaatttt     42180
     atagtttttg atccctctaa ttgcaatcac ttttccttga taccatgaga aaatgcaaat     42240
     gaaacatgcc aacacaacaa catttagaag aaaatgcctt tactcttctt taaaaaacga     42300
     gtaatttttc gacttctaaa catagaacaa gagtaacgga tgctcctagg ggctgaaaag     42360
     aactcaaaac tccctttatt caataatctg tcatgtcaaa aaatatgttt aaccttcaca     42420
     atacctgtaa tatcattgtg aaagaggaga ttaactaatg atcagttcgg tccatgatca     42480
     tactctaaac tcaagaactt ctcaaaacaa ataccaagag tgacgagtgg aagatatgtt     42540
     agagcctaac tcaagaatct tgggtgcaag ttgcagtaaa ggctccaatg cgcttggagc     42600
     aaactttctg gcaaagagat aacagatttg agactgatga tcattgtaga ggcaagattt     42660
     ggctcctgta agcttcttga gaaaactttc cgttacatca gccttaccaa aagtagctgg     42720
     atgagcacca ccacgtgacc aatctgtcca tgtcaatgtc ctattagcaa gcaaaacccg     42780
     atgtttcata gacaacattg ttgggaagta atgttcatct acatagcatg gaggtctaca     42840
     aaactctttg aatttgggat agtaagtagt gtcttgaaca atctcaacag cgagtttccg     42900
     gttaatttca aaccactgag acccttttcg ccactggctt agtgtgatct caggttccat     42960
     ttctgtcctg tatctgcctc ttccatcagg tccttcctca tcagcagcac ccataaaact     43020
     atatcttgat tcagagacat aactatagat aaagctgaaa cctcgcagag gaatgcatga     43080
     ttcagacagc agaacaaacc attcattaga gatatcaagc aacgcattag ccaaaagcct     43140
     cctctctgct tcacccatac tcatctctcc ccatgccaca gcctataaca cagaagaaac     43200
     taatactgtg agaacacaag aaacaaacac aaaacaagat tttcctctga aacatcaatg     43260
     acagtacctg actagggata tatcttctgt aaaacacaga cgacctcgaa aaatccgatt     43320
     tgtaactagg caacgaatga acatagatag aataaagacc ctcatgtcct ttacagaact     43380
     tctcccaaag tggagcaaat ggtaaaggac ctttggcaag aaacatgaaa gccaatttag     43440
     ggacacgtct aaacggataa ccatttcttt gcggctctat agaagcacgc caaagcaatt     43500
     cactatcatt cattgtgtgc caaacattgg aaggaggtct aataaagcta tctaaagtaa     43560
     cactctcatg attatacgta gagagcaaag taattggagc cacaggatct aaacgttgaa     43620
     tcttcaaaaa cttgatcatg tgtatactaa caacagagat cccaagagtc aaaacaagaa     43680
     acaataacag aatctgaagc agacgcaacg gtaagagagc tctagattgg tttgtgactc     43740
     tagatttagg tgttgatgaa ccattttctt taacacattc ctccatctcc attaccatca     43800
     ctttcatcta aaagcttctc actttcttag ctatcttcaa atgcttacac aaaaatccaa     43860
     tctttacggg aaatgtttgt acgacaacaa caaaaaatgg gttttttata gaaacccaga     43920
     agaaaagatt tgtgattttc aaagaagcaa agatcagaac ttgaatctaa agaagaagaa     43980
     gaaaaaacaa gaaagaaaaa ttgaatcttt atcagttaga catgttaaca agctctcgaa     44040
     ttttagcatt tgtttatgcg tcgaatcttc tgaaatctct caatctgatt tgtttaaatt     44100
     gaccgtttca gctctctcat tgcaatggcc caaatctgtt tttgtttgca gtaataacat     44160
     ttcttggatt taatagaagc ttgacactgc ataacaattt attaatcttt acatggcagg     44220
     ctctgtaaaa aagaaaaaac tgttaccatg ttttgacatt tttcagagta gaagaatagg     44280
     agaagccaat gtttgttggc atcaaagttc atcttttttg ttactcttat ttagagttga     44340
     agcttttagt tcaagaagat atcttgtggc catggaagca tgaagggaag caccataagg     44400
     tagtaattct tcgttaactt caaagtacgg cgagtgaggg ctcgccattg gtgaacgagc     44460
     tttgttttgc attccaacga agctaaaatg tcccgggatt gcttgttggt agaaagagaa     44520
     atcttctgat cccattaatg gttgcatctc gacgtaattc tcaatcccta acatatcgcc     44580
     tgaaacgttc ttgaaaaact ggtgtaaggc tttgtcattt acagttggtg ggaaaaaagg     44640
     tttctcctct tcaatgaaat ccactgttgc attacacata ttcacgctcg cttgccttgt     44700
     gataacctga aacattggat ttgcaaagag agttaaaaca gttcggtaag acaaaagttt     44760
     acacatcaga gggtaaagtt actgacctgc tcaattcttt tcttgagttg cataaagctt     44820
     ttagttgaaa aagctcggaa tgtaccaccg atagtaacag agtcaggaat cacattgaaa     44880
     gcaccaccgc cttcaaattt agcaactgta accacctgta agcactcgca tagataaaat     44940
     caatccacat gctatataga gacatttgaa gagccaaaga ttatatttat tacctgagag     45000
     tctaaaggat ctgcctctcg tgaaacgagg tgttgtaagc taacaataac atttgaagct     45060
     gccagtatcg gatctatggt atgctgcgga agagctgcgt ggcctccttt cccgcttatc     45120
     ttagctttga aaaagccact accagccaac ataggaccct ctctcgagct cacttgacct     45180
     aatgccaatt gatttgtgac atgtaatcca aagattgcac tcacattctc caacactcca     45240
     gcctccacaa tcttctttgc acctcctcct ccttcctcag ctggttggaa aactagaacc     45300
     actgtgccct gatcaagaaa atgtccaaca agtttcaaga atccaaacat catgatgatt     45360
     tcgacagact caaattttaa aactaggaaa atccagtgtc aaaactaaac ctgtagctct     45420
     tcttcatgtt ctttgagcaa ttttgcagca ccgagaagca tcgtagtgtg agcgtcatgt     45480
     ccacaagcgt gcatcttccc tggaacctta ctcttgtgtt cccattccac catttcctac     45540
     acaatccaac ataatctgtc caataagaat ccacccaaaa caaaacaaca cttaccataa     45600
     ttccaccaac aattcaagaa actgcaaatc acatcagaaa tcagatccca cagagaagta     45660
     aactcaacaa atcttcaact acactataga tacatataac caaaaccgaa aacacaaaac     45720
     ttcaagtatc aaacagaaaa acaaaaacaa aaaaagccac actgttccat gagaagctaa     45780
     gagaacaagt caattccaga ttttgagagc aaatacctgc atagcaagtg catccatatc     45840
     agcccttaaa gcaacaaaag gagcatgacc agttccaaca tacccaacaa caccagtaac     45900
     agcaactggg tacttataag aaacacccat cttctccaac tctgctctaa caagcttaga     45960
     tgtctctact tcctcataac ctaactctgg attctcatgg attctccttc tgattccaac     46020
     catccaatcg aaaaaatcat tccttttagc caaagtaaga aactttgaag gtatttgaga     46080
     taacccatta gaggaacatg aaatcagagt cggattaagc aagtgaagga tcaaaacaaa     46140
     agaaacccat ttgaagaaac tcatgactta tctcggattc gattgattga tacttgaatc     46200
     aatcgaatcg tgtagagaaa aagaagagat cgaagaagtt aagagaggtg tgcgtgatga     46260
     tgaagcaggg gtacaagaag caaaaaagtg gtatttaaat cccaagtagc caaagctcaa     46320
     agccaaacac aacttaactt cgtctctatt ttctcatgaa gtctttcatt ttattttatt     46380
     ttattctatt ttaatttttt tttggtaatt ttcctcgaat cccaaaatta tttgtaagaa     46440
     aacattcgtt tacgtgactg atttaatgat taatttgata actttttttt tgttgaaaag     46500
     agtgatggga tcttcttttc tttggattaa aacttaaaaa ttgtaaataa gccaaacaag     46560
     ccaccattct ttccctacat gtctcttgtt gaagtttctg catttggaaa ttgtgtaatt     46620
     ttaacgtcaa agaaattatt atctcactgt tttatacaag tagccaaatt gaagtaagaa     46680
     aagtagccaa actcaaatta tatgaaccgt aaagattatt ttttaattat taaacataat     46740
     aagaaaaaac aaaacaagtt tgtgtttttg ataaagtgca tttcactatc gtgtactaat     46800
     tttcaaaatc ttttttcttt tggattggag gaattatttt tcgttttcat attcattttt     46860
     aagttcttct tgtgacacgt gaaaaaagaa aagtataaca ttgaatggtt ctaatctaat     46920
     tggtggacgg tccattttgc tgttggtacg aacagctata acgcacgtgg agaacgtgtt     46980
     taataaattc aatttagtgt ttttttcctt ctcttttttg ataaaaagtt gatttttctg     47040
     ttcttcccat atttaaacaa taatatattg caagattagt tgacgtaata atccactagc     47100
     actagagctt gaataattat ccgagttctt attcgatcat gaaaataaga tgtctatagt     47160
     gaccggatct tagattgtaa aatcatggat ccgtcgaaac aagttcgaga tcaagataaa     47220
     tgaaccctta tttaggacaa ttaaatattt ttatacaaat tttcactctt aatcttaaat     47280
     ttccatctca tgtggtaaga gccgccccaa gagatttgag tgtctaaagc atttttaagt     47340
     tcatacattt agaaaagtca caaaataaca aaattgagat ttaaactatg caccataaaa     47400
     acaattatct acatttagag ctaaccacta cactataaaa tgttttcaga aattgatgcc     47460
     ctttgtacta catatatttt ttggcgccta aagcaaagcc tttaccagtt ttaggctagg     47520
     accggccctg tatacggtaa tgcatttcaa aacacaaaat aaatgattaa agatggcatg     47580
     atgcccatat ctgtatctgg aactagaacg agaactctcg tatttaatag caacaaacct     47640
     accaaaatgg gttggtaacc tagttgtagc tcaagtggtt gattcctttg cgctccggat     47700
     tcaaaccttc ttttaggacg gaaagacatt tattaaatag taatgaactc aaaattgatt     47760
     ccagacacta aaaaatatat aaggtcaaaa gatctgaaat tcgcacaatt taacataaaa     47820
     gaaaagaaaa aaaaaaaaaa gcttagaaga atctaaataa gacttacaat caatggaacg     47880
     atatgcgcct taagctcaac tcattgattg ctttgagagt ctacattccg gagtatcatc     47940
     attttagtgg aatgatataa tcaattagcc acttttgtcc aagctggatg taatcaatca     48000
     tctcttaagg ttatacccaa aaagttatac ctcaaaaatt ctagatcctc tcaaaaacta     48060
     aaataaaata ttaaaatctc atgatcaata agtaacaata atagaattca aaaggaaata     48120
     ggaactagga acgttacatc tgcgaaagtg taacacaatc ttagaccatt caacatatat     48180
     ttccaaagct ctcctacacc ttcttgtctc ttaaacgaaa tcttggcaca ccaaatatgt     48240
     gtcttagatt cgcgactttg atcgcaagac accatcacca ccatcgacca aactatcact     48300
     cttcttcttc ctccgtcaaa ataagtttta agacatatct ctgaaagcac atatgtacat     48360
     gttctatccc gtcccgttcc atttcttgtt tttccattcc ccaatttttg caagtaaacc     48420
     ataaatgcat actttattta tttttttgaa gaaaatgtca aattatattc aaaaagaaaa     48480
     ataacttttt acatcagctt aatcttatgt gagttgaaat agttgttttg ataagaaatt     48540
     acaatctgag agcttaacag aaagagcaga gagagtctag agccttgtcg agaaccagac     48600
     ttgtaatccg ttctcgtagc ggcggtctcc tgtcgagatt atgatggaga gttgattgcg     48660
     aatctgtttg tccatccaac taatgagatt ggctgacgtt ctaggctcct caccatggcg     48720
     tcgatcattt ctctccttcc aaaccgtgtg tactgtgagt tggaagatat atcgtgacaa     48780
     aaagctccga attcgatcag tttgagtctc tgagatgtaa ttcactattg tctgccaatc     48840
     tgttgagaat cgatgttgta aaacattctt tgcaattgca gtccagatcg ctgaggcata     48900
     actacacgag aagaacaagt ggtctcgtgt ttcaatagat gtggagcaga atgtacactt     48960
     cacatcggag ccattattcc aaagctgcat tcgatatccc gttgataacc tattacgcaa     49020
     agcaagccaa gtacagaact gatatttcgg agtagagtga ctgaaccata cccctttata     49080
     ccaagccacc tcgtttgatt ttttacgaac ctgattccat gtgtctttgg tggaaaaact     49140
     tgtcttaaaa acgtccccct tacctctcca taaagttgca tcttctcgaa gcaaattgcg     49200
     tgtctgatat ttctggttta aggctgcctc aatatcattt agctgttctg ttcgatgttt     49260
     ccttctcctt ctattactcc aagcctctgc cactgttttg ttccggctta ttccaaggtc     49320
     tatttgcccc ctctgtcctg ttacatccat caaatggccc attcccgacc agttatcaaa     49380
     ccagaacgaa gtccgagctc cattattcac ctctactctg ctaaacggct tcgctgtttc     49440
     tctatacttc aacatttttt tccacatcca agatcctaag cttgagttgg gcgttagaga     49500
     ccaaaaagac tcttgtttaa gcagattcat ttttgaccat ttaacccaca gtgaatcatc     49560
     attcgaggtt actctccata tcaactttaa aacactcacc acattcgcct ctgttaaaga     49620
     ccgcagacca agtcctcctt cttgttttgg tttgcaaatg tcatcccatg ataccttcgc     49680
     ctttcgacga tgtagctctg gtcctgacca taaaaatgct gaacaaatac tgtttatctc     49740
     ttttaggcat gcacttggta atcgaaatgc actcatccaa aagttcattg tactccataa     49800
     aacagaactt ataagattta aacgacctgc aaaagagaga taacgtgagg tccatgttcc     49860
     aattcgattg cgtatctgct caaaaagggg ggagaggtct tctttggtga gtcgtttggt     49920
     tactagtggg agaccgagat atctaaccgg gagctgaccc aaaccaaatg ggtagcgact     49980
     gatcatcatg taacgattgt gatcagagac tccagctgtg tacaatgttg ttttctccat     50040
     attgatttgt aaccctgaac gtttagcaaa taggttcata acttcgacaa tgccatctac     50100
     tgaacggact ttaccatcag taagtatcat gaggtcatcg gcaaaacaga gatgagtgag     50160
     tccaaggttt ttgcatttcg ggtgaaaacc aaatcgtttc cctcccgctg cctgatctaa     50220
     catctttgag agaacttcca tactaatgac aaacaaatat ggagatagcg cgcatccttg     50280
     tcggattcct cttgcacttc tgaaataacc tgctaactca ccattgacct gaactgaaaa     50340
     agatgttgta gtaatgcaac gagatatcca gtgaataaac tcgccaggga aattcatagc     50400
     agataaagca ttgataagga aggaccattg aagagagtcg aaagctttcg agatatcaat     50460
     tttcatggca caacgtgttg aaacgttact cttatgataa tccttgacca attccgttgc     50520
     tagaagtaca ttttcaatga gaagtctatc ataaatgcat actttaatct aagctttcca     50580
     tagatattat gtaagaacaa aagtattaat gttttctatt ttctcattca ttgtttacca     50640
     gaatgttcgt gtgaattgtg attgtaaagt tcctctccca tatatataat ccatctccat     50700
     cttttcttgc actttaagcc aacaacatac atcaacaact ttcaaattaa taacctaaaa     50760
     gaagttgcag caaaaagtga tcgttgaaac gagttttggc tttaatgcca agattgacac     50820
     tgaactgaaa atgtcacttt tattaagagt ttatttgccc ttgtgagggt tttaaggaat     50880
     caaagattcg gtgaactttc tgaaatagaa tgataaacac agagcaagaa caagaacaag     50940
     aacagacttt cttcctcatc gacaagagaa cttgagagta caagaaaaca aacaattttg     51000
     agttacctga aacaaggaaa attctttcta agcagccaac aatctcatat cactcccacc     51060
     taatctcaag cttttttatc agttttacat ctcaaccact aactactgat atatttacat     51120
     ttgctcactt ccaacttctc caaaacagtc tattttcatc tcagtttaag cttcgaaacc     51180
     cagacagata gatgacgaga aaacaaaaaa acgtaaagcc agccaaaaat ctatcttctc     51240
     tgtctctcat gttttggctg cagaaggcaa tgctcggtgc tgtgtttgtc ttgctgaccc     51300
     tttcaacact tcatttatcc tactgaaaac tactttcaac ggtatacaag ctacaaccgt     51360
     ttcctttgcc ttctctgttg tctgcttctt gcttctttcc gtcaacctct ggctcgttag     51420
     agtagagagc cgcctagtct ttactgacag ggaagacgat ttcttctttg agttccatga     51480
     aaaaccacgg gacttcttct tcttgccatt ctttttgggc aatgacttcg ccttcgcaac     51540
     aactggaggc atcaccatac cattggagta gtcttcttcc aagatttcaa cacttaaagg     51600
     atgtccaaca atagctttgc cactcaattc actcatacga gacaccagtg gaactcgggg     51660
     tttggtatag cttgctttta cctcaatctt cacctcatac agcgtagaat gaggcgtaga     51720
     actgttgtta ttagcttctt cgccgtacac atttcttctc tcttcttgtt tcttactcat     51780
     ctgcctcgag ttcctctttc ctttcagctg ccacttagaa gtgttcttct caatcccgct     51840
     caaaatacag ttgacaggtt ctgaagctgg tggacttgta caagctgatc cgttacttgc     51900
     ctcattctta acaaacacat tgtgactatt ccgaccacac cgcctggtta aatcagtaac     51960
     aagagctttc cttggtgagg agattctaca agctgccgga aagcctaaaa tattacaatg     52020
     gatgtcagca taaatgacag tgttcacaaa ccaaaacaga ggaaaacgat tctgccataa     52080
     gagcaagcaa ctaaattaga tctaagagat ccataccttc agatcctaag aaggtggaga     52140
     aaacacaata atagcagatt ttgaatgcag aagcaattta gtgataaaac aagtcaaggc     52200
     caaaaatata aagaatgcaa tttagctata aaacaagtca aacgttagga agaactctag     52260
     aaaatggtca ttgaacctct ttaatctatc atgtaaccat taacaagctt ttggtccttt     52320
     tacttccaag aagaggagat atgcagattc atgaaactag agcagccaaa acataaacaa     52380
     agacttaaga gaggtttaac cacttatacc ttctgagtgg ttttcttctc cggttagtgg     52440
     aacatcaaat aatctgtcag aagaatcatc ctctgcggaa acagatatgc tggaaatctc     52500
     actgtctttt gccttgttgt tatgggaggc tccgacaaca ttttcataag catcctcaca     52560
     tgacaccccg gtactgtccg agttattgtt gattacaaca gaaacgcttt tcatggattc     52620
     aacagactcc attcctgata ctttgctgtc ataaatccct tgacaatcca aactgacacc     52680
     ttggtcacag gtaacaggga cagagaccat agctgtactc tctaaaacct ttgtcaattg     52740
     gcggcgtcgg tttttccttt tagagcactc actaacattt ctttttaacg atgacgggga     52800
     gcataccttg ttcccattgg caatagtatt tccattcgac actgaatcac tgaggcctac     52860
     agcacagatc aaatccaaat cttgcttatg ctcgactata ccaccagcct gttctttccc     52920
     aatatcctca agccctctca ttcgcttgac cccttcagtc ccatcatctt ccgagtcatt     52980
     tggtgttctt cttctctttg actgcacttt agaagctcca acgttattca tttcttggga     53040
     agatatactg gattgcaatt gctctggcgc tgaagccaac tcatcatctt cagtctcttc     53100
     tgcatcagag gagcccgaat cttcatcctc tttgccagag agacacctct tagaatcttc     53160
     ctcaccagat aaattacaca aattatcatc ttcttttgca agatgttcat tctcaatctt     53220
     gagagcattg ttaatggcat cttctcggag agtacacttg ccagacctct tcttactaga     53280
     gctcgccttt gccttctcaa tgcaagtatc atactctcca caacgaaacg ccttcaccgt     53340
     cttggaattt tcaagaatat accaatccct ggagtcataa agaacaacac ttttaaccgc     53400
     aatttcaaac tgattattct acatatcgga aaggcataaa ggcaaagaga atgcgattgt     53460
     ggaaaagaga agagactcac acgctaacat cgtcacgacc tagaagcttt attggagtgc     53520
     cgactttggg accaaccaaa gagttgtcag gaacttggtc atgaaccaaa gtctgtccag     53580
     gccaccaaga cccgttacgg cggcgaaccc ataccaatct tcctactgac gcattaatag     53640
     cctccaagtt tcggtcatca ttactctcca ttacaacaaa aacacccaaa actctcaacc     53700
     cctcttaagg acaagacagt acacaaaaga aacagagaga caaattgcca cacaaaaatt     53760
     ccaaacttga cctaaaaatc aaaactttat aatttgaaaa tctcaatgaa gtgactttct     53820
     ttcactaaac aaaagtatgc ccccttcttg aatcctgcaa ccaacaaaaa tcattggaaa     53880
     aatcttaaaa gagagaacat gcaacaaaga actcagaagt tgaaaacaat tagctaagct     53940
     ggttaaaaac agtttcttga gaaagagaga tctgagaaga agcagaaatc catgtacctc     54000
     ttttcactac tctgcggcgt taggaggttt ctatctgtct atgaatcaga tagcattagg     54060
     accgcatttg tcttcgggtt gtgagaaaag ggtttttgct ccggcggttt aatgaatgga     54120
     agacagagag agcagaggag aggagagaga aagggcttgt tttggatgga gagagagaga     54180
     gagactgaga gagaagagga ggtcaaaaaa gcacatccaa ggtgagagaa ctctaactag     54240
     aagtaacttc agatgcaaac gacaccgttt ggagaacttt tgtcctctct tttaggttta     54300
     tttatcttac gtcgctactt aggccacgag gcaactgttt agttctatat tcagacatct     54360
     gatctcaaag gtgtcaaatt tggtaataaa tgaacgtgag ttggatcaaa gtactgtacc     54420
     ttccaaagtc tcattatttt tgttttaaca tttaaaccca tttccaaatt ttcataattt     54480
     atagttaaca atcaaaatct acaaaaactg tgtgaagttg ttgttggaga atggtttttt     54540
     aactgtacca atccaagaac aagacggaga aagtaaggac gaagaaaaac agtaagagaa     54600
     aggttctgct gctgctgttt cgttggattg cttgagaaag ctctttgttt ccaagctcca     54660
     cgttctttgt tgcctcaact gcctgcattt agtgtcaaac tgagtgagaa aaagggcctc     54720
     aagacacaca cacacacaca taaagagagc caccaagtca gtcataagct gtacgtttac     54780
     agagtaggaa aactgcaaag ccccataaac taaagtattg ggaatggcat tgagtcattg     54840
     acacattcaa atggagtttt agagacttta catagctaaa aacattaacc gttccatttc     54900
     ctaccactaa attggagagc aattaaaatt ggaccaatac aaagtttctt tcccgtctct     54960
     atacctaatt taggtgaatg tgacaaggaa aagttctgaa tacaataagc atccgaattt     55020
     aactttgaga tagcaaagga gtgtaaagaa cagtgaaagc ctaacaaaac agtgtgttga     55080
     catgagagcg ttagagaagt taataagtcc taacctggtc ataaagaaac tctatctgtt     55140
     gggcttgctg cagaacatga gttgccatca agtggtttaa tgcagacatc tccaccatct     55200
     tagtttctgt ctgcctagca ccatctaaaa gattacttag ctctacctgc aaaaattatc     55260
     aatttcaaaa tttagcataa ctacaaaact tatgcaagtt ttcgaagatc atgtatattt     55320
     gccttgttac ctgaagggct tgtgtttcat cgtctagaag ttgttgttgt tgtaatctac     55380
     gaggttgggc ctggatttca tccggttcta tggactccga atttcccaga gttgtattaa     55440
     ttggggtagc ttcctttatg accctcttag gttttcttct cggcatagct ctgtttataa     55500
     tatcttggaa acgagtagct ctaagctgat caaactgggc agtgactgaa tgaagtttct     55560
     cactcagaat caaaacctgc atacaaaaaa aattaccatt acttctacac atctagatac     55620
     tttgaaagaa aacatagtaa aaaaaaacca aagttggctt actacattgg tgcatatcat     55680
     accactccat gtttgtgtgc tatagaatca gcattgaagt tatctgcggg gaggccaagc     55740
     catcctttgg agtttgcttc ttcatttcta atactgttta tgagaatatc gatctgttct     55800
     ttgcaagctt taataaaagc agcaacctgc aagagggaga gagagagagt ttgatgatat     55860
     tacacaacac ataagtagac atagttctcg atcaaacact gcaagaggta taagaataca     55920
     agatccaagt tcctcagtgt cacaatatac taactccctc gctatctaaa gtaatagaca     55980
     ttaatcttcc tgagttatct caatatgagt tgctacattt cttatgattc catagttcca     56040
     tatgttcaat ctcaactcaa gcatagattt atcgcagtaa cttcatgagt tcagatatat     56100
     actacgggca agcctagctc agagtactta cttcttgttc aatactatcc ttttcctgtt     56160
     ctgtagtccg gtgcagatca acataatcct ttcgatgctt caacataaac agttccaact     56220
     ccttgatgct atcaagctaa atcaaccaac atagacaagt tggtagcaac accacatcag     56280
     aatcattcaa taatgcaaca aacatatttc agataaaaat gctgaatcac taaaggtacc     56340
     gttttgaaag cagctttcgt gaaaggcgat ctctcctttg gcttatgtat aataaaagac     56400
     gccattgttg atgccacttt agactgccac acaaatacaa acgaatcaga taaatgttaa     56460
     caaaaacaac aatccaaaac cctgaaaacc ctaaggaatg atcataattg agatgcaaaa     56520
     aaatcctctc tttttgacaa atagcttcga tcaaacgaga ttgaagacga aaggtgactc     56580
     gcgtacctca ttataaccta tcgaaacagc ggaattccga acagaatcct tgaaatcctc     56640
     cgtcctgtct ctgaatctcg acatcttgta cccaaaattc agatcgatca atgcttattc     56700
     ttccttatca atcaatcagt caatagcttc aaaaaaacag tctctttaga ttcaaagaag     56760
     ggtttttttc tccggcgatt cggagaagaa acccaaagga aatcgaagaa gaagagggtc     56820
     acagagaaga tcggagagga gaagagaagc gagaagagag agagagagag agaaaaaggc     56880
     ctttcatttt tttctgtttc gtaaaaaata aaataaagtg agaaatccat tcgacgacac     56940
     cgttttgggg atcgtaaagt tctgattctc tcctttaggt ttatctctcg ttaacgtcgc     57000
     tcttggtcac gaggcgactc tcactgtgga gttcgatatt caggcaatct caaaagcttc     57060
     cacgacaaag gtgtcaaatt tggtcatcat gacgggtgag ttcgatcaat ttacttcaaa     57120
     agtttcttaa tttcttcgtt taacatcgaa tctttgattc cttaagctta tcattagatg     57180
     ggagagtaat tagattccga ttgatcttga tttctgacag attgatttga gaattattgg     57240
     gtgttatgtt gtgtctcttg tagagtataa gcaggagcag gaaatggaga ttgaagctct     57300
     tgaagctata cttatggatg agtttaaagg tgagtttttt ttagtttcct tgtatgttca     57360
     tcattgagcc gatgatgaga gcattgaatc cttaacgact gttttgtgaa cagaaattca     57420
     ttctagtgaa agtgggctta atacttcgaa tcgatgcttt cagattacag tgactcctca     57480
     ggtagacaac accattcatc tatttccttc actttgtttg tcatttgtga aaagcttatg     57540
     tgttataagt gtagaaatgt caactgaaat atcttctgct tcttctttgg tctttatagg     57600
     atgatgaact ggaggaatta gcaatcccac caggttattg gtctttaaag aagatacctt     57660
     gttgtatcat atgcctctcc tgtactttct cagtcttata gctctcaatt tgtcttgcag     57720
     ttcagctggc tttggttttc tcgcacacag aaaattaccc ggacgaggct ccgcttttgg     57780
     atgttaaaag gtaattcttg gttaaccaat tttatcaagc taaaacagat atatgatgat     57840
     gacactcatg tgggtagagt attcttccag tattcgagga atccatgtta gtgacctcac     57900
     catcttgaaa gagaagcttg aacaagaggt aatatatttg tacaacttta tggcttgtta     57960
     taaattttat acatgaagta taaaactgga aggcctctgg tctatgctgt ttctacaccg     58020
     aattgcatgc ctgaacacaa agctattttt cacaggcatc tgaaaatcta ggtatggcca     58080
     tgatctatac actggtctca tcagcaaagg actggttgtc tgaacactat gggcaagatg     58140
     atgcagctga atttgccgaa gtagaagctg ccaaagagga tgaggtattg ttgtctgctc     58200
     agtatttcag atataagctg caaagaacct caagtctttt ttgcatgata tatgtgtctg     58260
     ccttcgtatc gcttgttctc ttcctgtcta aattttattt ttgcaggtaa ttgtccctca     58320
     tggagaacct gttacgctag agacattttt ggcgtggaga gagagatatg aggcagagct     58380
     tgcacttgag cgagccaagt gagtaaactt tccctgcata ttcttcttgt ttccttgctc     58440
     ttatatacca ttgaacactg actgagttat taatttttta tctgtggccg tgaattaatt     58500
     tctaaggttg atgccggagt ctgctcttac agcacctaag gagaagaagc ttacaggaag     58560
     acagtggttc gaaagtggga gaggggtatg tctcattctt gtttattatc ggactcatgt     58620
     tagaatttca ttatctaaac aagtactatt gttgttaact gtcttgttca gagaggaacg     58680
     gtggtcattg ctgatgagga agatgaggag gaagatgagg aagacatcga ctttgaagac     58740
     gaagactttg aaggtgaaat agtctttctt tttggtttac acgcgattat ccataagcaa     58800
     ccaatggttc tcaagaaccg ctttgttttt ttttgataca gatgacgaag aagacatgct     58860
     tgagcactat ttggcggaga aatctgattc ttccgctccc ccaacaagga catgaagcta     58920
     agggagagcc ttatatactg ataattgaag ctcttttctg gatagagatc atgatgcaag     58980
     atactgacct tgcattgaga agcatttaat ctccatatct tcagttttcc gagttttgat     59040
     ccactcaaga gtaccctgag aattaccatt tgtcttaaat ctataaaatt taccatgtca     59100
     tctataaaaa cactgtagga gagaatgcca ctgattttgt aacttttttg tttagcatca     59160
     gctcaaagca aatctctctg tcaaaagaca aatagttaaa atttggaccc ttgcaacctt     59220
     gtttaagctc tgcgttatca gtttcttcca tctttgttag tcacataact taagttaaca     59280
     tactatggct gaaaaaggtt tattcctatc agagtatgta atttctaaat aatgatatag     59340
     atttccatct aatatgttac agagagtcca atgttacttc attacgttta cagaactcct     59400
     gccggtactt aagatgcagg gccattttgc tagacacaac cttggtccgt catggcttga     59460
     gctatgttca aaaatgctgc aatcgttgct ccatgaagta gtgccctgac atcaaaaccg     59520
     aatattattc caatcctttg gattcacaat agtaacgagc acgaggaagc tacagagcag     59580
     cttaggccaa catagtacag taactgttgg tttatgacga ggagaaaaac ttactcagga     59640
     ctttcttttt gataaccgaa atcatttgct gctttaagag ctttttcata agtctgcttc     59700
     agtgcttcct atcaatatca gagcagttat cttaatagga aattatcaca ggccaaagct     59760
     gtaaattttt gaaagaaata tgagacatgt tgttacctgt aatctagact caaaatcttc     59820
     tgctgaccat tgcattgaat tagattcacg gagtacttcg atttcaccag cagcaacctt     59880
     caacaaagtt atacaattta gctaccattt tttatacaat ctaagaaact tttttgtgtt     59940
     ttgggttcat accccgcata atacaatcaa aaacaaactg atacagctct attggactct     60000
     cagtaaaacc acactcctac acattctttt atgacagcag cagagaattc ctctccaatg     60060
     ccttagtgtt gtaatttaat gatcggaaga ctaataaaaa atactttaaa ttgtagtatc     60120
     gatgtaaatg cgtaaaagaa gcaactcact cctccagctc cagcagcaat ggcaggagca     60180
     atcagaacat tcgcctttct gaaaacatcg actgcttcag ctgtacacgg catgtttgaa     60240
     cctgcacaaa aaacatccat actgcttagg ataaggtaac aaaagaacag caaaaaccta     60300
     acgtaaacac aaaacgagag gccctgaaat agttgcttga tataagaaat ctctaccttc     60360
     taccagtaaa cggcatcctg cattgaccag attaatggca tccgcttgat caacttcatt     60420
     ctgagaagca caaggaaatg ccacatcaca cctttcattc caaggcttta attcatcaaa     60480
     gtatttcgcc cttgcatagg tcttggaata gtctctgcat aacagacaca tgtacagttg     60540
     ggatctatat gattaaccaa gtgacaaata ctatagtatt ctaggacgac aaatacctca     60600
     gacttctctg ttgagatttt atatctctca agaatgcaag tttcatataa tcaaatccat     60660
     catcgtccac caaatatcct tttgaatctg caggaagttt gcatcagcaa aaaagtttgc     60720
     tttctatgga atcaaattgc aaaccgaaaa ccaaatcatt ttcacagaaa gctaatcctt     60780
     gagcagcaca atacgtcaca gacagctgaa ttgacttctt acattggcct aactaatcaa     60840
     gatcaattgg caataactag agaattaatt tgagacctct aagtctaagc ccttggccta     60900
     gaaaaagaaa attatacgta caagccactt ctgacctttc atctggcaga ctgggcctta     60960
     aattgattct cagctcaact aaaagacacc ttagagatgg tgaaaacaac aaaaatgcag     61020
     aaaagctata cacttgagtt gcttcaaatc tggaatgata agatgagtgg attacctgaa     61080
     acagtaaccg gatgggctcc acaagcaatt agcttctcta caacatgcat cgcaatcttc     61140
     ccgcaaccac tcacgacaca tctgaaataa attatagaag agtttatggt ttcataagat     61200
     gagagtcaca aaattgtaca caagtcacac agcttcagtg ttatgtgaga agccaaatat     61260
     tgacagaata attagcaaga actaaaaaag tgtcggaaga ggaaaacgaa agtaaaatgt     61320
     atcttgctta ttagattaac tcagagatcc aaaacaacat tggtacatat ttaaaatgat     61380
     caagaaagaa accttagtcc ctttatttcc ttattcatat ctgcaagtat aagtcgtgca     61440
     aagtacacct gaaagtatgc aagtgatttt tagttcatac agagtcatga catgttgata     61500
     gtgttcttca tattttttta ttaaaaaatt atccttacca cgccatagcc actagcttca     61560
     gttctgaggc tagaagcagc ccaatatatc cgcggtcctg taaaacttcc ctgcataagt     61620
     attgacacaa agatataaca gccaaaactc tttattctct cccaacagca aaaactaatg     61680
     caaataaatg actataagaa tagtatagac gatgacattt ggcactgaaa tgttccagaa     61740
     atgagagaat gaacacagag atcagtagag atatattctt ccctccaaaa tcacaaatat     61800
     tactcccaaa aaggataaaa caaataaaga ccaactagat aagaaataac ttataaagga     61860
     atgagaacca aatcaaaaat ttactgccat tttgttgcca ggaaaaaaaa aaggaggagg     61920
     caacagactc tcagtacctg aaactgacca gcaagtcgtc tatattgtcc aaaaagatat     61980
     cccatttccc gagtaccaac accaacctcc tctgacggaa gatcctacag tataatagat     62040
     ttaaaaatca ttgcagaaag gatgtacttg ctaaagggta aaaaacattc tacttacttt     62100
     gtcaggaccc atatatctgt acatctcatt catgaaactt tggcaaaatc tcataatctg     62160
     cgatgttgca aaacaacata tcagaacacc tgtaagagat cacttgcagg gaaaaatgca     62220
     aggggcgaag atatcacctc attgtcactt tttcctttag gatcaaagtc gcttccacca     62280
     gaagcccctc ccagtttata tggtgacaga gcattcttca acgtctgcga aagattaaaa     62340
     acccattaca attctgaatc ataagaacag ttaaggtggc aaccgggaaa aagaagaagg     62400
     aaaatgacaa acagtataag gtgaaaaata agagaaatca gaggaaatat aatggaatat     62460
     aactgatgga aatcacagta cctgctgaaa gccaagaaat ttggcaatgc ttaagttcat     62520
     ggatgggtga aatcggatac ctcccctaca tggacccaga gcttggttga actgaactct     62580
     aaagccacgg tttacatgtg tttcaccacg gtcatcaatc catggaactc gaaagactat     62640
     catacgttca ggttctagta gccgctccat gatattgaca taactgaaat taatcagcat     62700
     ggaacagtgt gatttgaatg cggtttccag aaaactattt tacaaagatg agaagaaaat     62760
     cgtaacttac tgagaatttt ttgcaatcac ccgctctaga gcatgcacag attcttgtac     62820
     agattgaaca aactcaattt cattaggatc tcgtttcagg gcaccctcaa caattgaacc     62880
     agcactcttt gacatgacag cttcattgag aggaaaagtg caaacagtta aaaaaacaat     62940
     aagcaggaaa aggcactagg agtaagacca aaaacagaaa accaaggagt caaccttttt     63000
     ctttcatatt agaaaacgaa aaagacaatc tatctcttga tcacaaaaat attaaactcc     63060
     aaaagctatg gaaagcagca taccaagaat gtacaacttg cgagttaaaa aaaaaaaaaa     63120
     aaaactacaa cttcctccct ttcacaaaac taactgcatc taagcctctg ttagtaaaat     63180
     atttcctatt aagagttgct tctttttcat cactcaagcc tggaaagttt actaatatag     63240
     gatataaaat tggagaaagc tcaaagatat ccaacataaa tgcaaagcat atgttaacac     63300
     actgttagct gaaaggttgt tcagtgcagg ttggtcagat gaaacaaaag gagttgcaaa     63360
     tgatcttgac tcactacata taaaaagaaa tcaatcactt gaaacaataa tgtaaataac     63420
     ttactcttca cataaatggg cttgtcaaca acaatcttat ctttggaagc cgtttggaga     63480
     cgcagagcct ctttgtgtag caaactattg ttgtgttcct ctaaagcact catctgcatg     63540
     tttctacttc cttcatttcc gtaaggattt cttcgatgtt ttctaccata ttctctgcaa     63600
     atagagcaga atatcctagc tgtaccatcc ttcatatcaa cataagccca cttgtacgtg     63660
     tcagcccatt cctctctcca ccgtttgaca acttttttct ttctcttcgc cggtgtaccc     63720
     tttgaaatat cctgatcctc actgggaagg tcagatacca aaaccatatg ctttgtttca     63780
     tcatgttccc cagtggaggg ctcccgtgga ggcccgccaa tcaatgaatt gttagcaaaa     63840
     gcagcatcat cctctccagg tccaatttcc aaatcaatct cttccccaag attacttaca     63900
     acaagctgat gcctttgtgc ttgctggatt aagttcatat catccattga gggattcatc     63960
     cccaacccac ctgttggtcc aaacattcag catcacagtt ttaactcccc cttagcttca     64020
     cttttgctga ctaccagcaa ctgtatctta cacttggtac gatgctcgaa atgacaacct     64080
     agtgcgcaac agatataaac ggtccaccat cagaacaaag ccaaaaatta atatagatac     64140
     aaaaaaaaca ccagccatat ttcagtactt ttcagcagat agcaatggca tactagactt     64200
     catctaccaa gaaatgcaca atatagaggc atcaagcaaa taacatgaat actacaaagg     64260
     aaaatttccc agaaaatgat gtgaaatcaa atcagagacc aatgagttaa atcattttga     64320
     gttaaatcca atgagttaaa tcattttgat catccatcta agcttgtgaa catatttggg     64380
     ggaaaattcg ttccagacaa tgaacttatc acttggagaa tcatccaaac atcaagactc     64440
     aaaaattcag aaccagctcg taaagtatga atctttgcca caagaaacaa ttcctaactc     64500
     aaaaaaactt caatcacacc aaaatttact gaatacctaa caagccgcag cacttgaaac     64560
     atttgatcaa atctaacatc tttcacaaaa tcaataagct aactttggca tacccagagg     64620
     ttggaaactt caatatagtg agagatactt gctgatttta gcagataatt tcgtaaagct     64680
     aaaatgaaga agacccaaaa aaaaagaaaa aaagattaca actttacttt gcctgtagcg     64740
     acgggtcgcc gaaaaagaga aacccacaaa gacaattgtc gcttaagact aaagagacat     64800
     aaagtctgtt cggctcgaac ttgttgataa ttttggtgtc ttcgcagatt ctgatgagag     64860
     ctttgagcgg ggataaagat aaatcgacca aagcgattgg tattgcagac gcaaaataat     64920
     aaaaaaccaa caaaaagaga gaaaaatccc aaatcaaaag gttaatgcgt aagaagtaag     64980
     aactactaac ttcttaaggg tttaatctag tttatctaat ttcttttttt tattaactca     65040
     tttaactatt tgttctaaga aaataatacg catttccttt agaacaaata ttcattcttt     65100
     caccaaataa aaaagaacaa attacaaata taaactcaag aataaataat atgttcaaaa     65160
     aattctatta aataaactaa ataatatatg tttttcatca aaaaaataaa taaaatatca     65220
     ggtaaatttc cctaattctt tatatattat gcaaattata gattggctac tatacatttg     65280
     ttatcataaa gtgatagtaa ccaatataaa ttttttaaaa aaaaattaat aaaacagtta     65340
     ttccgtataa taaggattaa ctatggactg gacattgtgg atccaaagat gtcaaaaaat     65400
     atatatattt ttttaaaaac atatatatat atatatatat attatttctt ggtgcaaaac     65460
     aaataaaatt ctacttaaaa actgaaattg agtggaaaag aaaaataaaa aaaaataaaa     65520
     aaaatcatat gccttaatcg atcatatgtg tgtagacaga aaagagatga tcttatgtta     65580
     acccaaattt tcaaccggtt taattagaat tgaagtgaca tataaccgga gggagctgat     65640
     atttagaacc gagattcaaa ctaaccggac aaacccgagt ggaaccggat ccaaccccaa     65700
     acccgacccg ctccaaaagg aagagacggt gacatatatc ggaactttgt agaatcagac     65760
     aacaaaaagc aaaatctaat ttcgttgccg tctctccaag caagaagaag cctctcagtt     65820
     ctcacagcga agatgcctac aggttccttc tctttcgatt tcttcgataa ctaatgctta     65880
     atcgatctat ttctcctcgt ttacttcttc gaatccattt ctctgtcggt gttgttgtag     65940
     atgtactcct ttcgagtttt cgtaatctgg attccgatga ttaggttttt gattttgccg     66000
     agagttgata gtgaagtttg tgtcgtctgg gatagtggat gatgtttgga tttgactgat     66060
     gtaaatccta atttgttgtt gatttttgtt tgattttgac agtaagcgtg aagtggcaaa     66120
     agaaagtgtt ggatggtatc gagattgacg ttagtctgcc tccttatgtt ttcaaggctc     66180
     agttgtatga tttgactgga gttccaccag aacgccaaaa gatcatggtc aaaggtggtc     66240
     tcttaaaggt aacgttggat tcattggttg ctgcccgggt tttactgaat gctatattat     66300
     gatctgtgtg tcctagattg tttattgatg ttgatgataa agtcttatct gtttcaattg     66360
     atgcaggatg atggagattg ggctgctatt ggtgtgaaag atgtaaagct ctctctctct     66420
     ctctcttttt ttgcattcat tagcactttc ttttacatga actgctttgt tgaaatgatg     66480
     gttgttgatt ttttgttcat tctagggtca aaaattgatg atgatgggaa ctgctgatga     66540
     gatagtgaaa gctcctgaga aggccattgt ttttgcagag gatctacctg aagaagcgct     66600
     agccactaat ctggtattta cttttgactg ctgattatga gtgtgcacgt gtgtaatcgt     66660
     tgttgttaac ttttacaatg tttggaccct agagaaaatg cacgtttcat agagttccgg     66720
     taacagaaga tagacccaaa tttttgttag gcattgtgaa aactggtttt gtttgtactg     66780
     tatattcaga aaatttatgt atccttccca actaacaaac attacaattg atttcagggt     66840
     tacagtgctg gccttgtcaa tcttggcaac acgtgttaca tgaactccac ggtgcagtgc     66900
     ttaaaatctg tcccagagtt gaaatctgca ttatccaagt cagtttatct cttatccttc     66960
     tctgtgctta acaaaaatac ccaggaaatt cattttcttt attcagtatc tttatctcat     67020
     acaaataatt tcctcttaat agttactcac ttgctgcccg aagcaatgat gttgaccaga     67080
     cttctcacat gctcacagtt gccacacgtg agttatttgg tgagcttgat agaagtgtca     67140
     atgctgtttc gccttcacag ttctggatgg ttagtctttt tccatataat actttctaat     67200
     atttgtgctt ctctttccat gtagctcatc tggactattt aaatcagaga aataattacc     67260
     catccaaaac agttgatccc ttcaattgcc atgacagaat ttaacttgta atagaaatat     67320
     ttgcatagac tctaaatagg tcaacaaaat tcatcttcag actcatctat gatagatata     67380
     caatcatata tctgtggggt tgtatggaag cgtcaactca aatgtctttt gcgagtttat     67440
     catcagtgtc cataattcat cataagattt ggaaacttca agctcgtggc tcattcatac     67500
     caactttggt cttgatgcag gtattacgaa aaaagtatcc tcagtttagt cagttgcaga     67560
     atggaatgca catgcagcag gtttgttctt attgcaaact atgttgcatt aagctttttc     67620
     agttttcacc tttcagtgtg tgaactcatg ttttaaatgt ctgacaggat gctgaagaat     67680
     gttggacaca actgttatac accctttctc agtccctaaa agcaccaact tccagcgaag     67740
     gtgctgatgc tgtgaaagct ctatttggtg tcaatctcca gagcaggtat ctgagcaaat     67800
     ttcaaatttc agtgtcatat ctcacttatt ttatctgtat aaatcatgca tttaataaac     67860
     aatgtgaaca gtcttctgcc gtaaactcct cctccatacc cttgcggggt atcctgatta     67920
     gctgagtaat ttgcagaaca gagggaaata cttgaaattt tgtagttaca acatttcact     67980
     ttgtcatttt ctacctctca ggataaaatt aggtgtgctt gataatgtta cagacagtac     68040
     tgtgatatca aagtgcacgt atgtgggtgt gtctgcatgt agcatatatt tattgagggt     68100
     cttcctacag ggaaatatat caaattttgg ttgtgatgtt tgtccatgtg aaaattgaca     68160
     actgaagatg taaatacttg agtggtgttt ttcaccttgc ttagttaatt taattcggat     68220
     tggttcatgt gctgtaggtt gcattgtcaa gaaagtggcg aagaaagctc agagacagaa     68280
     tctgtatatt ctctaaaatg tcatatatca catgaagtga accacttgca tgaaggatta     68340
     aaacatgtga gcaactttta taattccatt atagactttg tttctgattt ttcagcatgt     68400
     ttctcggata caaaaaaaat aggacagcgt ttgctatatt ctgcttatta taaatttttt     68460
     ttttttgatg aacggcttca atttttctgg tttactgaag ggactgaaag gggaacttga     68520
     aaaaacatct cctgctcttg gccgtactgc actctacgtc aaggagtcac ttatagattc     68580
     cttgccaagg tgatcagtct ctgcttattg tttgcgactt ttatttcacc tctcagtttt     68640
     ctgtaaccct cttgtggcat gcttcatatt cagcatgcac cagagaatgt actttgtcaa     68700
     cttactaatg tagtgcaact tctaaccttt taccactgac acgaagtttc tttctcttat     68760
     tactgatctt gaaggtactt gactgttcag ttcgtgcggt ttttctggaa aagggagagt     68820
     aatcagaaag caaagatcct cagggtacgt ttgctttcta tttttgtgtc ttaagcaaaa     68880
     gtccagatgc tcatcattct tatggtaatg tctccaattt gttgatcttt gaagaaagtg     68940
     gattacccgc tggtgttgga tatatttgac ctttgctctg aggatcttcg gaagaaactg     69000
     gaagctcctc gccaggtttg ctctgtctac tgaggtgacc tcaaattatc tgaactggtt     69060
     aaccaaatca actgacagct gtgtctttca gaaacttaga gaggaggaag gtaaaaagct     69120
     tggtcttcaa actagtgcta agagtggctc aaaggacagt gatgtgaaaa tgactgatgc     69180
     agaggtacaa tatctattgg acttagagat cttatatcaa gtccaatctt ctaagaatat     69240
     tttttgctct gcatttgttt gcaggcgtct gcaaatggaa gtggagaatc atccacagta     69300
     aacccacagg aaggtacatt atctaagacc cccttttcaa catttttctt ttctggcttg     69360
     gaaagagcgg taattggttt gtgtaaatac tttgatgatt gtttgtctat ctatagatct     69420
     catttcaaag caatcaagaa ccttgtcaga gcctaattgt gaggaatcta attctgttat     69480
     ataatggaac tttttaggta cttcttctga gaaggaaact cacatgactg gaatctatga     69540
     cttggtcgct gtgttgaccc acaagggcag gagtgcagac tctggtcatt atgttgcatg     69600
     ggtcaagcaa gagagtggtt agttccagtc tctaataaac tttacctctc tcacatctct     69660
     ctagcattta caacaattca catgttttac aggcaaatgg attcaatatg atgatgacaa     69720
     cccgagcatg caacgcgaag aagacatcac aaagctatct ggaggaggta aactcgataa     69780
     ctttaatcca cttcttttat aactcgcata cagtagttct cgtgatttat ttcttctttc     69840
     tctgctggtt tatctgatat tcacaggtga ttggcatatg gcgtacatca caatgtacaa     69900
     agcccgcttc gtctccatgt aatctctctc tttcttttga tgaatttagt tcttgaaaca     69960
     ttcagatcat taaaaagctt atgtagacca cctcagaaat ttcagtttta cattgttaca     70020
     aaatggattt tgtcactaaa ctattaagac cgaaatttat tttatcttac gactcttttt     70080
     acccttgttt cacgttatgg ctctttattt tatcctcgat ttagactaca tgtactgtag     70140
     taactgtact gctgaaaata gccttcaaaa atgaccagac aagcccccga atatatattg     70200
     tggtccataa aatcaaggaa tataaataga atggcccatc aaaagaggag ttatgggatg     70260
     agagttgtaa caaatatggt taagcattgt caaatcaaac taatcccaat acataattga     70320
     taacaactca tcagtcatca tttcaaatca ttttataaac tagaagccta agaagtggac     70380
     tacattgatt tcttgagact tatccatcca cttggaccac attttaatat ttctttttga     70440
     cttttccttc aatttttttg ctcattcaca taatacttgc tagtaagatc aggtgtgatc     70500
     gtaactacat agatttgtga tcatagaatc tgtatcatac atgtaaacgc ggtgactttt     70560
     tattatatgt ttccttacaa agaaatagaa tatatgtcaa ctcttaattt cacattagga     70620
     caataatata attccaaaag aaatagatat tcatcaaata cttatcatca tataaaactc     70680
     gctagagttt gcggaaatgt ttttttttct aaataacact cactaaagcc aatttgggtg     70740
     gaaaatgacg aaaaacaaag tgaaaaaaaa tgactacagc gctaaatgga ccgacatcat     70800
     ttgttgttat gtttgactat gagatgacta aaaaaaagac atctatgtca aattgaccaa     70860
     attacccttc gcctcttcaa ttcttctcca ttctgttcat agctaagtca gtccacgtgt     70920
     catcactcct ccgtaccgaa cccaaaccca aatccatacc tggtaaccaa cgcgacccgg     70980
     actcgtaaac aagcccaccc atctgcatat tcgacgccaa caacgaacta aaactcgcac     71040
     cattcggatc tccaactggt aacccgtata acatccgggt cggattcatt tcttgacccg     71100
     aaactctctc ttctttttct tctgacccgg acccatgatg atcaggtttc tcagcgacgg     71160
     tttggttctt gagattacta gacggagaag aaccggatcg tttgttgctt ttccgagttc     71220
     caccaccgac ggggatgtta cgaagagcac cgcctttagt ccagtaacga cgacagtttt     71280
     tgcaaaagtg acggggctgt gacagattgt aattgttgta gtaacagaat ttagtgttag     71340
     gtgagtcaca gcgaggacac tttagctgtt cttgttctgg taactctggt tggttctgtt     71400
     tcgccgtcgt catcatcatc gactgatgat aatacgctgc tgctgacgtc agatcctgca     71460
     tttttctttt ccccgggaaa atttctgact ctgcacacaa tctttgatcg gaaaaagttt     71520
     gtttcttacg tgaaaatatt ggtttatgaa gagagagaga cctttgatgg aatctttttt     71580
     ggtgtgggaa gttgcaagtt ataggagaag gaggaagaga gataaagagt ggagttattt     71640
     ggtggtgggt ttattttcat ttataaccac aaaatgacaa ttttttcaag cctttctaga     71700
     tttttttttg tgttttgggt atatatatgg agagaaaaga gagtttgtgt tgatgaagat     71760
     ttcaagattt atttcttgtt gacctttgtt ttctattttg taattttgct aattgttttt     71820
     tactttattt tatagtcttg gctttattga tttggttcta tttcttatgt taattgtatt     71880
     tttattattt ttacgaatgt aaatatatca tagaaatgaa aacaatccta ctatattatt     71940
     tgggaagtac attttaaatg taaccttatt ttttgtaagt aattacatat gtatgccatt     72000
     agaaataaaa tttaaatagt aaattaattc atctctttaa aaattaaaaa gtcaaatact     72060
     aatttaatta aaaatgaaat acattattaa ttttcaaaaa agtaaccaat taaaatcaac     72120
     aaattagatt tgatactaaa ttatcatatt aattttttat taattattat agttcagctc     72180
     tcatctttat atgattctat ttttgcgaaa aaataatatc atcgttataa aaaaataatt     72240
     agagtttttt cgcatatgcc ataatttgaa tttttaaaaa cgaatataaa ttgttcaatt     72300
     catgaaaaaa tattataacg ggtcaaaaat agatttaaga aaattttcta ctgagtactg     72360
     ggtcataatt tgaatatttg tattcaattt catatatatt attttaaaaa tttataatct     72420
     tatatactac aataattaat aacacattag atttttttat gtgtatgatg tgattcaatt     72480
     tttaatacaa ggtggaaaat cctagaattg acgagtttaa atcgatatta atacaagatg     72540
     gtatactaca ggtgaaactc taaaattaac aatcaaaata caattacata attttaaata     72600
     ctaaacaata taaataatat caaaaaacac atacaactcg cagtttacta tacatttaaa     72660
     attaaataaa ataatatcat atatttataa tcatctttgc aataaaagtt tttagtttaa     72720
     ctaaaatata agcctacatg cggtatgatt tactacctaa tagaataatt ctaaatattc     72780
     gggtctggtt cgggtaggat ccagttgggt ttgggttagt ttggataaaa agtttcagac     72840
     cctaaaaata cccaaaaaat agaaacagga attttgtatg tagatagcgg gtctccaaac     72900
     aaaaaaaact tttaaatttg ttaagtttta ataaatttaa ttatatttga atatatttta     72960
     ctaaattttg acaaacataa caaataattt ttgaatagtt tagttgtttt ggatatttag     73020
     gtccaaaatt aattgacata tttagattta taattataat cttagataat tagatgatat     73080
     tacgattaaa tataattaat attttggata ttaaattaat gtttgggttt ttgaatactt     73140
     tttttgggta acgggtaatt tttggaccaa tcggatatcc acgggtttac taaaactcta     73200
     cccaataagg aaatttccta aaattttaac ccgccctaac ccggtttttt ggttcggata     73260
     ttgggttggt tatcgggtcc gtttcttcgt cagccctatc aaagataatc taatataggc     73320
     cctaattaga tctacaaata taaccaaaat actatacaaa gactaattct aagttaggcc     73380
     aaaaattaga tcctctaata caaaggaaac atgtttctta ccaaaacaat ttgtatacaa     73440
     attttacaca ttaacttaaa actacatatg ttgtatttat tataaacata acatttttaa     73500
     acaaagtcaa tctaatgcag cattatatgc aaatagtaaa aacattgaaa aatattatga     73560
     aattactttt atactatact atttcttatg taattcaaac aaaatataca atttaattta     73620
     tacaaaatat taatacccgt gctatacaac acgggttatg atctagttta ggtttacaat     73680
     tgataaatat atatctacaa aaatagtttc atggctaaaa aaataaaaat atgaaagtat     73740
     aaaccataac taaaatttgg tccttccact caaccaaagc agtgaaacta agggagttag     73800
     ataaagcgat gccaattttg attgctcttt ccgaaattgt tgctggagaa gaagggtata     73860
     atgcaaggag aaggagctta attgctaaag actatattag aagtctttca ttggacatct     73920
     gagattgagt tgtcaacgac aaataactca aaatcttcaa tcacatgcat ctcctccggt     73980
     atgtgaaagc gatctgaaaa tcacattcat gagctttccc aaaacaaaac ctcgcggacc     74040
     aacttatgca aacgctgcaa gctccctcta tcaagttcaa tctcgaagtc tgctagtaca     74100
     gaggaagata aaacattcta atattaattt tgtttacata ttatatgtat ttttaaaaat     74160
     aagtgttgtt ttaaaatttt ttgatgtagt ttatatgtat cgttattttt tatgtaaata     74220
     ataataaaat tttgaaactt ctgtaaaaca acatcacaat aatgtttttt aaatcacaat     74280
     aatgttttaa agataattgt gttgtgaatt acatcaattt atatattgct tctaatatga     74340
     taatgttcaa gaatattttg ggatttgtca tatggttgtt ttgaatgtag tctttgggag     74400
     gatgaatgag aggagttctc ccaaaattaa ttatgaaaca agtgaacttt cttagaattt     74460
     tcctccaata tgttcttctc acaaaattag acgcgttgaa ctttatcatt gacttgttga     74520
     cttaacaaat atcgtagagt ttcttattcc cttgacttca actttatctt tttaattaat     74580
     ttcaatttcc cataacgtca aacgtgtata gatgtagctt tcatttcttt gacaaaatca     74640
     gacaagttta cagattttta atgttttttc caccaattta taatcaacga cggcacacat     74700
     aactcagtgg ctatgatatg atgctctgat cccactaagg cttgagaatt agcagacaaa     74760
     tataagatat agcgtgcgta ataagcaaat tcctatttct ttggatcatg aaaaagtaaa     74820
     gaaaaaaaaa ggcatcatta ttacacttgg aaccccacct ttgggaaatt gaatcagcat     74880
     cgtcaatttt gtacttgctc tatcgtggta cactgaacca gaaccacaca agtggcacaa     74940
     accaggtttg acaatcgcgt taagctgccg acttccgtta ttgctgaccg atcttaacgt     75000
     cacttctacg gctacgattt atggctctct aggaagacaa atgtatggct cgggttaagt     75060
     gtttaagtca taactcataa gatcaactgc aaatgatatt tgtgttgtga ttcctttgga     75120
     cactagaggt ctttgatcta catagcgaaa tcctcgaccc attctaacaa gtccctgaac     75180
     catacgacca cacttttggt taggtcttaa taaccttgtt tgatgaaata aatctccatt     75240
     agagaagcca cataaataaa caagtaagaa gaaaatatgt agatgaaatg tattatttta     75300
     agaagtcaag aaagtagaaa caagtttaac aaaagaatca ataaaacaat gattacacaa     75360
     cagaccagga aagattataa aaatctaatc tatatccatc caaaagtcat acgagatgat     75420
     tagcttacta aaatcacgat ttcttccaat cggattttct ttgttctttt ttcttggcct     75480
     gtaaagtagt ttccaagtgc acaagtgaaa aattctacac ttaaaacgaa aaaaagaaag     75540
     agagaaaatg attggttttt cactgcttgc cttctcccca tgccattccc ccataagtcc     75600
     acgatgatga ttacagatca tgtgtgagtg acaatcatga tgatgtatat agcaatcccc     75660
     atcaatcaaa ccatacggaa ccaagaaaaa cagagtctag agcaaggaaa tgcgcctttt     75720
     ctgcttcttc ttcttttttg ctgagtattg agttaagcat agtacatgta caagctattt     75780
     gcagcggcgc aagcaattga gttctcgttt ggatgccaag caagatgcag cagctttgtt     75840
     gtgtaatcaa gagcattagt attcccatcg actcccggac tctctgatcc tgttttacaa     75900
     atttcagtat ttattctatt catgccaatt ttttaataat gcttaaacga gcgagatgat     75960
     agagagagag ataccgacct ctacttacga cacgcgttat actgcttagt gctctggatg     76020
     gcctcgacgg aattgggaca tgtctcctat gataaaccac aacacaaatt ccatttcacc     76080
     aagagagaaa aaacagaaga gcacactact gttaatggct ttaccaagtt tacctcattg     76140
     ggtttctgct tgcttctaag gttgccgtct cagtacttcc gggggcaaca ccaaacacac     76200
     ggaacagatt gctggaaagt gtatgaaacc gaacaaatga tttatacaag gaatcatagt     76260
     cattcgaaaa tgcgaataac aaaataagat gctctgcttc ttggcatacc tgtaagaacc     76320
     tgtagctgct cgcaagccat tgccacttat acaacactcg aacttgtcaa agatggaatc     76380
     attttcatat aaatcacaga gctgaaaatg accacaaagg gaataccatt cagcaaagca     76440
     ccaactcgcc aaatgtatct ctctcaaaat attaggaaac tgacctttgg tttcaaatat     76500
     tcatgaacct ggaaagttgc tactggacct gcgtccatgt tgatgtccca taactggcat     76560
     gtaaaacata acatggggtc agtttacctt acacgaacaa atcgaaacca gccactgata     76620
     acttcgaggg gatatcatat tgaatgatga aaacagtgaa aatatggacc ttaagtgtca     76680
     tatagtcacg gctaagtaga tatcttcctt cttttgcaaa tttgatgtct gagactgaag     76740
     caattatctc agtaaagaac gatttaggac ctgcttgctc tggttcctca aacctgcaga     76800
     aacaagcaat attagccttt gctgctacca caggttatca aatcctacaa aagagtaatg     76860
     tcattaattt gctctcatgc agctttatcc atctcaatat taattgagta ttacatggta     76920
     tgatgctata aacttatctc tcatgttgga ataaaatgtt tagcaatcaa attttgatga     76980
     aataaagaag taattgagat gattatacaa gtttttagat cctcctttca agatatactg     77040
     gactctaaaa aaacttaaca taattgccag tctcaagact tacaattttg aatgtgaatc     77100
     acataaagct gactggcgca gatcaatcag gcgaattgaa cctttcgaac tgctataggc     77160
     taacatattg caatgggtag gatgaaattc tgctgatgtg ataacctctg catgaacgaa     77220
     tatggtcgta aattcgaagg atatcgcatc caattgcatg ataaatgggt accgtataag     77280
     agaacatatt agactgagat aacagtagac caaggcttac cagatagatc ttccattttc     77340
     gcaggcttga catcaacaat attgaaactt tgattgctaa tttccagatt ccaaagatta     77400
     attcgcaaat catcagcaga aataaatgtt tcgccgtcgc taattataag agaaaaatta     77460
     ttaggagcag aacattatca atgaaagtat agaactcgag ctaatatcaa caaggtgtcc     77520
     gtttggatag gaacttgaaa aggtgcattg attatctgga tagacaatga tttatcagac     77580
     gacttatagt gacatcattg aattttttgc ggacaaataa agcagttgct agtaagaagg     77640
     aagcaagttg aattccaatg ggtgaataac ctacctgtta tttgagattg aattaatatg     77700
     ataatcatga gcatgagcat atactcttcg acatctagcc acagggctcg actcatggct     77760
     agttacctgt atatgtcaaa tgaactatta gtctacaaat gagcaatatt aagtaatatt     77820
     gcatgactta agaatcaatt cctaatcagt ggtagtgaag gccatggaat gggaaaatgc     77880
     acaagtacga aaaacacaag tccagcacca atgaacagta aatttgagca aagtgtatca     77940
     tttttctgga cgcatatact acatgatatg atctatatta cttcgactca attggcgcca     78000
     atgcaaaacc ctgcatttga gttttagcaa tcacccagaa agaggttaga taaatggttg     78060
     gctctatgat gcaggtttta cttaagttag tgctgaaaca agcataaata tttaggaaga     78120
     cacagagaat aaagaaaaca tattgttcag ggtacaacta ccactggtaa tcgcagcgaa     78180
     gagatgcctc ctgctggcaa tgagaagtca ttacataagg agttgttcac ttcagatact     78240
     cctccattca caaggcatga gtttgtaatg tttgaattgc tcgagcttgc aacggttccg     78300
     tttcctacag ttcttgaagg atctgaattc atatcacaga ttttcttgat cttcttgtct     78360
     tgaacctgtt aagactctca cataagaaaa agaggaaaga aactctgtac taattaagga     78420
     tgtagaacca tttagataca caccaaacaa tgtcaacgcc agagagttca aatttcaacg     78480
     ttctaaagat tgaatatgaa agtatcagct ttacacctta aatatccaga agcaaacaaa     78540
     aacttcctat cttaacagta tgtcattcag aggcaaacaa acgaaataga tgaagttttc     78600
     accttccaaa acttgatggt tttatcattg gtcgagagga gaaaaagagc tccatttgct     78660
     gtttgacacc atctaatttt gttaattttc tcctctatct ccaaactctt gaggtaatca     78720
     aactggtaaa caaggataga gcatgaaaag acagataaaa ggtatagcca aatagctgag     78780
     taagaagaaa acagagtaaa tcaaatacct cagggtcatg actctgaaac tctgttttat     78840
     aacgaaactc tggatgcctc agtggataat cagcttcttc aagctctctt ctggttccac     78900
     tgctctgtaa tccacagcat gcaacaacaa catataacca aaatgatcca aatcccatat     78960
     cagaaaaacg attacaaggt aaagtggaca tacattattg gtatcggttc tctcgaaaag     79020
     aacaacacgt cctccacggt ccccagtagc aagatggttt ccagaattat caaattcaat     79080
     cgctgagatt atatcaactg cagaggaaac accagctaca gtttttaaga aatttcaact     79140
     aaaattcaga ataacatcga ttcagcaaaa cgaaaaacga ctattgaatc taattcaact     79200
     acaaagctta caactttcaa tttacccaga tacaaagtag accaaaaatc aaaacttttt     79260
     cattgaatcg aacaatcaaa gaacacccaa tagatctaac atatccagat tcaaaaaccc     79320
     caattccgaa tagatcgaat agtgagctga tgaaaatcaa aagcacagag agacaaagtc     79380
     aaagagagat gtgtaacctt cttgaacttc ttcaccagcg cttcgttcac cgaagacctg     79440
     agagaatctc cattccaaag gcagagatgg gtctgccgaa gctgcgacga cctcatcacc     79500
     accgttcatt tccctctctc tctctctgtc tctcgctctc tccgattcac acacactcct     79560
     ctccttggga taagataatc taattgatcc gacgatgagg aattagccgg atcgggaaat     79620
     cagagattct gattaggaga caaaccggat ggagctcgtc gccgatagat gattgaagca     79680
     aatcgatgaa ggaggagaag aagaagagta tcagatgatt cccagatttc gacaaacaaa     79740
     taaaatcaca caacactctc tttttttttc tctctttatt aaaaaaacaa aactaaaaaa     79800
     tgttaatatt atttggtatt aattttttct tatttttggt tttatcactt tttctggaat     79860
     tagttcacag cttttaatat attactaatt gtaaaaattt aatgcaggga aatctcattt     79920
     attttcaaac ttacattttt ctctaaacga ctaatttgag ataaaaacaa tatatttctt     79980
     ttttttcaca gtgttgaaat ttagtggatg tagatttttt tcatttttaa gctttctttt     80040
     ttttttttgg ataaagatat gtgttcctac atgttggaaa aaagagaaga aaatatatac     80100
     tgtagttcct acttcacaat atacatttgt ctttatccat ttaaattaca gtttcacatg     80160
     acagtttgtg tatataaaga tctcactagt aatgtaaggg tcaaaacaaa aagtgagagt     80220
     tatgtcttct ctggaaactt aataatattt tgattttaaa tatgagtatt ataattttaa     80280
     ataacgatat aataaaatta aacttcatca tgagaaaata atagtcatat ctgcttagct     80340
     gtaaattggc ttttttggtt gttgatataa ttccacaaag gaagataaaa aacaagaccg     80400
     tttattttcg gttaagaaag aaacaactaa cactcttctt cgctctactt tgatcacata     80460
     tcactaactg tgattctatg aacacagttt aaaacaacgt ccgccggaat cttaggatca     80520
     tatggtacgc gatggcggag cgagaatgtg gataactgac caagaagtct ctccaaaaac     80580
     tatggtgtaa tcaagcaagg aagatcacta attagcttaa ttatatatct ttctatatct     80640
     caataccctg aatctcaatc atgatacgat taaatgttca tcgaatttcg aatttttaat     80700
     ctaattttac atttgttgtt ttaatcccta atgtggtact taacgagtag ctatataatt     80760
     agtgatcaac atagaaaatg aaggcttcta cgaagaaaag aatgatggtt cactgaatct     80820
     ctttaagcta gccagatgca gcatagatac aaagcacaat tcttgagact agtagattag     80880
     tagtgattca cttgtactta cgttcatttt aacgtacagt agcaaatctg cgagaaaacc     80940
     gttgatttta ttgttataga cttgaaaact attttatagc ttgtggatgt acattgaacc     81000
     ttcattaact catgtttgcc ttatgcagag ggatactccg tttttttgct ctcttgtgca     81060
     ttaaaactga acacaaaaca tagatttttc gcattattgt ccatccactg gtagcagttt     81120
     agttgcagag ctttaaggta agaatacaaa cagagactaa taaactgtaa tgatttgaag     81180
     gactatcaaa aatataataa aggtgaaaaa tcagtatctt gtaacagttt tgacttttga     81240
     actatgatgc tttactttaa ttggcctttt tcagtggtgg ctcgctaggt caagtggcct     81300
     ctgttgatga tttcgtatac gattaggtga ctgataaccg ttgcatattt atgaagattg     81360
     ttgctgactt tgtttttttt atgagtagat aacatttttt acgttcataa aaggtgaaac     81420
     aaggttttcg caatgtgttc gagtttagtt gcaagaaaat gagatttgaa tttatcaaga     81480
     ttgaaaagtg ttacctgtct cttgaaaaat tcttttgctg actcctagaa gtgttgcagc     81540
     tgaaggtact aacaagcaaa caatcagcaa aataaacttt atttcttcaa tattttgatt     81600
     catttttctg gttaagaaga cgaagtaagg tggttacaca gataatgaca ctaaacaata     81660
     gcacataaga tttggattat gagaggagtt gagaagttat atgatggaaa ctgaaaagta     81720
     aatctttttg cagagctgta gaatcaatca acatttgatg acttggactt cttcaccatg     81780
     tgtgttggtg tggaccattg aattgacggt tttgccattc accaacaaca gcatgagttt     81840
     ttgagtcttc atgtttggta aaggttaggc ttattaggag acacgggtaa gagactagag     81900
     agagacattc tccaaacctt tcttttgcat gttttgtaag aaacatttcc gaaaatgaaa     81960
     gaaatcttac acaacattca tataatttgt ttgaaatata acaaaatgat aatttatact     82020
     ctcaagtaaa atgcctaaac ttttatcaat tggaaaagac atcacacaca agcgtgaagc     82080
     gtatcttatt accaaaccca actaagcatg ggtctcgata cttgccataa ttactttaat     82140
     ccattctctt tttgagaaat gtataaaaca tgactttgca taaatagtct tttactaatt     82200
     actatgtaaa taattcctaa gactggtttc atggtacata ttatcgtttt atccttgttt     82260
     taagaatatt cagatgtttg gtctatggaa tatagtctat tcttcatgtt taaaactatt     82320
     atttgataag aaaatatgta ctaatatgtt tttgcataca aatgttgatc agttcgtagc     82380
     atttgaatta atacattctc aatcactttc aagcattatt atgtaataaa tgattcatgt     82440
     cgaaaagtaa tagtatcact gtccattaca tttggcatat atattttttt gtcaaagcct     82500
     tacatttggc atattgacga agcagttttg tattcactta tattttgaca tcgctttcac     82560
     aaaaataaat agctatatat gattattatc cattaattgt ctcttttctt ttgctgacac     82620
     aattggttgt aaatgcaatg ccaatatcca tagcatttgt gtggtgaatc tttttctaag     82680
     cctaatagta aataaatctc aatacaagaa cccatttacg aacaaatcaa accaagttgt     82740
     gatgggttag tacttagtag cccgtttgaa atgtagaatt tttgatgaga ttttacgttt     82800
     tatatagatt tttctcagaa aacaaaaaat tcttgcatct tgcattttgg tcatttgtaa     82860
     atattttttt agtcttaaaa aagacccaaa ttcttattaa tttcaaaatt ttcggtctct     82920
     aatacctccg gttttaaaaa aaaacatatc agttgaagga tgagtttggt gaaggctata     82980
     ttgtccattg attttggaga tatatgtatt atggtcatga ttattacgat ttttatataa     83040
     aagaatatta aaaatggtgg ggttggtgaa gaaatgaaga tttatcgtca aatatttcaa     83100
     tttttacttg gactattgct tcggttatat cgtcaacatg ggcccactct tccaccaaag     83160
     cccaatcaat atatctctcg ctatcttcac caacccactc ttcttctctt accaaaccca     83220
     tttcctttat ttccaaccct acccctttat ttctcaagct ttacactttt agcccataac     83280
     tttcttttta tccaaatgga tttgactggt ctccaaagtt gaattaaatg gttgtagaaa     83340
     taaaataaaa ttatacgggt tcaattgttc aattgttcat ataccgttga cgttcaattg     83400
     ttcatatacg ggttccgtgg tcgttggtaa tatatatgtc ttttatggaa ccaaaataga     83460
     ccaaatcaac aacaaatgaa gaaattgtta gagtatgata cactcatata tacccaaata     83520
     tagcatatat ttataatata acttttggct atgtcatttt acatgatttt tttggcttat     83580
     ctattaaaag tatcatacaa actgttttta cttctttttt ttcttagaat atatatgccc     83640
     aaaatggaaa agaacatatg ccaaggttga ttttatcgct tatatggtaa aaattggaaa     83700
     aacatacaaa tcattacttt atttaattaa atcatgtgaa gaaacatatt caattacggt     83760
     aatacgttat caaaacattt ttttttacat taattgttac attttttttt tttgcaaata     83820
     ttcttaaata accattcttt ttttatttac tataattaac ataaaaataa ataaaatata     83880
     acatttcaac aaagaaattt gcttatgaaa aatacaaaat ccagttaatt tttcagaaaa     83940
     atacaaattt gcttataaat atattaccac tagtttatgt gattttaaaa gaaagaaatg     84000
     cagcttacca aacgcaacgt gaaaatttga gaaacccata ctcaaaaaag attaaatgac     84060
     aaaatcaccc tcagcaaaat catgaaacaa caacactaac attttcacca accccaccgt     84120
     ctactccggt gaattgtcta tatgaactcc tccgatacaa ctcctgtttc cttcaggcca     84180
     aagcctaaaa ttcacacaac caaaaaaacc aacctttttt ttccacctaa atctttgaat     84240
     atcacaatat ttactattta caatggcgcc acaagaacaa gcagtttctc aggtgatgga     84300
     gaaacagagc aacaacaaca acagtgacgt cattttccga tcaaagttac cggatattta     84360
     catcccgaac cacctatctc tccacgacta catcttccaa aacatctccg aattcgccac     84420
     taagccttgc ctaatcaacg gaccaaccgg ccacgtgtac acttactccg acgtccacgt     84480
     catctcccgc caaatcgccg ccaattttca caaactcggc gttaaccaaa acgacgtcgt     84540
     catgctcctc ctcccaaact gtcccgaatt cgtcctctct ttcctcgccg cctccttccg     84600
     cggcgcaacc gccaccgccg caaacccttt cttcactccg gcggagatag ctaaacaagc     84660
     caaagcctcc aacaccaaac tcataatcac cgaagctcgt tacgtcgaca aaatcaaacc     84720
     acttcaaaac gacgacggag tagtcatcgt ctgcatcgac gacaacgaat ccgtgccaat     84780
     ccctgaaggc tgcctccgct tcaccgagtt gactcagtcg acaaccgagg catcagaagt     84840
     catcgactcg gtggagattt caccggacga cgtggtggca ctaccttact cctctggcac     84900
     gacgggatta ccaaaaggag tgatgctgac tcacaaggga ctagtcacga gcgttgctca     84960
     gcaagtcgac ggcgagaacc cgaatcttta tttccacagc gatgacgtca tactctgtgt     85020
     tttgcccatg tttcatatct acgctttgaa ctcgatcatg ttgtgtggtc ttagagttgg     85080
     tgcggcgatt ctgataatgc cgaagtttga gatcaatctg ctattggagc tgatccagag     85140
     gtgtaaagtg acggtggctc cgatggttcc gccgattgtg ttggccattg cgaagtcttc     85200
     ggagacggag aagtatgatt tgagctcgat aagagtggtg aaatctggtg ctgctcctct     85260
     tggtaaagaa cttgaagatg ccgttaatgc caagtttcct aatgccaaac tcggtcaggt     85320
     atattttttt tgggaaatac ggaatcatac gaatttggaa aatcgaaata actatacgga     85380
     atgaaatctc ataattaact gaaaaacata acataagtaa atacctatat acagtttgta     85440
     ttttgatcaa ataaagtaaa accaaattat tcaactgtgt gcgatttttt tatattttct     85500
     gcataatcac atttttggct actcagatga catattttta tttatttctt atagtaaaaa     85560
     aaaatataaa tgttatacaa aatttgacca aaaacgtttt taagaaattt gccacttcag     85620
     ttttaaattt tacgtaacta actttaattt attaaatgat tagggatacg gaatgacgga     85680
     agcaggtcca gtgctagcaa tgtcgttagg ttttgcaaag gaaccttttc cggttaagtc     85740
     aggagcttgt ggtactgttg taagaaatgc tgagatgaaa atagttgatc cagacaccgg     85800
     agattctctt tcgaggaatc aacccggtga gatttgtatt cgtggtcacc agatcatgaa     85860
     aggttacctc aacaatccgg cagctacagc agagaccatt gataaagacg gttggcttca     85920
     tactggagat attggattga tcgatgacga tgacgagctt ttcatcgttg atcgattgaa     85980
     agaacttatc aagtataaag gttttcaggt agctccggct gagctagagg ctttgctcat     86040
     cggtcatcct gacattactg atgttgctgt tgtcgcgtaa gttcaaattt ttaaccgttg     86100
     ttcgttttgc agtcgctaat tgaattgcgc caaaatatgt tgttgaacca acaactacaa     86160
     aacggacatt gtttgatcat gaccaaataa tgttgttggt tcaacaatat atttaggcta     86220
     atctatgttc tgagtactaa tctattatta aagtatgttg ttgaaccaac atgaatgatt     86280
     aaaacataat ttaagcataa tgacaaaagg agatcaatga tatcaataac agagccgatc     86340
     ttgatttctc tagcatctct gtttcaaact gcttacactt tttgttgtta cgtgtatgat     86400
     taaacagaat gaaagaagaa gcagctggtg aagttcctgt tgcatttgtg gtgaaatcga     86460
     aggattcgga gttatcagaa gatgatgtga agcaattcgt gtcgaaacag gtaaaaagtg     86520
     aattacaaag caagttcttg attttgatta atgcatgaga aatgaatcat tattgatgca     86580
     aactttgtat atatctgaaa tcacaggttg tgttttacaa gagaatcaac aaagtgttct     86640
     tcactgaatc cattcctaaa gctccatcag ggaagatatt gaggaaagat ctgagggcaa     86700
     aactagcaaa tggattgtga tggatgattt caaccaaaaa gcaaaagatg atttcaatgt     86760
     gtatatacat acaactgttt gacccaacca aggaaacaaa ctcatacgaa ccattgtctt     86820
     ttgttgttgt tgttgttgtt gttgttgctg ttcttgcttg attcatgtaa tgagcctttg     86880
     tgatgaaggt ggtttctttt ttggtttcct atcatgtaac ttgtgctgga gaaaacagca     86940
     cacctttttc atataataat aaatttactc ggattatgca actgaagatt gaaactgaaa     87000
     agtttgatac aagcaccatc ataagcgaac agtaacccaa agattcaata agcataacaa     87060
     taatcgatca tcccaaacaa atatgtcttt agaaagtaga gatctcaact tctcaactta     87120
     tcacataaaa aaagtctcct gaaaacatgc attcttaaac aaagtcttcc actagtagca     87180
     tgttgttctc tagatagata gatatttctt gcttaatcga tggataggcg tggaacacaa     87240
     aagtccacaa gcagcacaga tggccctacg cccgccaaat aaaacatcct gctcaaagcc     87300
     actttgacaa ctacaaactt cttcttgtac cataccttca ctattgccat ggactttcct     87360
     tggatcttct ctgttccaac tactatccca tctctaagtc caacgtagcg cgcatactca     87420
     cctgacgagg caagtaaatt gcctagcacg caaaacaaat gaacatatat tttagatcag     87480
     atgtatatct ctctggatca ttttatattg aattttaact aacagctata gcacttacgt     87540
     cttgttgaag ttcaatgtgt ggagtgaaca catgcagttt tgctcccacg gctgattgat     87600
     gcaccaacaa ctcaggtact tcgtccatat ccttaggctc aatcacttct cctttcatgg     87660
     aaacgagagc aggttcgtac gatgatgggg tctttgactc agatcccaaa ggtggccaat     87720
     cttctgctct cggtatgccg cctttcttta acgcaaagtt aaggcagtcc ttgacagtga     87780
     gcttgcgcct gcgcctgagg ttgcgtgagc cagctttgtc caccaaatac tgagctgagt     87840
     actcagtgcg gacactatcc agcttaagtg caagccgtgc agagcttatc agctcaaccg     87900
     ctacgatagc agcagaagca gattcatctg catagacaaa acacaaaatg gaacaataaa     87960
     tcaaatctga atgtattccc atcttacaag atacgaatag gatcagaatc aactgtgata     88020
     tactaacata atccaggcta taactaaagc aatgtgacaa aagcagtgga ttcaacacaa     88080
     catcctaatt ctacagccac aaaatttggc tgattgattg gtcaaatgac ttaaatctca     88140
     ctgttaacat aaaagagaat ctctgaaatc atgaaaaaac gtacaaagac aacacacatg     88200
     ctatcaatat ctgagagaat ctaaaaccta tcttggcaaa caagttatca gagccaacaa     88260
     caacaaaact taagacattg gtgtaattaa gcacatgacc agaactgtga taactcaaca     88320
     taatgggtaa attttgtcct gcactaaatc caggctaaaa ctaaagcaat gaatcaacac     88380
     aacatcctaa ttctacagcc acaattcacc attcctaggg attagatcaa aatctgtttt     88440
     aaaaccaaga agtgagatac ttttatgagt aaattctata cagtaacaag ttcttaccgt     88500
     gctctgggtc attctcaaag acattatcgc gtctaccgta tgaaaaagcc aatgtgaaat     88560
     tcggatcata gggagggagt gccatctgaa aatttgcaaa gttttcaata aaactacatt     88620
     aatggatgtg aataataaat gcaaagaaca ttaacaaggg aattaaagtg aagcgatttt     88680
     tcacgaaaga aaggaaaagc aagagggacc tttgcttcct aataggatcg aagttatagc     88740
     aaaaagaaac atttttatca atgacaaaaa aacagatcga tgagtatgtg gctaaatcga     88800
     agcaatgtga ccaaactaaa tgaagtttaa acgctaacaa cctaaccaaa agctcctcat     88860
     tgttcactaa tcacactgaa atagtaaaaa gatgacattt ttatcaatga caaaaaacag     88920
     aggaaggagt ttgtggttaa atcgagccag tgtgatgctt ctttaccaaa gaatgacaaa     88980
     aataaagaag gatcaaacgc taaaacgtaa ctactcacta atcacactga aaaaggaaat     89040
     gcacaagcaa gcaaaatccg taacaaaaaa aaaaaaccct aaaacgtaac taaaagctcc     89100
     tacaaaggca aatgcataag caaaaattgt gacaaaccaa agcaagctac aaaaatctca     89160
     acaacttaga aaaaaactct aaagagtaac actgattgca cttacaaaga aaaactcaca     89220
     agcagaggaa gcaaccaaag gaacctaaag gatttagtat ttatagacaa gagtatgggt     89280
     gactcgaaaa accctagaga taggacagat gtcaccatcc tctgtcatca aatcgtatca     89340
     atggctgcga gaatcgctac tttctccgta caagctttca attcatcacc actgctctgt     89400
     gtttttgttt cttgtcgttt tccaactttg gagatgaccg tttgaccgtt gttgtgcctt     89460
     agacgacgtc ttttcaacat tgggctttat ctttagctgg cccaagttcc tcttttcttc     89520
     aattagaccc actttgctaa acacagtcgt tttgctctct cggattgagg aattgtctta     89580
     aactcttcca aggatgttct aaactgggac atcaacctga ttaggtttga gaaacgattc     89640
     tacgatccgt atattttgct ttttcatgat ggtaataagc tttacaagga gacattttat     89700
     caatgacaaa actaaacacc gagaatggaa acgaaacggt ccttttcgtc ttcaagatgc     89760
     aaaattgacg agcataaatg acaaaagaaa aaccaaggca aaaactttta tgaaaattca     89820
     acaaagctac attggggata catgcaccat cataagcata agaatattat cattgttctc     89880
     ttttaccttt ctagaaaaca ataatcccaa aaaccctctc tcgagttttt tactccctaa     89940
     taaatgtaaa attcagagac cctccatgat tagcaaaaaa ttggacaaca gactcaagaa     90000
     cagtagtaac acaaaaaata tgagttgatg aagggaagaa gagagaaaac gctatgtggt     90060
     tggagaagaa gacgaggaca gaggacgagg aggaggcaag agttgatgta gattctgagg     90120
     agacctgttc tggctcggac ttgctcttaa tatgaaagga tgctgcaata gctgcatagc     90180
     actcctcctt ttccccggtt ctctctgcaa gcaacacgag ataaaatgcc gaaactccgg     90240
     cgacgcagtc gctggagctt ctggaggctg agacatacaa atggcacaca taagactagc     90300
     ccaatcacct tgtctactca cagggaaagg aaacctcccc aagtaaaact ccaaaatgct     90360
     aacacctaag ctccaaatat ctccagcata accatcatac tttccctgat tcaaatcagt     90420
     gttaatcctc tcaggactca tataagcaat ggttccaaca gatgaattac acggatccat     90480
     agtctgagcc aagatcctac taactccaaa atcagcaatc ttaacgtttt tagcagagtt     90540
     tatcaaaaga ttcgatggtt tgatatcacg atgaactatg tgacggctat ggagataagc     90600
     taaaccacta agaatctgac gagatagatc agctaattgt tgctctttcc acacatgagc     90660
     accttctaaa gaacctttat ccataaactc aagcaaaacc tggatctcac cgttctgatc     90720
     aaacatctcg tgacatttca caacgtttgg atgattcaca tctcgtaaaa tctcgatctc     90780
     tctacagatc tgacgtctca cagtctcctc gtggttaccg tatatcacct taagtgcata     90840
     tagacgagaa ctcggacggt gaatcacttt gtataccgtt ccacctgctc cgcttccgat     90900
     acggttacct ctcactaaat ccgaatagtt cttcgcttct atggagctgt tagtgttcgt     90960
     tgaagacgcc gaaccaccag aagacggcgc agatccacta gagccaccgg aaccaccgga     91020
     agtaggtggg agaggaagag gtacagcgag agaaacatcg cgttgaggaa gcggtaaggt     91080
     aagatcagga cggcgacggg gacggctttt caccggaacg gaaactcctg gaggcgattg     91140
     aatcggtctc atcgcttttg gaatcaaaag ttcgattttc ttctacgatc tgaaaattta     91200
     aaagctcgat tgaagattga agtaatgatc ttcgtcgttt atagtagtag tcttcttcga     91260
     cttcttcgtc gtcgtgcgtt gtcgtattct agggtttgtt tgtggcaggc ttaaattgat     91320
     tcgttcttcg aagcgatcaa aatcaaaaga aattgagaaa tgaagtttcg tcgaaagaaa     91380
     ttgaaaggac actgaaaagg gaacgttaat ttttattttg agaaaattaa ttaaaaggaa     91440
     ataaatagca aaattgttaa aatcgagaaa aaggtatcta cgcgatgtgt aaagcgcgtg     91500
     aggatcactt tcaagcacgg aaaccatttg tgactttgtg tggttggttc actgggcact     91560
     tctggctctg ttaagttttt ttcagacttt acgcggtgtc gttttgttgg ttttgtgata     91620
     taaaccaaga agaggaaatc gaatttaaat caaacaaacg cgtaaaagtg acattggaga     91680
     tggtctaacc tgcaaatatg cgtactgcga ttcaaaatac atgattcaga aaatcagttt     91740
     gtatattctc atgtttaata ttaagtatgg tcttctctca acttctgaca gtgtattgat     91800
     tctccacgta tgtgcttagt tttatgctat tctcactgtt ctgtaacaat caaaagaact     91860
     tgtctttagc cagaagagtc tttaaaggct ttttttcatt gttcgcatac aaaaagtgaa     91920
     acagaatagc aaaagaagaa aagagataca caagactcag tgtgtcatta ttatgatcgg     91980
     aaatgagttt ttcactcaag ctccattgtt gacaataaaa agaaaacaaa tcttggtaac     92040
     tcagttactt ttgaatccct taagaacata agctcaaagt tgacttcaaa cttcaggtgt     92100
     gtctgaccgc aaaactgtca aggaaaaaca aaaacatgag agaatgttag acaaatggat     92160
     caacaagaag aaagctgaac cattttcaga tagactaaat ctggaatcat tgtctcagta     92220
     aaccctattt gagaaatgaa atcattccaa attcaacaat ttgaacataa caacaactta     92280
     tgagaaaaca aaatagaatg aaattaatca aatccagaag cagaagagag acagattaag     92340
     cgcaaaatcg atggagcttg ttaaaatgat tcatcttcct cttaaattca atagctttcc     92400
     caaaatgacc tactctgata tctacgtatt ccaacaattt caatgacaca caacaagaac     92460
     atgaagaatt cagatccaaa cataaacgag aaaagacatc taaatgcaat gttcccaatc     92520
     agctttccat cttcttcatg ttcttgtttc acacatacta ctagttttgt tgttttctct     92580
     gaagctaact ctaaatgaaa aattcaacaa tttggacata acaacattgt atgaagatag     92640
     tattgaactg atcaaatcca gaagcagagg aaaggttaaa tgcaaaatcg aagatcaaat     92700
     ccagaagcag atgattcact ttccacttaa ttccgataac ttttaggaaa tcagattatt     92760
     ccaacaaatt actcaaaaac aaatcaggaa tcgagaacac aagaacgtga agaatccaga     92820
     tctaagatcc aacatcgacg attaaaggat cgaaaaggct taccaggttt ctggggcttt     92880
     ccatcagccc atttggagag agagaagtga accttctcgc gagtaagagc ttcagctttg     92940
     tgtggctcct tgagacagtt cctcacgata ttcgcacaga tgtttgaata cgatatatat     93000
     gtcatccccg ccgctctcca gaacggaacc gccgcattcg atgccatctc cgatcttctt     93060
     ccttgtcttc cttcttcgtc cgttccgatt ctaaggagaa agttcgcgaa atgggacaga     93120
     gaccgattct gtgccctagt aatcctaaca cagtttagac ccaatgggcc ttattaaata     93180
     ttttaacggc ccattaagta gctaactaca cgaatcttct atccaacttt catctactga     93240
     aatctctcaa cttttttttt ttttttggtt tcttgtcttt tttatttgtt tttatgattg     93300
     tttcttggag tttacgcgaa gactgagcca aaccaagctt tgctatttta ataccttgat     93360
     taggcaatta gaaatttaag cgaagttaca taaaaatagg aaaacaaaca aacttatttc     93420
     caggagtctc cacgaaattt actcaaaact tattctcatt ttcaggtaga ttgaatttcg     93480
     tgtatatgtc tgcataattt cgtgtaaatg tctgcttttc tttgttttgt ttcgttttgt     93540
     agtttttcaa aagttaatat taaatgtgca acagagagaa gacaccaatc tcattgactt     93600
     gtcagaaaca aagaagagag aaacagttta gtttcagata aagatggttg agctgactaa     93660
     caaataaaac aagactttgg gttttgcttt aagttaatga ttatatgtga tcttgttttg     93720
     gtttatagaa gtctttagaa gaagaacact ggtaattact tattttggtg ggtttggtaa     93780
     gaaatttggt ttatcttccg aggataaagg attgttatca aatccatata tagttgttga     93840
     agcaacaatc atatcctcct ccactgagta agcagcaaaa caatggctga atcaaagaga     93900
     cttgagaggc ttaaagcaat gagaagttta ttgaagagtg agatggagaa atctgaaacc     93960
     ttttcattgg ttcttaacaa gactggatcc aagattgaag agatcaacca taagttgtcg     94020
     tctttagaag ctgatcttaa agttgagaga tggaaggctt ctcctttctc tgatcatatc     94080
     cgtcacacca ttgctccaat atccgctgtc ctgagagtct ttgctacggt tcaagagctt     94140
     gagagatctc tcgtgtcctc tgatggagtc cttggttatg tttcggatgt taaacgtctt     94200
     ggagaagcga tgaagcttct ctccagtagc tgtgttcttg ctcttaactg gctagaagat     94260
     acgatcgagt acctaaccga aaagggaatg cctgaagatc atccttgcgg tttgcggttc     94320
     aagacttcca tagagcttct ccgggaattg caaatgaccg agtctcgtgc ttatctcaaa     94380
     ggaggtattc tttacacagc gctgaagaat cttgaaacag aattcaagcg gattctccaa     94440
     gagaagccgg ttttctcaga agacaacttg agaaagttgc aggctatcat caagagatta     94500
     catgctcaca cgcggttaac aagctgcgta ccagtttaca tcaaagtccg caccaaggtc     94560
     attcagaaac ggtttgagat tagttatctg gagaaaacaa tcacagaagc tgataatgta     94620
     catgatattg aaggcgatat agatcaatgg agattgcata tggagatagc tgtgaaagag     94680
     atatacgagt ttgagagtaa gctctgctat gacgtatttg aagatattgg agaagatgtt     94740
     cccttgcgtt gctttggaga aatagcttca aattcagtga tccttcagct tctcagattt     94800
     ggatcaagaa tcagcaaatg caagagagag ccaccaaagc tgatcaagct cttagattgt     94860
     ttctctacaa tggacaactt tcggatagag tttaacaggc tatttcgagg ggaacaatgt     94920
     tcagagatac gcagagttac acgggagcta atcagcaatc tcgttaaggg tgtctccgag     94980
     atcttctggg agttaccttg tcaggtagag ctacagagac caaattgccc acctcttgat     95040
     ggaggtgtcc caaagcttgt aagcgttgtg actgagtact gcaacaagct actggggaac     95100
     aacaacaagc caatcttgtc gaaggtccta gaaattgatt tgggatggaa gaacgcaaag     95160
     tatcaagaag agcttctcac aggtcacatc tacaacatac tgagagagat tgctttgaac     95220
     ttggacgcat ggtcaagttc caacaaagaa accgctcttt cttgcatctt tatgatgaac     95280
     aatcactccc atttctgcgg cttgagagag acttatctcg gggaaatgat gggagagtct     95340
     tggttaaacg cacacgagca gtacagagac tattacgctg cactttatgt caaagaaagc     95400
     tggggacatc tcttgtctct actcacaaac aaagctcaaa ccacttcatc atcatcatca     95460
     tcatcatcag aatcatctcc tgtgaaagga aaacgagccc gtgagtccat taagcgaaca     95520
     ttacaagcgt tttgtaaagg atttgatgag atatacacaa agcaatcaaa ttgggttgtt     95580
     gaggatgaca agttggtatg gaagatatgt caagcaatgg tgaaaacagt tgtgccaaga     95640
     tacaagagtt acctacaaag ctacataaag cttctagtag aagaagatcc tacgagtgat     95700
     agtaagcatt tatattatac tccaaagggt ttagagatga agctgaagac aatgtttcag     95760
     aagaaagaag aaacagagaa gagagacaaa gattctcact ttgtgaacaa agtgatggat     95820
     ttggagatta ctcagaattc tcgctcgaca ttagaagcta tatgataata cttagacaag     95880
     atcacgaaac tagacactcg tttcttagtg aagcttagcc taacatagag aggtgtgaat     95940
     tgtataaaat tggttgttgt aatgaaattg aatccaaaag attataggaa actacgtact     96000
     caagtaattt gtaacttcga gattggtcaa accaaaatta aagtttccaa ctttgcaact     96060
     ttacaagaaa aaaattgaga ctttaaactt gaagagcgaa ccttcttgag aagcaagaac     96120
     gaagaagttg aacgccgtcg taggtcaatg ttaaatagag ttcttacggc aggggagact     96180
     taaaaatcaa cggcggtcaa cgacgggtcc gacggaagaa ttgtaccaat tagaccggaa     96240
     attaaatctg taaacgttac cgatgatgat gattcattcg attctggcat caaaagcaga     96300
     agggctttat atgggcctgg gcatattatc tattcatata gtgggctcga aagaaaaaga     96360
     tttgttttaa actcattgat atataattgt gtgcccatca aatgagaata tagtttgatc     96420
     tctttgagtt agatttattg aaaaattaca cgagttcaag aagagttcga tttaatctcc     96480
     ttagttttaa agaccttgaa gctcgattta gatttgatga tagcttggta aaatttgcct     96540
     catcatatac tactttgatg ctactagtta cattttcttg tagagagaga gattgataat     96600
     tccaaaatct tactaatgaa aagtattatt tagagcaaaa ataataagat tataattctt     96660
     ttttttaata aataaattaa cataataact ttcttaacca tttttgtagt tttcatttta     96720
     ttttctttaa tgttatacta atatatttat ttttatctac aacatgaatt atgtgacttt     96780
     ggatatatat atatatatat atatataaat aatttttgtt aactagaatg atagactgat     96840
     agtatattac cacaaactac gaaactatat gtctcatgat ctaaaatcta acttttgatt     96900
     tcttcacccg aaaaaaaacg aatttgagaa aggttaatgc ttggtaagtc taacaaatac     96960
     ataaaaccag attcatactt tactacttta gtcagtttca tgtcatcttt ttcggagata     97020
     atcccggaaa gatatcaaaa tatgtctatg atgattatgt cagcaatttg accaagaaat     97080
     ctaattgcta aagtgttgcc aaatctactc tattatttga gacgtacgtt aagtgatttt     97140
     ccgttaaaat tatttttact tttaaatcat atgtttaaaa tgttaatgtc atgaaaaaga     97200
     ttacctttta ctgagaatca cttaagttac gttataatct tggccattcg tttgaattgt     97260
     ttttaccgcc cgatctctcg ctttcactta aaagtacgcg gatccttatg acccgggttt     97320
     acaattattg ggtcatacgt tataatcttg gccattcgat tgaattaatt gtaaccattg     97380
     attttttttc aataaatcct acagcaaaaa ttttggagaa agaattttta tttatttcta     97440
     attaatatat tcccttattc aatactattc ataattacgt gtgtttaaaa ttggaaaact     97500
     aattatactc atatatcaac aatatttatt atattctaaa atattactaa tccaattatt     97560
     tttttaaaaa tattttctaa tcaaagctgc tttatttata gatataacat tataaatatc     97620
     gaattaatat gtttgaattc gaaattgggt taaatattct aaatttattt aaataactgg     97680
     aaaaataatt ttaactaaat tattttttat gtttgataat taaaatagaa aaatatgttt     97740
     aaacatttaa aaataagatt aattacattt ttggtttata ttaatttttg ttaattatat     97800
     taatttaatt cccttttcag caattgaatc atattaattt aaaatattca atgcgtatat     97860
     tcctttctta aatttgaata tcgcttctcc ataattatag gtaatcaaat atttagttgg     97920
     atattcattt ttgaattaac ataaagtttc cgaacaattt ccataattaa ataactactt     97980
     ataagataat tgctaaacat tctcctataa ttatgagatt catcataatc attaaacttg     98040
     agttccacaa tttattttat gcatactttt tccccaaaaa tttatatctt ataaatactg     98100
     tctcatttca aaaactcact cagcagttcc tatttacttt tactctctcg cctctttttt     98160
     tattctagca gaagaaaacg agaccatgaa gaaaactgaa gttgtggatc aacgagtcca     98220
     tggaaaaagc aatatatcga ggtgtcctct cacattctct gtttttctct atttttcatg     98280
     tttttctcac atctgttttt taaaatattt atgcaggtaa tatgggagat taaaatgtat     98340
     acgcacacat gattttgtta aagtatgtct tgctttataa ttatttatct tttatgcaag     98400
     taagaagtta agcttttttt acctctctat atatttataa gatgagtaat tctgattgaa     98460
     ttttttgata gggattacag tctttttcct gttaatttgc agaaacacga tgatgattta     98520
     taatttgact actatcttcc aatgaacaac aaaattataa ggtatgtaat attttttctt     98580
     aaatctgatc gatatattct ctttcactaa tatattgaga ttgtgtaaat atttttgact     98640
     gtagtttaga tttcaagaac tcactcaaca gttcctattt tcttttactc tctcgcctct     98700
     ttttttattc tagcagaaga aaacgagacc atgaagaaaa ctgaggttgt ggatcgacga     98760
     gtctatggag aaagcaatat atcgaggtgt cctctcacac tctctgtttt tctctatttt     98820
     tcatgttttt ctcacatctg ttttttaaaa tatttatgca ggtaatgtgg gagattaaaa     98880
     tgtatacgca cgcatgattt tgttaaagta tgtcttgctt tctaattatt tatcttttat     98940
     gcaaagtaat aagttaagct tttttacctc tctatatatt tataagatga ataattctga     99000
     ttgaattttt tgatagggat tacggtctct ttcctgttaa tttgcagaaa cacgatgatg     99060
     atttataatt tgactactat cttccaataa acaacaaaat tataaggtat gcaatatttt     99120
     ttcttaaatc tgatcgatat attctctttc actaatatat tgagattgtg taaatatttt     99180
     tgactgtagt ttcgatttta atatattggt attgttaatt aaattaattg aattttaata     99240
     taagtttcta ttaataattc ttttaatttt ttcttctaaa attctggatt ttgagtaaat     99300
     ttatttttgt cttattaatt tgtcaaattt gataattaat atatatatta ataaaataca     99360
     ctaaaccccg acacaccatg tatacaacta catatactaa atatacaatt atgtattcaa     99420
     aaggatacat caattttgta ataaattcaa tagtatccat atttaaatga taccaataat     99480
     aaattgagaa acttttaaaa tttataaatt atacaaataa acatttatag ataaacagaa     99540
     tatatgaaat tcgtaatata tagaattgaa actgataaac taattaaaac atgactacgt     99600
     taagtgattc taagttaatt tttttccgaa gaaaacagaa tatagtaaaa gcatttcgtt     99660
     ttcccattta cttaatgcaa gtttttttaa tactagtgga gaattatgta atctattttt     99720
     tttcttttta gttatgagtt ttaagtatga agaaagacat tttccaatta ttatttgtca     99780
     aattttataa ttcacttaca tgttaatgac atacatgaaa atgtataaat tttctatgtg     99840
     tacaactaca tatacaaaat atacaattac gtacccaaac gtacatacta actatagaca     99900
     tatattttca aaactacata tattaaacaa aatatggttt gaccagacta aatatattta     99960
     gttggtacca ataatacatg ataaacaact atatgtttaa agataataaa aatatagtag    100020
     agtttctgtg gaatacacag aactgagatt tgatgattga ttaaaccaaa aataccgtgc    100080
     gtagcacagg tactgaccta gtacccatta cttgcgccgt cccttaattt gcttatccac    100140
     tccaacacta gagacaacga ccaaagcaag agtagttttg tttgtctcta ttacactttt    100200
     cgttattaca ctattttttc caactaacat gctattacac caaaatttgt aggagcttat    100260
     agttgaaaaa tgaataaact ggattaggta gaccaatttt cgcttaaata tttttaatac    100320
     aatatacaac aaacattaaa acacttacca catgatgtag tccaagctaa gagagttttg    100380
     gaataggaaa aaatagtttg ttcttagatt tctttcattt tattttcaac aaaaaccctt    100440
     ctcaacaaat ttatctttta gagtaacatg agacatgatt aatgtaataa tggtttgata    100500
     aattgggaaa taaacggcgc ataaaaaatg acccacaaaa gaatcagtac acaattttga    100560
     gattagaaaa ataaacactt gaacacctcg caaggttgta cttgtacata attaattaaa    100620
     tatgcctttt agtgattata tcaaaaaatt aataattctt aaaggtttaa atcaagatac    100680
     tttctgttag agaaaataaa tttgttcaac tttactcaca cattttgtga ctatgtgcgt    100740
     tacatctagt atgttttatt aatggtattt aataatgtaa tcttatatat ttttatttat    100800
     tttaatagta cacggattct ttattttctt atatcttgta gttgtatata acgattttat    100860
     aatcagtact ggcataaaac aaataaaatt tcacaactat cttggtatac taataccatt    100920
     agtgacttta ttacttttag atttacacac ttctctacac aatttgctca tctattcacg    100980
     tttttattat gaaattctcg aaattaattg tactttgaaa ccaacaagaa aagaaaactt    101040
     aattgtacgt aggtactcta tttgtcaata aattcagtct cgcttaagaa atagacagta    101100
     attaaatagt ggcaactggc aagtcacttg tcaaatttga attaataatt tgacatggta    101160
     tacagtaaat acacttcaat gaatcattaa tatattcctt gacgacaaat caattaagga    101220
     aaataatcta aaccaccacc acttgtaagt aaagtaacaa attgacatat acagattaga    101280
     tttgttgact aattttggtt cgataaggta caaatccggt tatctaacat caaaatccgg    101340
     ttaacaaaaa taaaccatac caaaattcac ggcgagagtg tcggtggctg tgttgggttc    101400
     ttaaggcaaa gcttgagaac actgacaata tataacccca aaataaaaat aaaaagtgtg    101460
     gtcttttgac aaaatcatca aaagggactc agatttgtga aatcttgtct ctttttcttt    101520
     atctgttttg tttttaacga ttcgtaattc tcctcaattt ccgtgaaacc ccttggaaaa    101580
     acccatttct cgagagagag agagagaagg agagtgtaag aagaagaaga agaagaagaa    101640
     ggagatgggt gtggatttga ggcaagtggt ggctggaata ctcaccatta ccatgtttgt    101700
     gatgcttgga caaatgcttc atagagatta ctttgatgct gttcaggtat tttaattaac    101760
     ccatatgcga tagtgactga gcttaattca agtgatcgtt tctttggatc tttctctgag    101820
     aaccagatct agttaggttt tcttcaataa aaaaaaccca atttttattc attttggatc    101880
     gaatttggat tgcattgatc ataaaggttc agactttgga gagaatgatc gattcagctg    101940
     tttgttcttc taaattgatt gtgaaagctt cgatctttat gtttctattg gcagctgaaa    102000
     tcgaaatgct gatcttaagt tttttattgt tgtgatttta caggagaaag ttcaaggaga    102060
     tgcacatgat attgaattcc atggatcaaa agtagctgtt gaagatggac ttgttagagc    102120
     ctttgaggct gggactaaag ggccttggat ggaagatagt catgaactca aaccttgttg    102180
     gtcaatttct caatctggta tgttccctga gtttgtttct cagattagtt ctgttaatta    102240
     ttgttagtgt gtgttaatga ttctggtgtt tcagatgaag cggtatcgtc aaagggttac    102300
     gttacattct ccttaacaaa tggtcctgaa taccatgtct ctcaggtatc ctttatatca    102360
     tcagctctaa gattcaaaga tctgtgaatt caaatctgat ttttctttag atatgttctc    102420
     ttctttattc tgatgtttta tgttgcttaa cttcatcgtc ttgtttagat tactgatgcc    102480
     gtgatggtgg cgaagcatct tggagcaact cttgtgcttc ctgacattag aggaagcaaa    102540
     cctggtgatg aaatgttagt ggtgtttgta tcttcacaaa cattttggtt tcggtgaatt    102600
     gtttgtttct ctaaggaggt taatgaataa atttgaaacg cttgaccagg aaatttgaag    102660
     atatctatga tgtggataaa ctcattaaaa ccttggaaag tgtcgtcaaa gttgtaagaa    102720
     aattgccgag ccacgtatct ctaagagata ttgccattgt caaagttcct acccgagttg    102780
     cagaagatta catcaaggaa catattgatc ccatcttcaa atcaaaaggg aacataaggg    102840
     ttacaaccta tttcccttct gtgaatttga ggaaatcttc gcagggtgct gaaaccgacc    102900
     ctgtctcttg tttggcaatg tttggttcct tggaattgca acctgcagtg aatgaattgg    102960
     ttgagtcgat gattcagcgg ttgaagacac atagcaagaa atccggtggc cgtttcatag    103020
     ccatagactt gagggttgag atacttgaaa agaaaaactg ccatgaaaca ggtgcagtgg    103080
     gatccaaaac atgttacaac gcacaagaga ttgcattgtt cttgaggaag cttggatttg    103140
     acagcgatac aactatatat ctgactcagc caagatggga gagcagcctc aatattctta    103200
     aggacatttt cccaaaaaca tatactaagg tgcgtaaaac ccttcattat ttagtctctg    103260
     aagtcttcac ccatttgcta atcttgactt ttttctgcaa atggcaggag gcgataatgc    103320
     cgtcagataa gaaaacgaag taccttgaat tagagaattc tgaatatgaa aatgttattg    103380
     acttctacat aagttcaagg agtgatgtat ttgtaccagc cattcccggt ctgttttacg    103440
     ccaatacagt tggaaaaagg atagctttag gcaagcctca agttctcgtt ccagccgaga    103500
     tctcagggac atccggtctt cccgctaatt acatatctcc ctatatatca aagaagaacc    103560
     acttggcgta ttcatgcttt tgctgaactt ctctggtgta acttttgagg gaaatatttt    103620
     gctaaagtga tcttgtagcc aaaatctgtt gaaatggtct tctgcaaatg taagccaata    103680
     tagtaaccag gtttttccgg ttgtttattg ataagtttag ctcgatacca attcgatttt    103740
     tagtcaaaag tattctcatt ggggttgtct tgtttaggta aagaaagtaa actgttgaag    103800
     ttacaatttg attctattgg ctcatataac gtttgcatac tattcatttc ataaccatat    103860
     ggtcgacttg agagagacgt catagtcaaa ggaggaactt cgaagattcg gcgagacatt    103920
     gttcgctgtt caaacattac tgaaaatgaa cagctataaa gtggaaatgc agcaaccatg    103980
     cgtgaacaat gcaatgtacg atctgtcttt tcttctttta gagagaaaag aggtaagaaa    104040
     agatacaatg aaaatgttga gataattgaa ctcatggtca tctgttgttc actgagtctg    104100
     agttgtctcc ccagttcttc cattacttcg agccatctct aaggctagac actcattgag    104160
     ctctataaca acctggctca tgcttggcct attatgagca cgagctgcac aactgcatgc    104220
     tatatccata gctttcctga ccgagtcgcg ctcaaagtca ttgtttagcc tgagatcaac    104280
     aatctctaga gtatcgcctt tcgcgacctt taaatcgacc cactttgaaa tgtgaggact    104340
     ctcacgcttg ttgtcaacta caggctggtt ggttatcatc tccaacataa caatgccaaa    104400
     gctataaatg tcgctcgttt ggtttaaccg gttcgagttg aagtatctgc aatatccaat    104460
     acgcacagtg agtaacattt tcgagtccat taaaagttct gacgaaaaga tgtatcttta    104520
     cttactggtg atgcagatat ggatctcttc caggcttgac ataaatctta tttgacgctt    104580
     gtatgtcagg gttggttgga gaggatctag acagcccgaa atcagccagt ttcgcttcaa    104640
     agttttcgcc tagtaggata tttgtcggct taacatatcg gtgaaggatt cgcaactcgc    104700
     tatgcaaata ctccagacct gtgaatgcac tttacaaata tcagtttctg ccatgaatga    104760
     gaaactctgt ttcagtcact gcagcttaag ttaccttgtg ctactcctat gatgattttc    104820
     aacctggttt cccagctcgg gacattacca aacttccctg ttacatcgaa agaaaatgcg    104880
     gttattgtct cgtatattcg tacaacttga agaacaagcc aaaactagaa tgtagtttca    104940
     ttcataccag atagttgatc attcaagtca ccatttgcca cgaattcgta gattagggcc    105000
     aagtgctcac catcatcgca atatccaatg aggctcacca agtttttgtg acgaactttt    105060
     acaaagtcgt gaacctgatc gaccaacaaa acattaaacc tttttaacca agggaaacaa    105120
     tagctgtttt tttatccaat tacctctttg gtaaactgta caatattgta gatggaagct    105180
     cggtttagca tctttactgc tacttgttgc ttgtttaaaa ctccacgata aactacacca    105240
     aaccctcctt tgccatgaac tctattaaac ttgtttgtaa ttttcgtaac ctcggcatac    105300
     gagtaactat tcgctggaat gtacacatat ggttcatatt caatagtcga atcgtctgca    105360
     tcacctgcaa agaaatgttg gggaaaaatg gtaagaaaaa accaagttac tggatataaa    105420
     cttaaagttc ataaaaatgg atcttgtgca ttggacacac agcaaatgaa cttagaaaag    105480
     aaacgcctca ggcctgtcgc ttctgtcatc gcctagaatg caaactggtt tatctgtttc    105540
     ctagaaacac caatacacac catggccaca aaatacaaaa gagcagcaga atttttcata    105600
     gtcaacttct taatgtcaac ttacgcgttt ccactaaaaa acaatactac aattttcatt    105660
     tcaatgtgat cgtgtaaact gtaaagtttg accaaacaat tatatggact tttgggccgt    105720
     tggtattttg ttttttgatt tgggtttagt catgagaaca gacattatgt atgtcttagc    105780
     cgaattatct gaatacggaa tacgaaatac caaaacacta gtatcgtgta catataaaat    105840
     aatatcgatc ttacatctca atgttcctac aagtaacaag cttttttttt gttgttgtgt    105900
     gcatagaata taacatcaac aacactcatg agaagaatcc atttgcaaat ttttccctat    105960
     cacacaactg taacacttct atttctccaa gaggccagga tttaccacaa tcttacttgt    106020
     ggcttgcatt tcttcaggcc aagagaatgg aacaaaagaa tgtatcgata atccgacctt    106080
     gaattaagcg agtttcttta ttagatcaaa gagatgggtc tgtgggtgtg gggttgtgtg    106140
     cttcaatgtc aacatgctgg attcctggga caagctcttg gatctctttc tctaaccggt    106200
     ctacttcgct tcctaaagcc gtgacaactt cctcacctgc aacagtttat acagtttgtt    106260
     ttcaagcttg gaacgtaagc tatgacaatt ccagaagtcg aacatttgca taccgtagtt    106320
     tgacataata ttgagcattg cagaatcatc tccgttcttt gcagcctcgc gaaactgagt    106380
     aagtacacca tcaattttca gaaattttaa agtaactaac cacaaatttg actaatggta    106440
     gttaatagat tgttcataag ctaaaaagac acaactatga gataaagaat gcaaatttgg    106500
     ataccatttt tgcccactct tcacgcccag ttctcttcaa atagttttgg acaaccatct    106560
     gcccgttgaa atctgtttaa atacaacaat taatacagtg cccaatggaa tcactcaaga    106620
     agttcagaat acgatagaat gatcttcact cgctaagact ttgccttttt ccttcttatt    106680
     ttcaagcata gggaacaaat caattctttg agagcgaata acagttcaaa atacgcacct    106740
     atttcagctt taaatctgaa ggatccagga ccaatcactt cacttttgca gtcatataaa    106800
     gaatctacaa cctacacaac acaatatttg attctgagcc cacctctaca tgcgtcatat    106860
     atgagatttc taaattatga taagaagaat ttgtaccgag tcatttctca aaaatttaag    106920
     aactttactc atgtcttgat catccattgc tcttccaatc aaggcatgtc ggtttcgttg    106980
     aattagaaat atagcaacct agtcgaattg ctctttagtt tagaaatgta atatagagta    107040
     atataataac aagttaagga gagcacagac acagacatac cattccaagt aaatttccga    107100
     ctacaattga tcctatagga tcatagatag gatttcctgt catcctaaca gcgacaagag    107160
     atgcggcagc aattgccaaa cctgccactg cagcgccatc ctgtgcattt acaatagtca    107220
     caaacagaca aataagaaca taatacaatt taacagtgtt ttcaacgact ctaacaacat    107280
     tcctttactt ggtttctaca tatgttcaaa tcagatccaa gtataaagta atacctcagt    107340
     cataacagca acagaagtag gatcatgacc acgccatata taatctctta tggtcatgcc    107400
     ttcttgagca gctccttttt tgacagattg aattgcaacg agtaaggaag cgcctttgag    107460
     acataaagat taacaaacga tattcagcat gtaggcttga agtatagctc gaccaacttc    107520
     aagaatattt cacataacaa gatgcacaaa gatcaggaga agttgatacc ttcaattaga    107580
     aaagaaccac caattaccac agcagctaat tccatattcg gaggtggctg agaaagatag    107640
     tcaaaattga tgaacaacca aggaaatgta caaagagtat ctaataatcc aaaagatcaa    107700
     atagcagata acgtcaaagt cacaagatat gccgaaaatt accgaagaag tccacaagtt    107760
     ctgtactcca ttaactatgg tagcaccaga cccaaggcaa aagatgccaa cagcagatat    107820
     caaagaccat acaaatcttt cttttgagta gccatagctg agcaaagtga aaaggctggt    107880
     ctaagtactt cttcaaacaa gagaaagctg ttctgttcta ccatacagta tacaagatta    107940
     ctagagagac tcacggatga agagcatctg gggcacgcct tgagctactg agcccataag    108000
     caagaagtgc ctacaacatc aatatatata tatatcagtt ttttcctgca cccaatagtc    108060
     aatatattaa actggacaca aaagcagcaa acaagcataa cagcaacaaa cctggttagc    108120
     aaaatcagct acggagtgaa ctacttcagc cattatgaca tggctagaac ttgtccacca    108180
     aaccccaaac ttgagtgaaa acacgaggaa gttgcaccat agtgcagtag tgacagctct    108240
     ttgactgcaa aatgttcacg aaagcataac tcagaagtta ggaaaaactc acaataaaaa    108300
     tatagctcaa gggcttcaca agataagaca ccaagtacat ggaagaattt ctcttctcat    108360
     gacctccctt ggctaactca atgaacttca ccaagcaaca aaactaataa aaccacaaca    108420
     aaggccaaaa cagaagctag ctaacactgt attctaccaa aaaaagatac caatcttcat    108480
     gagtatacaa gaacagataa aattacccaa ttttggaacc caaacaacca gtaaacaaaa    108540
     tgtatttagc aaacggcaat tcaaaagaac ttgttaaacc acacataaac aaaatgatca    108600
     gacgataata ctactcacat tacaagaaaa cacaaactag aacattacct gtgttgatca    108660
     ttgatctcaa ttctcttcac ttgtttcgcc cgagtgaaga aatctgtaaa cgagcaaaca    108720
     cattgacatt tctccaaact aagtatcaat cactaaacca ttaaacaaca caatatacaa    108780
     aaaaggtgaa aactttaggt caacgaaaag aagacatact ccggtgagag gagtaggtat    108840
     caattaaagg tgtttcccta tcaagcgaaa cagaacatcg cacaccaaga cctttattta    108900
     aacaattggt ggagataagc cctcttacgt gagaactgga acggataaga gaactaaaac    108960
     tccgatgagt agtatctaca aatccattgt ctttctcgtc gaatagcgcc aaaaagtgaa    109020
     cagagccacc gacacttgct ctgatgtaac cttttctagg agaatgaagg aggcgagaca    109080
     aaattcgatg cgatgattgc atttcagagt cttaagagca tgcaagtatt gatttttttt    109140
     tctccgggaa agttaacaaa tgattcccaa aaaaggagaa agctgtgtca cggagaattg    109200
     ggatttggtg taatctgttt atgaaacttt gaaaagaaaa agaattggta agaagaagat    109260
     ttggattgag aaaggaggaa gatgattttg agctcagagt gatgataggg ctcggcggag    109320
     gtcttctgtt ctctgcgtgt tgtccattaa cttgaagcta agcaaaagat ctttcttttt    109380
     cctttttttt ttttttctaa attttatttt taattttgga aaatttaaaa aatcccaaaa    109440
     ttcagtgaaa tttagtaaca aaaagaaaaa ttaaaacttt gaagatataa caaaaaccca    109500
     aaatcaaaat catcaaaaag atcttttaca attttcccta ttttcgaaga taataatctt    109560
     ttgtccacaa agattataag aatattcttt tataccattt atttccaaag cttagctctc    109620
     ataaattaac taataacatt gtaatgtagt ttatcagaaa aattgaaatg taatgactgg    109680
     tatgctaaaa agtcaatata aatattatta aaaaatgaaa ctatgagaag attttcagat    109740
     tttcatgata agatgagaca attcactaga agagaaaatg caagaaataa gattttgtct    109800
     attaagctaa aataaaaaca aaaatggaat ctaaaatatc tctcacaaat tgggatattt    109860
     taaagtctct tttttttttt tttttttttt tgatctaagg gatatttgaa agtcttttag    109920
     gcaaaattct gtgtaaaaat ctttgccact gaaaacaaag gagcagtcac attcgcactg    109980
     aaccatttta gtttgtctcc ttgttttggc aagttccttt ggcaagttcc tttggctaat    110040
     aatatcacaa ttcacaagcc tctttttgtt tcttgactta gagaagcatg aggcattgaa    110100
     catggttcac tttacatgag gctactaagt ctccaaaaca accctgtggt cataaggaga    110160
     ctactctttt ggtgagttct taaataaagt tagtttgtct ttaaaatagg gtaaaacaca    110220
     gactgcaact agacgttaca tcagagtatg gaccaatgca acaacagtct ataaagcatt    110280
     tttgaatcat aaaaaaagaa gaagcaaaac attgcagatc attatcactc agattacatt    110340
     gtcatagatc aaatcctgat aacctaaatc gagtcagatt ctttcaaagg gaatgataaa    110400
     gctacagaac ctgaggcgat tcaaactctg ttgggatctt tctcttgctt gtaatggcaa    110460
     gagccaacat gtcctcactg tgagttgctt atgtcattgg ccactgttat cattatttga    110520
     tgatcagtct caagatttgc atcctgcaaa gatagatcag acatgcacaa gttatgataa    110580
     agacgaatgg attccttttc gtacaacaaa ttgtttggtc aaaacatgat gttgcttact    110640
     tcattcttat ttaaaggaag attctgggct gtttgaggag aggctttgga taagtcccta    110700
     aaagcaccct gaaagtataa atgtcgtcct catttagaca gactaatcat cgaatcacta    110760
     gtgctacaaa atgagcaaga taaagagagt tgatcaaatt aagaagcaag tattgtcttg    110820
     ccttgtttgc ccacataagt ccacatgcat tgcaaagtgt tcttggcccg gcaggtccac    110880
     gtcgcatcat tggagttgac ttctcgccaa ttccacagtg ccgacatctt acaggtatca    110940
     agccattcag aggaagtaaa atcagatatg ttcttaccaa ctaaagtaag gctatcaaga    111000
     agaaaaactc aaatctacaa agacttaaac gacaattgtc tattccaaag ttattataaa    111060
     aattctcagt tccaggatac aatattagtc atcacaacct gtcttaacca atcatctatc    111120
     acagaagtca ttttgcttca ggcatggaag agcttttata taatattttg tctgtattgg    111180
     tccttcaatg ttaccaattc gtataggtcc atgctcatgt taaatattac atatgcaatg    111240
     tgtatgtctt gatattgaat cattgatagg tttcagagtt ctagtacctc tacaacgttt    111300
     ctgaaaccaa aaacaacatc taagatgctt aataaaccta tcatctctac attaggatgg    111360
     ttcagtttaa taactaagtc agatgctaca ttaggttgga agcaaaaaca acttctaaag    111420
     ttgcttagca aacccataat aactacgtta agttggttca agttaaaaag tatgtcagga    111480
     actcgcagtt tactttcaaa gcatttctaa acttacgaga tctcttgatg ctgagcctca    111540
     ctactttcta tggcccaggt ttgattcgac ccccagctag atccagcaga tgcagcttca    111600
     tcattgtttg acttggcaga tgtgaactga cctttattgc gttgcatcct gtataccaga    111660
     aaacaaaaag taatcaagat gcgaacctta attttgggag agcaaccata aaagaagtat    111720
     aactagacca agttgttgat ttagacatca atgtacctca aagctacctc cttgcggact    111780
     gtataccgaa tcttcttatc aaaattcctt cctttccgtt tctctcgaaa tctgaccaaa    111840
     gaagctaatc gctgcggaat actaaacctt tgaggagtac caggtaaact ctgtttcatt    111900
     gattagtcag tcagtcagtc aagcaatgta tcaaggaagg gaacttatgt cccataaatg    111960
     ccatcatata ttttattacc gatactctgt tgttctgatg aggtgatcct aggccaggag    112020
     gggctgcctg aggtaattca cgaccaccca ataatagaag cacagcttga acctgcaaca    112080
     ggcgtcgaat agcaagaggc actcacacat tagaatcaat agatggaaaa aactcaaagc    112140
     taactagatc cttcaaccac ttgctaaaat gtggcttgga gtaagaatat aaattctaat    112200
     ggaatgagac aatcaacgaa ccaactcagt aacaacttaa ctcaccttct caggcaagac    112260
     actgtcaaaa acgtagactt ggccctgaaa agacaatgtt aactgatctc cttgttcact    112320
     accacggtcg accacttcac cacgattgtc agttacattt ccagggtgag aaggaatgtc    112380
     tgtttccaca ccctcactca tcccaccagc attgccatca tcagcctggt catcaaccat    112440
     accgcttcca ttgtggatgt gatgcaaagc atgatgttca aattgcacat gcattggatc    112500
     ttgagcttct ctaatgtgca ttcgagcatt gcttccatgt aggtcatcca tggttgcttt    112560
     tcatcaatct acctaatgat aacagtgaaa gtaaaacaaa ttaacattaa aactggaaac    112620
     ttcaaacaaa aacacctaat cttcataagc acgattcatg gatgaccaga caaatcaaat    112680
     cagctctaag caaaacatga ttcacatact atataacctt acttcctcgg tcattggagc    112740
     aacttacata taagttctaa ctaacactat acataaattc aggaaacctt atggatcaat    112800
     gcttgttttc aagagattaa cacagacttc taacatattt gcatcaatca gattcaatcc    112860
     aaagtttcaa tatttccacg ctctaagcct tacataaacc atattatacc aattccacaa    112920
     actcacttat aatttcaaca aacaaaataa accctaagaa acaaaagcaa atcctgaaac    112980
     aaagcgacat ccaaaaccat tgaaatatag gttcctcatt acgacacacg aaaccaatat    113040
     aagagttaag atgatgttac ctgttcgtgg ggagcaacac caaaaagaga agaatgaaag    113100
     atgttcgaaa gacccaaacg agaaacacca aataacacga cggaaacgat gaagatgaca    113160
     attgaaccga tggataacgc cacaaataga agaacagaga caaaccaaac ccaccagaac    113220
     accaacgaga cgaaaatgga aaccagatag aaagagaaat cgaagaaaga gacgaaccag    113280
     tgggggctaa agagactcga ttgattattt tatcatcaaa agaataaata agcaaaagtg    113340
     ccggagatat aaataaatac ttttcttttg gtttttgggt aaagtttcgt tttttaattc    113400
     tttcttcgtc ttcctccttc taactactaa aatcggatct ataacttttg ttctttgaga    113460
     gacttatttc tctctcggtt tcttactctt ttcggatcag aaatttaaaa gcttttaact    113520
     tttgtcttgc tctgtttcat ggacactgat ttctcaattg gtctctgttt ttgttgagtg    113580
     ggttgagaag agagatggcg agaagtagat cgattagtgg ttatgggata tggaaatatt    113640
     tgaatcctgc gtattatctt agaagaccga gacgtttggc tttgcttttc attgtcttcg    113700
     tctctgtttc tatgcttgtc tgggatcgta ttaatcttgc ccgagaacat gaggtatgtt    113760
     ttgtctaatg aaatctggtt agactctgcc taggagtagg agatagttct tgtatcatag    113820
     cttattggta ggccaattcg aattttggtg aagtaggtta tatggtttag gcctggaatg    113880
     gtttgattgc cttcatagct caaggtctat aagtaagaca gttggtgttt tatttactag    113940
     aaaagagctg taattaatat cttctggact caattcatgt attcgtttat aagaagctat    114000
     gtaaccaaaa taagaaaaat gtcaaggaag tgaacaattt ctcttgtgat cattctctca    114060
     cttgtcctgc ttttttttgt cttgcaggtt gaagttttta agctaaatga agaagtttca    114120
     cggttggagc agatggtaag attaatattt tcccctcact ctaggctcag atagtctttc    114180
     taatgtttta gctaactaac tatattttcc gctagttaga agagcttaat ggtggtgttg    114240
     gcaataagcc tttgaagact ctgaaggatg ccccagaaga tccagttgat aaacagcgaa    114300
     ggcagaaagt aaaagaggca atgatccatg cttggagctc ttatgaaaag tatgcatggg    114360
     ggaaagatga gcttcaggta tacaattatt ttccaaaata catttcaccc ttgtgaatac    114420
     gaaatctagt ttacgacgga ctctatgaat caaattttat tttgacgttt agtgcctgct    114480
     cttccagtat cctgttgagc cttttattat gagcttatct gaagttacca ggcctacaaa    114540
     gattttgtta agaactaaga ttattttctt cctgaactct gcaaaaaaaa tattggtctg    114600
     aagctattct tgtttctttc ctttttttat tgtcagcctc ggacaaaaga tggcactgat    114660
     agctttggtg gccttggagc aactatggta gattctttag atacactcta tataatgggt    114720
     ctagatgagc agtttcaaaa agccagagag tgagtaattg caggctcttc atttattcat    114780
     atgtaactgt tttcgtccca gttgcaaatc caacttttta cttcttcatc tttgctaatc    114840
     ttcatttgct tattgtcttt tatttgcagg tgggttgcaa gctcattgga tttcgacaag    114900
     gattatgacg ccagtatgtt tgagacaacc ataaggtggc tttaacaggt ttactgtggt    114960
     tgttttctgt aattatcgta ggaagagtca gtttatttgc gattatcagt tggtgacata    115020
     agatggggaa cggatattgc atctgcttat attctttttc tttatctgcc ttcagagttg    115080
     taggcggact tcttagtgcg tatgatcttt ctggggacaa aatgttcctt gaaaaggcta    115140
     aggatattgc agacagatta ttgcctgcat ggaatactcc aacgggtata ccttacaata    115200
     ttatcaactt gagaaatgga aatgctcaca atccttcatg ggcggcaggg gtgagtccta    115260
     gattactgag tgccgtgtat gttgtattgt gtcatcttgt gtcatgtaga tctttttaaa    115320
     gcctaacctt ggaatccaat gattggatac aaatctttat tcgtttctag aaaaaatggc    115380
     tcctgaaact ctgtgcactt gttctgtagt tgacttaggt tcctgattat gtttctaaag    115440
     gactccttag agtctatttg atagcttaaa tccaagttct gaccactttc ttagatgatt    115500
     caaccccgta taaaaactaa gatctggact cggcagaaac agccaagtta tggtttctct    115560
     gtatgcaaca attaacattc ttgtttgggg tctagacttt taaacaggtg ttacgtttag    115620
     agtttatggt agctatagtt tcttaactaa ctatatattc actagcaatc atatgcagtg    115680
     tctttgaaat gagtaccaag tgtgatcagg tttagatatg tttcagtttc attgaggaca    115740
     tgtgctgtgt cagttttact gattgctaca cttttttttt gttttactag ggagacagta    115800
     ttctcgcaga ctccggcact gagcagctcg agtttattgc cctttcccaa aggacagggg    115860
     acccaaaata tcagcagaag gtagatacta attttgagtt tgtccaacag attttcttta    115920
     tatcctaact cggtgtgaaa aagtgggcaa tcaatctgca ttaatgctga agaaaatatt    115980
     ggctgctcaa gattgacacg tttgctaact catgtctctc aggtagagaa ggttattaca    116040
     gaactgaata agaactttcc tgctgatggt ttacttccca tctatataaa tccggataat    116100
     gctaatccat cgtactctac cacaacattt ggtgccatgg gagataggta gtttcttcct    116160
     ccaaattttc attttgtgtt ggtcgggtct tgtgaccatg actttgctct ctaactttta    116220
     ataataattt ggttttacag cttttatgag tatttgctca aagtttgggt gcaagggaac    116280
     aaaacatctg ccgtgaaacc ctataggtaa gtaaagctcg acgctgtgta tatacaccca    116340
     agtaattcaa tatcagcaat aaaggataag gactaaatct ttcttaatgt attgaatcag    116400
     agatatgtgg gagaaatcaa tgaaaggttt gttaagcttg gtcaagaaat caacaccttc    116460
     atcatttacg tatatatgtg agaagaacgg aaataatttg attgataagg taaaaactat    116520
     tctaatttca actctctact ttgagaattt tgttggtttt gacataattt caacattcag    116580
     atggatgaat tggcgtgctt tgctcctgga atgttggctt taggagcttc aggttatggc    116640
     cctgatgaag aaaaaaagtt tctttcactt gctggagagg tgccttagaa tctcaattgt    116700
     atgttgagta taactttctg ctgtgtcctt attgctgttt ccctcacttt actgcagctt    116760
     gcctggactt gttataactt ttaccaatcg acaccaacga aacttgctgg agagaactat    116820
     ttcttcactg cagggcaggt tggtaaatac tttttgcgca tctgtttgta tgttagttgg    116880
     ttggttatgt cgtatccata agcacatgat tgtttcagga catgagtgtt ggcacatctt    116940
     ggaacatttt aagaccagaa accgttgaat cactgtttta cctctggcga ttaactggga    117000
     acaagacata tcaagagtgg ggatggaata tatttcaagc atttgagaag aactctcgcg    117060
     tagaatctgg atatgtaggc ttgaaggatg taagtttcga gccgggctga ccttaaccaa    117120
     tcagataccc tcctcgagtg ggcctttcca tctttcggaa acacgttgtt aacgtttgct    117180
     tcttcatttt caggtcaata caggtgctaa agacaacaag atgcaaagct tcttcttagc    117240
     tgagactctt aagtatctat atcttctctt ttcgccttca tctgttattt cattagacga    117300
     gtgggttttc aacacagaag cccatccgct taagattgtg gcacggaatg atccgcgtaa    117360
     gccaactata gcactacgcc agaggaagtt tggtcatcag attaacgttt agtagacagt    117420
     ttctgctcaa atggaatttg atattattat atattaccac aaagtttgag gcacattgtt    117480
     gtatcagttt aaagaacaga tggacaacgt ttttgccaca gcaatttgta gaggtacttt    117540
     actgtttcct atgatttttg gatttgtaga agagcttttt tttactatca tgttaaaatt    117600
     gtacacactt tgaaaagaga gcaatcaaga ttgaccacag agaataaaag catgaagaag    117660
     gctttgagca aagtgagctt gatccgatgt gcctgagaca accaccagtc cttctgtagt    117720
     ccctgccttt ggatcatgca caaccacatt cgctcctgat acctagttga ttaggtttac    117780
     aaacggtaat cagatgcagc ctttcaaaat gaccagctgc tcatatatta tcggcaacat    117840
     acctgtttga tgtaattcag gttactgcag ttctcaccat agacatgacc taagtatgct    117900
     tgaggaatca caatctccac atttgcactt gtcattactg gattctcgct gccaacacca    117960
     taaccaaaag gcaataatgt gaaattagtg gataaaattc cttcgtacag tttctggcat    118020
     ttcaaagtca tttagtttta aagtgaacaa agacagcgcc gggaaagtga tacctgccaa    118080
     tgggctcatt tctcaaagca aatccatggt tcacatcagg aggaaccata ccaccgggat    118140
     ggccatcgat tcccggctgg cgattgagaa atgttgaatt agaaagaaat aaaaggacat    118200
     gacagctaac gaaggaataa agatcattga gttcacatac ctgcggggtc caagacattg    118260
     gggaaggtgg cctgtcaaat ccaggaccag gtggcctatc aaatccagga ccatgacaat    118320
     gcctctctgt atcatatgta acaagtagac attattaaga aactgagatt gatgcatgta    118380
     tcaactggtg atcatgggtc ggaaattgat gaaataccat ggaatggtcc tactggagaa    118440
     tggtaacgat ctggagaagc tggatattgt ctcggtccaa atgggggagg cggttctgga    118500
     tacggaccca tgaacggcgg aggtggacca cccattcctt gaaaaggaag tcttccagga    118560
     aacattgctt cccgaagcct acataatatt tggaacaaag catcttgaac agttttcaaa    118620
     ttaccaatga cctgccaatc cagcaaaaag gtgtcaaata acaagaaaac tacagagttg    118680
     aaaaacttat cgaggccgcg gatgttatat aaaatttacc tgaacaatct catcatgttg    118740
     tgattcatac tttgtagctt gatctttcgc aaagacgcgg atgctagcac cagttgctct    118800
     cctcatttca cttatcaaat gacccccttt acccaataga cgtccgatat atggagaatg    118860
     tacaagaagc cgggcaacaa cagcagcact aggttcaaat ccaatctcaa caattctatt    118920
     atgcacacgc atcacaccat cttgggcaag agagtgcctt ctctccaagt tctacaacaa    118980
     tgtaaaccaa tgagacaaag tatccaatga tatacataaa ccaaatccat ggagcaaatc    119040
     aacatacctc tcgtgccgat atcacaataa tccgctcctc tgaatcatga gttggatccg    119100
     aaaccttgat tgacgcaccg ctttcgtttt gcagagctcg caccacagct ccacctttcc    119160
     caatcaagct tccaacttta tcagccgggc ataacaacct gaacgcaacc tcctcttcaa    119220
     caaccggtct attaaagggt ccaacatctt caggcattgg attaggagga ggatgatccc    119280
     attgaggatg atactccata gaatgatact caggcggata accaggctgc ggaaacggac    119340
     actcgtccca tgttggaggt gcaccacttt cttgaagaca gtttgtaacc aacaaaagcg    119400
     ccttcttcac actcgaaaac tttccattca tcttcataca aaaacattac taaatcagcc    119460
     aaaaaagctc tataaattga atagccacaa agacacaaga agctgtgtat acctgaatca    119520
     caacatctcc agggaaagca caaggaggaa tctgatcagt agatgagatc ctaacaatag    119580
     ctccactatc ttctctaatc ttctgaatca tcttccctcc tttactcatc aagtaatcta    119640
     cttgattacc tctaacaatc atcctacaca aaccttcact ctcaccttta tccaattcat    119700
     caccatcaac cgtagcagcg tcatcgccaa acactattct ttcgaaaacc ctaagtaaag    119760
     ccatctgcgc cgacgacggc gcttcctcgt catctccacc actagtcccc gcacactcgc    119820
     tccctttctc ttgcttaggc tcttcagagc cagggttttc ggaatcacac acattcgatt    119880
     cgtccttctt ctttccacta ggtgcgatta tcaacactac acgctcttct gaaggaacgg    119940
     gaatatcatc gatgacgcgg atttttgaac cggttacaga ttggaggtgt cgaatgactg    120000
     agccgccttt tccgattatt gcaccagttc ttgttgccgg acagagaaga cggaaatgta    120060
     cagactccgc cgccgtcgct gtcgtcgccg gacgttttga ggtagagaac tccattagtc    120120
     gaataagctt aacaacgtcg ttttgagttt aactcaaagg ctcttaaatg ttttaaaatc    120180
     tgttttataa aataccacta aactatgttt tttctctttt ccaaaaatat tttaatgagt    120240
     ttattttttc gaaaatacta caacaaaaat tttgttccaa atttattaca aacaccaaaa    120300
     ttaatttttc aaggtttata atttaaactt ttgagtttag aatttgttgt taggatttag    120360
     agtttatttt tacggtttag gatttagttt tgaaagttta aaatctagtt tttgttttgt    120420
     ggtatgtttt gagaaaaaaa ctagtgacag tatttgtgga acaataatac tcaatttagg    120480
     tatttttgag aattgccata gtatgtgaga cttttgagta ttatttgaaa taaaagttct    120540
     attcatattt tcgtacttaa aaaaggagag aaagaaataa aaatttatat tgtgtagtcc    120600
     ttttcaaatc aaatttcatg attatgaaga aaatgttttt cacttattgg cctttttttt    120660
     tttctttctg ccaactcata aaatcatttt gaatttaaaa caaaaatcga aaagagcaaa    120720
     aaaaaaaaaa gcaaaaggaa gaagaagaca agaaaacctt caccactcta cttcaatgtg    120780
     ttttactttt ctctcactac agtcctttct ctctatctct ttctaaaact ctctcaatgc    120840
     ttatcttctg attttacgag gaagaagaag aaaggattct tctttacttc tttctttttt    120900
     tgggggttta atgttaagca gattctgaga tttctggtgt aaatcgtttt ctggggttgt    120960
     ttgtttgttt tgaagatcta acttatagat ctagtgtttc tgaaagaaga aaaaatccaa    121020
     actttactag tttcaaagat gcagagacca cctcctgaag atttctcctt aaaggagaca    121080
     aaacctcatc tcggtggagg caaagtcacc ggagataagc tcacaaccac atatgacctc    121140
     gtcgagcaaa tgcagtatct ctatgttcgt gtcgtaaagg ctaaagaatt accaggtaaa    121200
     gacttaactg gtagttgtga cccttacgtt gaagttaagc ttggtaacta cagaggaacc    121260
     actagacatt tcgagaagaa atctaatcct gagtggaacc aagttttcgc cttttctaaa    121320
     gatagggtac aagcttctta tcttgaagct actgtcaagg ataaagattt agttaaagat    121380
     gatttgattg gtcgtgttgt gtttgatttg aatgagatac ctaagagagt tcctcctgat    121440
     agtcctttag ctccacaatg gtatagatta gaagatggga aaggccaaaa agttaaagga    121500
     gagcttatgt tagctgtttg gtttggtact caagctgatg aagcttttcc tgaagcttgg    121560
     cactctgatg ctgcaactgt tagtggaact gatgctttag ctaacatcag atctaaggtt    121620
     tatctctctc ctaagctttg gtatcttagg gttaatgtca ttgaagctca ggatttgata    121680
     ccgagcgata aagggagata tcctgaagtc tttgtgaaag tgataatggg aaatcaggca    121740
     ttgaggacta gagtgtcaca aagcaggagt attaatccga tgtggaatga ggatttgatg    121800
     tttgttgtag ctgagccgtt tgaagagcct ttgattctaa gtgtggaaga tagagttgcg    121860
     ccgaataaag atgaagtctt ggggagatgc gcggttccgt tgcagtattt ggacaaaagg    121920
     tttgactata gaccggtgaa cagcaggtgg tttaaccttg agaagcatgt tataatggaa    121980
     ggaggagaga agaaagagat caaattcgcc agcaagatcc acatgaggat ttgtttggaa    122040
     ggagggtatc atgtgcttga tgagtctaca cattacagta gtgacctaag accaactgca    122100
     aagcaactgt ggaagcctaa catcggtgtg cttgagctag gggtcttaaa tgcgaccggt    122160
     ttaatgccca tgaaagctaa agaaggtggt aggggaacca cggacgcgta ttgtgtggca    122220
     aagtatgggc agaaatggat cagaactcgg acaattattg acagctttac cccaagatgg    122280
     aacgagcaat atacttggga ggtttttgat ccgtgtactg tagttacagt tggtgtgttc    122340
     gataactgcc atctacacgg tggtgacaaa aacaacggag gaggaaaaga ttcaagaatt    122400
     ggaaaggtga ggataaggct ctctactctc gaggctgatc gagtctacac acattcatat    122460
     cctcttttgg tgctacatcc tagtggagtc aagaaaatgg gagagattca cttagcggtg    122520
     aggtttactt gctcttcatt gctcaacatg atgtatatgt attctatgcc tctcttacct    122580
     aagatgcact acctccatcc cctcacggtt agccagctcg ataacttaag gcatcaagca    122640
     actcagattg tgtcgacaag gctaacacga gcagagccgc ctttgaggaa agaagttgtt    122700
     gagtatatgc ttgatgtggg atctcacatg tggagtatgc gtagaagcaa ggcgaatttc    122760
     ttcaggataa tgggagtctt gagtgggata atcgctgtag ggaaatggtt tgaacagatc    122820
     tgcgtatgga aaaatccgat aacaacggtt ttaatccaca ttctcttcat tatccttgtt    122880
     atctaccccg agctcatctt gcccaccatt ttcctctacc tcttcttgat tggagtttgg    122940
     tactatcgct ggaggccgag acatcctcca cacatggaca cacgtctctc acacgctgac    123000
     tcagcacacc ctgatgagct cgacgaggag tttgacactt tccctacttc ccgaccatca    123060
     gacatcgtca ggatgagata tgaccgactc agaagcattg ctggtaggat tcaaacagtt    123120
     gttggtgatc ttgcaactca aggagagaga tttcagtcgt tgctaagctg gcgtgacccg    123180
     cgtgccactg ctctcttcgt cttgttctgt ctgatagctg cagtgatttt atatataact    123240
     cccttccagg ttgtggcttt tgccattggc ttgtatgtgc ttagacaccc gaggctcagg    123300
     tacaagctcc catcagttcc acttaacttc ttcaggaggc ttccagcaag aactgattgc    123360
     atgctctgag ttacttaaga tttctccatt tcaagaaaga ctcctctgtt ctagtttgtt    123420
     atcgttttga agtccttacc tcttctttgt gatgttggat gatcatgttt ttttctgttt    123480
     gacattattt atgtttatgt ccttttgaaa actttctttg gaaagtggta actagtaaga    123540
     taagtttgtg tttttggatt ctcttctgtt tagcctctct ctctctctct ctctctttaa    123600
     gtcgaggaga tgccaagagg aagaagataa atgcggaaag tatattttat aatgtaacca    123660
     aaatttcagt aaaccgtacc aaaccaactt aacttcggtt tagtgtacgt agtggctaaa    123720
     tttctcgaac caaaccgaaa aaccaattgt tcaagcctat tgaaaatcat tcagacaatt    123780
     tttgcagggg aatctaataa agttgggatt ttttttttgg ttttaaaaag aaagttggga    123840
     tttttgaagc gatcttgttt ctctaccatg gatgctgcta tctttacttc cgtatacgtt    123900
     tgcaatatac caaagacgaa gaaggctttc ttcaacccga atccgcctgc tctatcttcg    123960
     tcttcttgtt ggctctgcaa ttcgcaagcc aagcaaatca taaaactgag aatcagggaa    124020
     ggctcgaatc aggggcttct tcgtgtacat gctctgttta acaacgagga ggcatcaagt    124080
     gaaagtgaag ataagaatgg gtttggtttg ctacctgcgg atattttctc tttgcctcag    124140
     gtaaatgagg ttattaagtt gctcttttct aatttatatg tgggtttatg gtgttgtatg    124200
     caaattaaga gctttcaatt gatgaagaaa gcttgaactt gtgcataaga ttgatatggt    124260
     tcattatttg tttgtgaagg agaagtttgg aagtaatgta agtggtgaaa aggatagtga    124320
     aaatataatt gatgtagaga catctcttgc ggttcctcat ggtggaggaa ctcgagctgg    124380
     gctctttaga actccgattt ctggtggtgt tcaaagcgca acctctgctc acggtttacc    124440
     tcgacctgct ttagctgtta ggaacttgat ggagcaggta aaacaatcat ttccatttgt    124500
     tctcatttat g                                                         124511
//

If you have problems or comments...

PBIL Back to PBIL home page