(data stored in ACNUC26462 zone)

EMBL: AC104280

ID   AC104280; SV 2; linear; genomic DNA; STD; PLN; 75456 BP.
XX
AC   AC104280;
XX
DT   11-DEC-2001 (Rel. 70, Created)
DT   03-OCT-2004 (Rel. 81, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group chromosome 5 clone OJ1430_B02, complete
DE   sequence.
XX
KW   HTG.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-75456
RA   Chow T.-Y., Hsing Y.-I.C., Chen C.-S., Chen H.-H., Liu S.-M., Chao Y.-T.,
RA   Chang S.-J., Chen H.-C., Chen S.-K., Chen T.-R., Chen Y.-L., Cheng C.-H.,
RA   Chung C.-I., Han S.-Y., Hsiao S.-H., Hsiung J.-N., Hsu C.-H., Huang J.-J.,
RA   Kau P.-I., Lee M.-C., Leu H.-L., Li Y.-F., Lin S.-J., Lin Y.-C., Wu S.-W.,
RA   Yu C.-Y., Yu S.-W., Wu H.-P., Shaw J.-F.;
RT   "Oryza sativa BAC OJ1430_B02 genomic sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-75456
RA   Chow T.-Y., Hsing Y.-I.C.;
RT   ;
RL   Submitted (07-DEC-2001) to the INSDC.
RL   Institute of Botany, Academia Sinica, 128, Section 2, Academia Road,
RL   Nankang, Taipei 11529, Taiwan
XX
RN   [3]
RP   1-75456
RA   Hsing Y.-I.C., Chow T.-Y.;
RT   ;
RL   Submitted (29-MAR-2003) to the INSDC.
RL   Institute of Botany, Academia Sinica, 128, Section 2, Yien-chu-yuan Road,
RL   Nankang, Taipei 11529, Taiwan
XX
RN   [4]
RP   1-75456
RA   Chow T.-Y.;
RT   ;
RL   Submitted (30-APR-2004) to the INSDC.
RL   Institute of Botany, Academia Sinica, 128, Section 2, Academia Road,
RL   Nankang, Taipei 11529, Taiwan
XX
RN   [5]
RP   1-75456
RA   Chow T.-Y., Hsing Y.-I.C.;
RT   ;
RL   Submitted (02-OCT-2004) to the INSDC.
RL   Institute of Botany, Academia Sinica, 128, Section 2, Academia Road,
RL   Nankang, Taipei 11529, Taiwan
XX
DR   MD5; 3f4c739811f217df22ec678e433be2fe.
DR   ENA-CON; AP008211.
DR   RFAM; RF00886; MIR807.
XX
CC   On Apr 30, 2004 this sequence version replaced gi:17402728.
CC   The nucleotide sequence of this BAC clone was generated by
CC   combining Monsanto and ASPGC-Taiwan sequencing data. Genes were
CC   predicated from the integrated results of the following: BLASTN2.0,
CC   BLASTX2.0, GENSCAN (Chris Burge,
CC   http://genes.mit.edu/GENSCAN.html), Fgenesh
CC   (http://www.softberry.com/), GlimmerR
CC   (http://www.tigr.org/softlab/glimmer/glimmer.html), TWINSCAN
CC   (http://genes.cs.wustl.edu/) and GeneSplicer
CC   (http://www.tigr.org/tdb/GeneSplicer/index.shtml). The sequence was
CC   searched against the Swiss-Prot+TrEMBL protein database, the NCBI
CC   Plant EST database, the TIGR Rice Gene Index and the rice
CC   full-length cDNA database (KOME,
CC   http://cdna01.dna.affrc.go.jp/cDNA/). Annotated genes are named to
CC   indicate the level of evidence for their annotation. Genes with
CC   similarity to other proteins are named after the database hits.
CC   Genes without significant peptide similarity but with EST
CC   similarity are named as unknown proteins. Genes without protein or
CC   EST similarity, that are predicted by more than two gene prediction
CC   programs over most of their length are annotated as  hypothetical
CC   proteins. This clone overlaps with OSJNBb0115F21(accession #
CC   AC135918) and OSJNBb0016G07(accession # AC130599).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..75456
FT                   /organism="Oryza sativa Japonica Group"
FT                   /chromosome="5"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="genomic DNA"
FT                   /clone="OJ1430_B02"
FT                   /db_xref="taxon:39947"
FT   gene            266..1453
FT                   /gene="OJ1430_B02.1"
FT                   /note="unkonwn protein"
FT   CDS_pept        266..1453
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.1"
FT                   /product="unkonwn protein"
FT                   /note="similar to rice EST D42558"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q60EZ5"
FT                   /protein_id="AAU90184.1"
FT                   /translation="MESVLARLPSSLRPREPLLCRVISAYGRARLPAAARRAFAHPAFP
FT                   APRTARALNTLLHALLACRAPLPELLSECRGSGIHPDACTYNILMRAAVADSGSVDNAC
FT                   LLFDEMLQRGIAPTVVTFGTLVTAFCEAGRLEEAFKVKEVMSLQYNIRPNAHVYASLMK
FT                   ALCEKGKVDDAHRLKEEMVSNSEPLVDSGAYATLARALFRLGKKGEVVSLLEEMKEKGI
FT                   KVGREVHNSMIAGFCEDEGDLDAAFAALDDMQKGGCKPDSVSYNTLVGGLCKMGRWRDA
FT                   SELVEDMPRRGCRPDVVTYRRLFDGICDAGGFSEARRVFNEMVFKGFAPSKDGVRKFVA
FT                   WIEREGDAASLESVLCQLASVNALESSEWEKAMSGVLHDPAEQKIVKLLDNLSLA"
FT   gene            2757..4648
FT                   /gene="OJ1430_B02.2"
FT                   /note="putative 60S ribosomal protein L11"
FT   CDS_pept        join(2757..2759,2902..3009,3207..3249,3357..3552,
FT                   4450..4648)
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.2"
FT                   /product="putative 60S ribosomal protein L11"
FT                   /note="'similar to rice EST CF279947, AK070605, AK062150'"
FT                   /db_xref="GOA:Q0DK10"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0DK10"
FT                   /protein_id="AAU90185.1"
FT                   /translation="MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQ
FT                   SPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCF
FT                   GFGIQEHIDLGIKYDPSTGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMK
FT                   WFQVKYEGVILNKAQANTS"
FT   gene            complement(6084..9335)
FT                   /gene="OJ1430_B02.3"
FT                   /note="unknown protein"
FT   CDS_pept        complement(join(6084..6306,9052..9335))
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.3"
FT                   /product="unknown protein"
FT                   /note="'similar to rice EST AK104023, AK070191'"
FT                   /db_xref="GOA:Q60EZ3"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q60EZ3"
FT                   /protein_id="AAU90186.1"
FT                   /translation="MAVIAAAGGEGDAGVIAHVVVDVDESCAAAADDDDRSRRPSTGCR
FT                   ICHLGGGGDGEMAAESGSGRLVRLGCGCRGELAAAHRRCAEAWFSVRGNRRCEICGETA
FT                   ENITGWGGGGKEFMKRWHATAGVDVEGSSKACSGFCKSHSLCNLLIACLIIVIVLPWLL
FT                   HNHVL"
FT   gene            complement(11147..14505)
FT                   /gene="OJ1430_B02.4"
FT                   /note="putative shaggy-related protein kinase"
FT   CDS_pept        complement(join(11147..11239,11351..11452,11976..12059,
FT                   12244..12339,12427..12477,12591..12731,13079..13135,
FT                   13217..13291,13377..13649,13743..13802,14238..14339,
FT                   14431..14505))
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.4"
FT                   /product="putative shaggy-related protein kinase"
FT                   /db_xref="GOA:Q60EZ2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60EZ2"
FT                   /protein_id="AAU90187.1"
FT                   /translation="MDQPAPAPEPMLLDAQPPAAVACDKKQQEGEAPYAEGNDAVTGHI
FT                   ISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRE
FT                   LQLMRAMDHPNVISLKHCFFSTTSRDELFLNLVMEYVPETLYRVLKHYSNANHRMPLIY
FT                   VKLYMYQLFRGLAYIHTVPGVCHRDVKPQNVLVDPLTHQVKLCDFGSAKTLVPGEPNIS
FT                   YICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLG
FT                   TPTREEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALD
FT                   ACAHPFFDELREPNARLPNGRPFPPLFNFKHELANSSQELISRLIPEHVRRQATHNFFN
FT                   TGS"
FT   gene            complement(20552..24985)
FT                   /gene="OJ1430_B02.5"
FT                   /note="putative serine/threonine-specific protein kinase"
FT   CDS_pept        complement(join(20552..20779,21202..21334,21491..21749,
FT                   23909..24044,24467..24985))
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.5"
FT                   /product="putative serine/threonine-specific protein
FT                   kinase"
FT                   /note="'similar to rice EST CB682973, AK103861'"
FT                   /db_xref="GOA:Q60EZ1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q60EZ1"
FT                   /protein_id="AAU90188.1"
FT                   /translation="MSSGGGGGDDYKREESVALMVIVSLAALSLLSLVAAFAYYCYITR
FT                   KVSRRLHSLDLPKHHRRSSSSSPPPMPPPLPPPPPSANAPTLGKESPSSNSASDGAAAA
FT                   VVVGGERGAVQVFSYRQLHAATGGFGRAHVVGQGSFGAVYRGVLPDGRKVAVKLMDRPG
FT                   KQGEEEFEMEVELLSRLRSPYLLGLIGHCSEGGHRLLVYEFMANGGLQEHLYPNGGSCG
FT                   GISKLDWPTRMRIALEAAKGLEYLHERVNPPVIHRDFKSSNILLDKDFRARVSDFGLAK
FT                   LGSDRAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDMKRP
FT                   PGEGVLVNWALPMLTDREKVVQILDPALEGQYSLKDAVQVAAIAAMCVQQEADYRPLMA
FT                   DVVQSLVPLVKNRSTPKTCNPSVQA"
FT   gene            32841..45462
FT                   /gene="OJ1430_B02.6"
FT                   /note="unknown protein"
FT   CDS_pept        join(33504..33782,33863..33941,34018..34067,35335..35532,
FT                   35609..35666,36442..36550,37307..37375,37738..37866,
FT                   38024..38224,38303..38358,38440..38533,40881..40971,
FT                   42791..42910,43903..44250,44368..45462)
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.6"
FT                   /product="unknown protein"
FT                   /note="'similar to rice EST BP184775, AK068965'"
FT                   /db_xref="GOA:Q60EZ0"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q60EZ0"
FT                   /protein_id="AAU90189.1"
FT                   /translation="MNQPEVNGLLCVGLHQTDGGDELYATECLKMNQGSSHETNKLDAV
FT                   MSASTMHSDHNNANACVDDYQHTKMMAGIQPMEEVGFGCTQPFELQSQGIVPDSEEESL
FT                   PSSPETSSTSNYDMPDLAEQNLEHIYNVLGEMVDKEGPVVLSPEYVMCGTTSHVEPRLT
FT                   FSADGFKIEYWDSCENDEMAAQYWKISDITCIDCKWAQSVGSVLITLHVGSGTETGNSS
FT                   HDRIQFCLIDSQWPRKQQNIWHLASRYQEIWNNIPSGDFASENWNIEPSLFFPKQYFSD
FT                   TEEFEDVIYPKGDHDAVSISKRDVELLLPETFVNDTIIDFYVKHLSTRIEPAEKHRYHF
FT                   FNSFFFRKLADLDKDQGRAPEGRAAFLRVRKWTRKINIFTKEFLFIPVNFNLHWSLIVI
FT                   CYPGEVETFKDGDTNISAKIPCILHMDSLKGSHSGLKDIIQSYLWEEWKERHPESASDC
FT                   SDKFLNLRFISLELPQQDNSFDCGLFLLHYVELFLMDTPRSFNPLKIDSFANYLSDDWF
FT                   PPAEASLKRSLIRKLIHKLLKEPSQDFPKLVCCSEQLDKTHGSENAELEQMSENAEREQ
FT                   AKELPAQMCTDGEPDSVGTILETQQPSISTCFNYSDENGPPVSVHNLHKLEVSSANKDA
FT                   IVCLSNHDEKNESPPADSYNHLDLRSCDSEEAETAKGSAGVVKDPNSHKEPLLDSLDNN
FT                   QDISIQAGAEMHDSMDSKLCSISNNADLMASEERSLDKNTNENEEHNRTSEDIVESVMM
FT                   LGGSKSDTELDAEPERTAGEAEVRNCDHSKDIDYIALGDINKDAAKQSLNRNIVEAEDI
FT                   KCEGTLVDHTVVEDATPYNVNETSASADKINDNEHNVSSELKEGNNGNGITTSISCEME
FT                   DRSIDNLMVGDSRNGTDETRADGQEAHDNSATAETVPCEDNATTSITDAEMPHEDSTCS
FT                   VKGEAISDNTASDAKRPLPDSTYIEDIPDDKCLQKDDGGGDEAKTERHYKRRKFLVSEA
FT                   TS"
FT   gene            49748..53294
FT                   /gene="OJ1430_B02.7"
FT                   /note="putative 2-oxoglutarate/malate translocator"
FT   CDS_pept        join(49748..49888,50705..50788,51089..51150,52329..52690,
FT                   52932..53146,53238..53294)
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.7"
FT                   /product="putative 2-oxoglutarate/malate translocator"
FT                   /note="'similar to rice EST AU070568, AK071500, AK059612'"
FT                   /db_xref="GOA:Q60EY9"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q60EY9"
FT                   /protein_id="AAU90190.1"
FT                   /translation="MADAKQQQQQQTAAAATGVWKTVKPFVNGGASGMLATCVIQPIDM
FT                   VKVKIQLGEGSAAQVTKNMLANEGIGSFYKGLSAGLLRQATYTTARLGSFRVLTNKAIE
FT                   KNDGKPLPLVQKAFIGLTAGAIGACVGSPADLALIRMQADSTLPIAQRRNYKNAFHALY
FT                   RIIADEGVLALWKGAGPTVVRAMALNMGMLASYDQSVELFRDKLGAGEVSTVLGASAVS
FT                   GFFASACSLPFDYVKTQIQKMQPDASGKYPYTGSLDCAMKTFKSGGPFKFYTGFPVYCV
FT                   RIAPHVMMTWIFLNQIQKFEKQIGI"
FT   gene            complement(54538..55938)
FT                   /gene="OJ1430_B02.8"
FT                   /note="unknown protein"
FT   CDS_pept        complement(54538..55938)
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.8"
FT                   /product="unknown protein"
FT                   /note="similar to rice EST AK107068"
FT                   /db_xref="GOA:Q60EY8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60EY8"
FT                   /protein_id="AAU90191.1"
FT                   /translation="MPEKGTVVMSRYELGRSLGHGTFSKVYQARSLVSGETVAVKVIDK
FT                   EKALRAGAGMVDQIEREVAVMRLVGRHPNVVRLHEVMASRSKIYFVMELVRGGELLARL
FT                   VAGGGRLGEDAARRYFHQLVAAVDFCHSRGVYHRDLKPENLLVDDDGSGGGGNLKVTDF
FT                   GLSALSASRRHDGLLHTTCGTPSYVAPEIIGDKGYDGATADVWSCGVILFLLLAGYLPF
FT                   FDSNLMEMYKKITNGEFKVPDWFTPDARSLISRLLDPNPTTRITIDELVKHPWFKKGHT
FT                   KRPASSNTMKLNEEEKPANAAMNMKPASLNAFDIISLSQGFDLSGMFCCHGHSSRTQDQ
FT                   LFVTGKPATAIVSRLEEIAETEHFTVKKKQKKRQEEDGMAVKLQGWKEGRKGQLAIDAE
FT                   IFEVSPSCYVVEVKKTAGDTLEYQAFCNRDLRPSLNDICWTSPATAASEKNQLPAVSEV
FT                   SPLSSPRN"
FT   gene            complement(60928..61323)
FT                   /gene="OJ1430_B02.9"
FT                   /note="hypothetical protein"
FT   CDS_pept        complement(join(60928..60953,61092..61323))
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.9"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q60EY7"
FT                   /protein_id="AAU90192.1"
FT                   /translation="MERAAARPAMDGGQDGGSRWPVRGVEEREEGEWICGRRMARKEKR
FT                   GFAARRHVNSPAWCSANARHEARLMTGTEGDSEQSKWISS"
FT   gene            complement(66794..67428)
FT                   /gene="OJ1430_B02.10"
FT                   /note="hypothetical protein"
FT   CDS_pept        complement(join(66794..66802,67204..67428))
FT                   /codon_start=1
FT                   /gene="OJ1430_B02.10"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q60EY6"
FT                   /protein_id="AAU90193.1"
FT                   /translation="MPNGIVETGIRARLRIAAVVARTRLLMNWLFIAGLYHGREFYPTA
FT                   DIKDIDSSNDEDKSDDVAAREDMKLAIITTVN"
XX
SQ   Sequence 75456 BP; 22231 A; 15041 C; 14889 G; 23295 T; 0 other;
     cgcacgccac gtcgccggcc tcgagtcgac gacgccgtag cccaccgaca tgagcggcgc        60
     caccgccaag ttctcttcct cctaccacct cgccgccgcg ctccgccgcg agcccgaccc       120
     ggcggccgcg ctccgcctct tcctcagccc caccccgacc gccgccgccg ggccatcctc       180
     ctcccccgcg ccgccgttcc gctactccct ccgctgctac gacatcatcg tctgcaagct       240
     cgccgccgcg cgcctcttcc cggccatgga gtccgtcctc gcccggctcc cctcctcgct       300
     ccgcccgcgc gagcccctcc tgtgccgcgt catctccgcg tacggccgcg cccgcctccc       360
     cgccgccgcc cgccgcgcct tcgcgcaccc ggcgttcccg gcgccgcgca ccgcccgcgc       420
     cctcaacacg ctcctccacg ccctcctcgc ctgccgcgcg cccctcccgg agctcctctc       480
     cgagtgccgc ggctccggca tccaccccga cgcgtgcacc tacaacatcc taatgcgcgc       540
     cgcggtggcc gactctggct ccgtcgacaa cgcctgcctc ctgttcgacg aaatgctgca       600
     gcgggggatc gccccgactg tcgtcacgtt tggcaccctc gtcactgctt tctgcgaggc       660
     aggacgtcta gaggaggcat tcaaggttaa ggaggtgatg tctttgcagt acaacattag       720
     gccgaacgct catgtgtatg cgagcctgat gaaggcgctc tgcgagaagg ggaaggtgga       780
     tgatgcgcac agactcaagg aggagatggt gagcaattca gaacctttgg tggattcagg       840
     agcttatgcg acgctggcaa gggcattgtt ccggttaggg aagaaaggag aggttgttag       900
     tttgctggaa gagatgaagg aaaagggaat caaggttggt agagaagttc ataattcgat       960
     gattgcaggg ttttgtgagg atgaagggga tctggatgct gcatttgcag cgctcgatga      1020
     catgcagaag ggtgggtgca agccggactc ggtgagctat aatacactgg ttggtggtct      1080
     atgcaagatg gggcggtggc gggatgcaag tgagttggtt gaggatatgc cacgaagggg      1140
     atgccgtcct gatgtagtca cctacaggag gctgtttgat gggatttgtg atgctggggg      1200
     gttcagcgag gcgaggaggg ttttcaatga gatggtattc aagggctttg caccaagcaa      1260
     ggatggtgtg aggaaatttg ttgcatggat tgagagggaa ggagatgcgg cgtcactgga      1320
     gtcagtgttg tgccaattgg ctagcgttaa cgccttggaa tcaagtgagt gggagaaggc      1380
     aatgagtggt gtgctccatg atcctgcaga gcagaagatt gtgaagttgc tggataattt      1440
     gagcttggct tgattatata tccctatgga ttgttgtcac tgtactggtt gtttttctga      1500
     tctgccacag tagtttactg atttaaattt gatgactctt gagtaattat catgggaagg      1560
     aaagagatac aacatcatca atacgaggag tttgtcatta aaaatacatg ccaatctaac      1620
     atcaatggtg cattcttgaa gcaaatgaag caaggagtca tagggatgat tgcaagtgat      1680
     gatacagacc aagtcttatt tttcataacg ctgccgtctt cagcaatgat tgcaaacaga      1740
     gtttgagcat gcaaatatgc tctgtccttg gcaaagattt ggatcaaccg cctaatcatc      1800
     gttgagtaag gcactgcaaa tccagttgag cttctatttc tctacgatgt ggcatggagt      1860
     ccatccaaat tttttacacc gaagaaagat gtctgaaaac ttgcagcgga gatatcaaaa      1920
     ttaagaaaaa aaaaactcgg tagagtagga catgaaattg cctggaatgc aaaattatca      1980
     ggacttaatg ctgttatgtt gtattttcag tccaagttca gggttgtata tagcaatatg      2040
     agctccggga ttgtaccccc tatacccgtg atatctaata ctcctaaaga tctctctttt      2100
     cccataatga ggtaactagc cgagatcagc gaaaagaaga acaacacgag tgcaacagat      2160
     ctggtgacat ttttgtcagt cgctaacatc gggaaaagaa aaagagatcc cgaggcacat      2220
     tgaagttgga tgaaatcatc acagttgcct tgttgtcgag ggtacatcga ttatcactga      2280
     aagaataaat aactacgagg accaatatta aatctaattg gttgcaccat aggaaaccaa      2340
     cctagccagc ccataggaaa catagccagt tgagctcact ttgcaaatta aggttttttt      2400
     tatatgtgaa tgaaatgagc agtaactcta aatatagtta actaaagttc aaaaaaatat      2460
     atagttaagt aagtttggtc caagcagggg aaggcctatc agtgactaat cctagcccaa      2520
     caaactatct gggccaggca agtcctatca cggcccaaat aacaagtccc aaaacagaga      2580
     gcctaaacaa caactccatc cgagccgtcc attccgcgat cagagcgctc tctccgccac      2640
     ccccctcgct atataagcac ccgagggtgc atttctaggg tttccgccgc cgaagccacc      2700
     acacctaaac ccttcttccc tctcctcctc cgccgccgcc gccctcccct ctcgccatgg      2760
     tgagtgaacc cctcctcccc cctcgacgcc gccggtgaaa tgctcggctt ctccgtccat      2820
     catagtgtga cggggtttcg tggagattgg ttggttgctc acgccgcgtg ttttttgttt      2880
     tttttttggg gggttttgca ggcgtcggag aagaagcagt cgaacccgat gcgggagatc      2940
     aaggtgcaga agctcgtgct caacatctcc gtcggcgaga gcggcgacag gctcacccgc      3000
     gcctccaagg tatatcctcc attggttcga ttgatttggg tggtagatct gctcgtccgc      3060
     gatatgctct aagcaaaagt ttgtctcaag aaatgcatgc gtcgcagttc gaatcgaatt      3120
     cttgcttccg cttccacgat cttctgtatg caactcttga tttcttttta atcaaaaaaa      3180
     attctctgtt tcgttctcct tcctaggtgt tggagcagct gagtgggcag agcccagttt      3240
     tctccaaggg taagcgaatt ttgttccaag ctttgtaatc tctttcatcg cgttgttacc      3300
     aatggtgcca ccgtgtggtt tggtttctta cggtgagagc gatgcgatgt ttgcagcgag      3360
     gtacaccgtg aggtcattcg gtatccgtcg taacgagaag atcgcgtgct acgtcaccgt      3420
     caggggcgag aaggccatgc agcttttgga gagtggcctc aaggtcaagg agtacgagct      3480
     gctgaggagg aacttcagcg agaccggatg cttcgggttc ggtatccagg agcacattga      3540
     tcttggcatc aagtaggacc atctatctgt cttgcactca tgttaattca tacggtttca      3600
     gtgtgctttc cttctgttta tatggctatg acgaattggt tgtggttgtc cggtctctgg      3660
     acgtttattt acctgatgcc attgcaatct gctttggtgg ataataggct tggtagatgt      3720
     tcctatgtga aatataaaca catgtgcatt cttgaatgct cagttgctcg ttctttacat      3780
     ttgccgttat aaatcattat tctatcatat accgaatgat tttatttgca catatagcct      3840
     actagttttg ttccttaagt cattgtatgt catttcataa atgccacaat ttgatcctta      3900
     gtcattgtat gtcatttcat aaatgccaca atttgacatt gcatggaatt tctgatgtgt      3960
     gcgccattgt ttatttctac atgaagtgga aatttgtgat gcatgaacga aatttttgcc      4020
     cctctttggt actgtcctag tttaaatagt tttacataga agttatttta tatgaaccca      4080
     ggtgtaacta taggggctta tgacctcaag ttagataatg ttattccagg ttaaatatct      4140
     taatttaacc atgattaacc aagatcagaa cactgttctc atctttatca aatagtttac      4200
     ttttgattgt ttttgtgacc ttatattacg atgtttcttg tctacaatta acattctgca      4260
     acattcctta tgtttcctag tttatatttt ggtgttactt tgcaactcat ttgcttgagc      4320
     cacttgtata tctgaaacac cttttctgtg ctttgtattg tagataattc gtattgtaga      4380
     caatcttata ccaagcgtaa ctaggagtac tcgtgctaag agaattaact tgtctaatca      4440
     atgtttcagg tacgacccgt caactggtat ttatggcatg gacttctatg ttgttcttga      4500
     gcgtgctgga taccgtgttg ctcgccggcg caggtgcaag tcccgtgttg gaatccagca      4560
     cagggtgacc aaggaagatg ccatgaagtg gttccaggtc aagtatgagg gtgtcatcct      4620
     caacaaggcc caagcaaaca cgtcgtaatt ggcaagggtt taaccagtta tcctgtagaa      4680
     ttaagtgagg gttcatttga atcatggaac tgtctttctt gaaagccaaa tgcactgtca      4740
     attttgcctc tgttggagtt gacctgcgtc tatatttcca ttaaatgctt aatgatatcc      4800
     ttgttttaaa tcttaatatt aaggcagact tggaatcaat ccacccgctt tgttacctgt      4860
     atttctgcct tatcctgtgt caggcaaaag ctaagtagca acagtcaaat tgttcatttt      4920
     agtgatgttt tatttggggt gccaatttct tcttttggac tgcgacttgt gacatcttca      4980
     tggcggtata catcttactc tcttggtaat gtcaatgcat tgctatgctt tgggcgcatg      5040
     tttttatcga tatggtgtgt atttgttctt ggggacatat ccggtaaaaa tgagctaagt      5100
     gttgaaaact cgtgaaaatt atacctaaaa gttttgtaaa ttcatgaaaa aaaatactag      5160
     agataggtgt agatatgaaa tacattctca ccaaatctca cgttcaaact caacttcgtt      5220
     taggagtaac aaaaaagaca aatttcaggt gaatagtaac atgacactat tcacctgaaa      5280
     tttgtctttt ttgtttctca taaacgaact tgagtttgga gttgagattt ggtgagaatg      5340
     tatttcatat ctacacctat ctctagtatt tttttcatga atttacgaaa cttttaggta      5400
     tgattttcac gagttttcaa cacttagctc attttcaccg gatatgtcct ccttgttctt      5460
     agtatgaaaa atggtaaatt gggtaaaaaa aacactaaaa gttttgtcat ctaagggtgt      5520
     gtttggttgg gggcacgagg ctggatggga gatggccacc tgattttttt tcttagtgtt      5580
     tggttggagg gcagggtgga tgggttccct caatatgctg gatgagtgca tccggccgat      5640
     ttggctggcc ggatgaagcc atccagtttt ggtctgggtg atgtgtcctt tggtttggta      5700
     tgattggttt gattttctgt taagcaagcc ccaaattttt ttctcctaaa ccgtttatct      5760
     aatttgtgat ttgattacac cattatattt gttataatta aatctttaaa ataagaatga      5820
     ttatattttg ataatatata tatatatata tatacaacaa atgggtccta ctaacttatg      5880
     tctttttcca tccatgctat attcattcaa ccaaacaaga aattggatcg ctatatctat      5940
     ataaaccaaa taaaaaattg gatcgtcgta tccaacaaaa tatggtccca tccatgcatg      6000
     actgtgaacc aaacacaccc taaaatagcc atctcatctg aatagctgaa aatgatttat      6060
     ccaaaatggc aatttagagg atctcaaagc acatgattat ggagcaacca tggcaagacg      6120
     attacaatga tcaagcacgc aatcaagaga ttgcataatg agtggctctt gcagaagccg      6180
     ctgcatgcct tggaggagcc ttcgacgtcg acgcccgccg tcgcgtgcca ccgcttcatg      6240
     aactccttgc ctccgccgcc ccagccggtg atgttctccg ccgtctcgcc gcagatctcg      6300
     cagcgcctgc catttttgtg aattccatgc aaaatattgt aaatatttgc gtaccgctta      6360
     tatatgttga caaatatatg tatttttctg taaaaacgtt atactttaga aacaaatcgt      6420
     gcttagaggt atatatattc aacaatgccg ttaaacaaaa cctcctcctg caaggccctt      6480
     gattctacct aacatgcttt aaaacgaagc ccccaaatat tttttggaga ttgagaaaat      6540
     aaaaaggttt agtaagatcc cacaagaggc cccaaaataa gacccccttc ctcagctgcc      6600
     ctcaaacttg agggctttaa accatagacc ccatccatag ttgtggtgat aggaggacat      6660
     ttccaccggc cgttactctc tccatgtagt catcgttcca ccgttggccc tactctgatt      6720
     gtatccatga tgatcaccac ccttccccgt atctctacaa tgccacctaa gctcaactag      6780
     taccgtttca ccgcctcgac tccacactag gagctcaggt ggagccttgg ctcccaagct      6840
     cgggcactct tattcctttc aagcttcttg gcctctcgag ctctagcagt gaccatgcca      6900
     ccgtccttcc tacctctacc gccctcccta gcgtcctatg atagtcaccc agctacttcc      6960
     cccacctctg aatgtgcctc ctccgtccat tgccccttcc tgcctccacc atcaggactc      7020
     tgaggtccct cgacgacgga tttggttcct gtgcagtctt tagtatgact acaacttagg      7080
     cagtcataca atagccgtag gatgcaaatc caaaggccca aatttgataa gacactgttc      7140
     attcggaaaa tccagcacaa gattattatg gcaagcctac tgtagcattt aatctggact      7200
     ttccattgaa aaattgaatg gacaagatct tgtgcagtcc ctaaagtgca gttacagtta      7260
     ggactgcatc tgatcccaat ccctcgacga ccatacctcc ggccgagagc aaggtatttt      7320
     ttatgactat tggtattttc aacatttaat aatagtattt atcatttcca tttatataaa      7380
     tatgaatttg aattgtggtg tttgaaattg tgaatttgta tatagctgaa ttctatgaat      7440
     taaaatattt gtgtttgaat taccatggta ttgaactacg tataaagcat atgatgaaat      7500
     aaaaaaataa atgtgaattg ttactcgagt tgaagatatt ttttatcctt atgaaatgag      7560
     gcaacactta ttcggaccta agagggttga aacgaaggca ttgtattgtg gatccggatc      7620
     accttagttt agagcctaaa aatataggcg tgcagtacca tgagtcaatc gctatggtag      7680
     taaacaatta tttttgtagt tatttacagt agcaacagta taaaacatga attgtactat      7740
     atcgcattat tgtttattat atattgtagt atactgtagt gatcgatctc gttcgttcgt      7800
     tacaaatcgg atggctggga aaaccctagt catggtactg ttcacctctc actttaaccc      7860
     ctaaagtcag gggggtctca atccattgtt ttgattgtag aagcagaaca gtgctagagg      7920
     aaaaagattg gattgatgct acaagcaagg caaattcaaa gttgctacta gtacaaagaa      7980
     atgaatcacc atcaaagata agttcttgaa cagtgtgagt gatacttagg tccacatggt      8040
     gctgagtgtt tgcaataatt cacatgtgta gttttctatc agtattttaa aagggtagtt      8100
     ttcttttatg ctactccctc tatccacaaa agttacacat attacttttg acaataagac      8160
     caaggagaaa ttaaatcatc ttggatgtta caaaatcaag gagtgaatgc aagcatacaa      8220
     ccaaagagta tttatagatg atttcttggg ttctaataaa atatttaatt tatctcttca      8280
     tttaagtttt gaatgcataa agattacaaa tatgaacaac ttatttgaaa aaactcaaat      8340
     gtgaaatagg tgtaactttt ctggatggaa ggagtagcta ttaataatag ctaatttttg      8400
     gattaatagc accctaactt gtaaattaaa taaaattgct tgttggacca atcaagatgc      8460
     acccaactga tgccaggtca atgctcccag gctcccagtt ggtataggta atatgctagg      8520
     attgcaaggg attattccac catgattgca cggctttatt ctttcttttt cactacagcg      8580
     aagattccgt cccattattg tcataattta tggccatata aataaataaa taacttagat      8640
     attacgtact tcaaactggt ttcgacagaa acatgaacct caccagcaca tgctaattaa      8700
     atcgctttga aataatgagt cctttttcat gaaaaagaaa agacgaactc tacaccccat      8760
     ttacatattt caccaaaatg ttataacata caatatatct acggcccaaa atataacgat      8820
     ttttatcttt tcgaataaat gtagtaatta tctttagaac taatctcaat tggaatttaa      8880
     ttgaattcat ggagaacgaa gattgcattt aaattattgt agggaaacaa agaaagctca      8940
     tcaacaattt tttttcttga aattatcatt aaggaattca tcatccatta actttcttct      9000
     atgtacaaag aaatggatcg aggttgatcg gaattggatg ggagtgagta cctgttgccc      9060
     ctgacggaga accacgcctc ggcgcaacgc cggtgcgccg ccgccagctc gccgcggcag      9120
     ccgcacccga gcctcaccag ccgcccgctc ccgctctccg ccgccatctc gccgtcgccg      9180
     ccgccgccga ggtggcaaat cctgcagccc gtgctcgggc gccggctgcg atcatcatca      9240
     tccgccgccg ccgcacaact ctcgtcgacg tcgaccacca catgcgcgat gacgcccgcg      9300
     tccccctccc ctccggcggc ggcgatcacc gccatggcaa tgtcatgatg gcgatcggca      9360
     cgcggccatg tgggctgggc gcatcgatcg atcaaccacc agggaaggga atctaggtgt      9420
     tggggaatat agtaataata ataatgacaa gaaatcaaga aatgggagaa aatgatgggg      9480
     gacggggaat atcgcctcgg tgctgcgaac tgaaggaaaa ggcgcgggga gggggaggga      9540
     cgaagctata aacaagttga cctacgacat gggatggtag gattggagac gaatcaggcc      9600
     atgtcatgtc gaggaaggtg ggtccaacta gtggtggagc taaaaccttc acgcatagga      9660
     ctgaatcaat gtgagttcaa atattttcac aaattatata ctcccccagt ccctgtttta      9720
     gtattataag ttgttttgcc tttttttcta tagtcaaact aagtttatag aaaaaaaatg      9780
     ataacatttt caatacaaaa caaatatatt attaaaatga gtaaatttca caaaactata      9840
     tgtattttga tctaaccatt agaaagctat ggatttaagg cgttgtatca taaaactata      9900
     gatttaaagt taagtatcac aaaactgcat atttaatatt gaagttatca caatttagag      9960
     tttaaatccc tagcaccatt attatgctag agcaataaac attattgttt tgtaactaaa     10020
     ttggttctaa acctatagtt ctgtaataat gtagtaacta aacatgtagt tttgtaacat     10080
     ttcatcttaa atgtgtagtt ttatgataca tcgagttaaa tatatagttt tgtgatagtt     10140
     tggtcatagt atgtgtagtt ttgtgaaatt tactctaaat tttaatctta caaacctaac     10200
     aagctatggg gcccaagccc taactgtccc atgccttttt tttcatctct ataggtggta     10260
     tgtaattcat cttttaaatg ctcgctctat tcaaaaatag ttctcgtttt agagtttaaa     10320
     gtttgcccca attcaatcca cactacagta ctacttgtta cattaagaaa taatcatctt     10380
     tcatttaaaa agttttccca ttctacaccc aacaattaaa tagcaatata gttttctttc     10440
     tttttaaatc ttattttatg ctaaacaatc tagaaaaatg aaagataagt attgtgcata     10500
     tgggagtaag gggttttaaa acgacactaa ttgcttatgg ttgaccatcg aaagttgtgc     10560
     cattttttta aaaaaaaatc cagcaatgct tgatgtagtc tttcgagaga gagaaaaaaa     10620
     attcaaatat gtccttccgt gtagcacggt acatgtacag tgtacactgt ccacggcttt     10680
     aaggtaaaca gtcaaggatg gaaggaacaa ggttacaagg agagttattc atcagaggca     10740
     tggtggcatt tacatcatgg aatgtgaaca aaacagtggc agtttacagg ttacaactac     10800
     gcctacatta gggaactata ttcttctgtt acaattgggc aaaaaaaatg aaagaaaact     10860
     cagtcatgga tctaaacatt tcggtttcct ccgtcatacc agctgatccc ggtttcacta     10920
     ccaaactcgc gatgcaaaaa cttctcgatt tacaatgttg ttcttcttcg atgattgaat     10980
     tgaacttcca acgaagcatt tgcatatcat catctgagga atcatatttt ctattcttct     11040
     tgttttgcgg ggattcgaag aatcatctga ctcagccttc atgtgaactt caccggttcc     11100
     gcgaaaacga tccaacaaaa ggtctggtgg tgtgcattta gcatttttag ctcccagtat     11160
     tgaagaagtt gtgggtagct tgccgtcgaa catgttctgg tatgagcctg ctgatgagct     11220
     cttgagaaga atttgctagc tgtagagacc aaaaggcagc accaatgagc accaaggaga     11280
     gtacacattt tctcatggat accaagatct gaagttgtgt agcagattat gtttcatctg     11340
     attcacttac ttcgtgtttg aagttgaata gtggtggaaa tggacgtccg tttggcaagc     11400
     gtgcattcgg ctctcgcagc tcatcaaaga aaggatgtgc acatgcatca agctgcataa     11460
     agatattcaa atgaataagc acatcggaaa aaaaatcaat attaagttgt catctggcta     11520
     ttgcaattac actgaataac gactaaacat gagacaacta tcattcatcc accccaacat     11580
     tgatttggta atggaccact aaagatcata accataatgg ccatgcccca ctaaaaccaa     11640
     agttagtgaa gactagcatt cttcaatcta ctttaggaaa aaagaaaaaa gagaaagaaa     11700
     caaggagtgt ttctccactc caccccattt caggagttgc acaaatcaaa gagcacttgg     11760
     agggcaaagt gattaagaaa attccttggt tacgctcaaa tttgtgcaac tcttaaaggg     11820
     tgaaaagtaa cagctcatat gaccagctac agtaggcaaa cttgcataac agcaataaga     11880
     aaaggggcgt tttacagtac ccctgctgtg agcagtagtg aaaaatcact tttctactgt     11940
     tctgctactt aaaattgcag caagaatata ctcacagcag tgcagcggag actcggtgaa     12000
     tattgaagaa ggcgtgaagc gaggtctatt gcttcaggag gcatcctctt gtggaaaacc     12060
     tacgcagaag ttagaaaaat cagtacctgt atgcacctcc ttatttatac attgcattgt     12120
     aaagctatct ggtgtccaga atctattatt ggaaatgagc ccagctacat tttcatagtt     12180
     gtccaggaaa ctataaaaga tgacgtgata tatgactcaa catggataag attgtatgct     12240
     taccttgtgc caagggtgag cttttatctg tggaaaccta aactctgtat agttcgggtt     12300
     catgcaacgt atttcctcac gggttggtgt accaagaacc tgcaagaata tcatacaagg     12360
     ttagagaaga tgcccatact caatagtagg agcaaaatta gaactgcatg gcatgtcttg     12420
     cagtacctta attatctcta caagctgatc gactgcactc tcccctggaa acaatggcta     12480
     gcaaaaacaa atacaagata atcaaaatca cagcaacagt gatgacatca tgcttaaata     12540
     actaaaccaa aagtttgcag atctgtcaac catagaaaaa agaaaccaac ctgaccaagg     12600
     agtagctctg caagaacaca cccagctgac catatatcta ttgatgtagt atattcagtt     12660
     gcaccaaata tgagctccgg tgctcggtag tagcgtgagc atatatatga tatattgggt     12720
     tcacctggga cctgatggaa tagtaaatta atggatatta ggacagtaag atcaaaatta     12780
     tcaaaagtac aattgtagca aacatctgga ataaggtgga aaaaggtgta aaactaagga     12840
     atttccatga aacttccatc aagcataata aaaaggaaga aaaaaagggg taagattcac     12900
     caagtatata agagttcttt gaacgattca gtaacacagg gctagctcca acttaacaaa     12960
     tggtaagatt caaaactgac tagtctacag caagaatcgt ctaaagtcca attaaaaaaa     13020
     agaaagtcta aagtaatgtg tgcgtattac aaaactttag ggtggaaaag gccaatacca     13080
     gtgtttttgc gctcccaaag tcacagagct tgacttgatg agttagagga tccacctgta     13140
     ttgcaagaaa ggagttcaga gccaataatc aaaggccatc gcatagcaaa ataataatct     13200
     gatcatgaat acctaccaaa acattttgtg gcttcacatc cctatgacag acccctggaa     13260
     cagtatgaat gtacgcaagc cccctaaata actgcagcca atgtagaata gacttagaag     13320
     agacacacag gaaggcaggc atttcaaaat ttatgattga ttagcaatcc acacacctga     13380
     tacatgtaaa gcttgacgta gataagtggc atccggtggt tggcattgct gtagtgctta     13440
     agcacacggt agagtgtttc tggaacatat tccatgacaa gattgaggaa cagctcatcc     13500
     ctacttgtgg ttgagaagaa gcaatgcttc agggagatga cattggggtg gtccatggcg     13560
     cgcataagct gaagctcacg gttcttgtac cgtcggtcct gcaatacctt cttaatggca     13620
     acagtctctc ctgtctccaa gcatttagcc tacacatgaa accagcaagc taaacatcag     13680
     accaacaagt cgacagcacg aaaagaaaga aacaaataac aactttctga aagatgaatc     13740
     acctgaaaga cgataccgaa agaaccagtg cccacaacgc gctccgccat gtagctaatt     13800
     gtctgaaaat caagtacaaa attaccatct taagaccaaa atttaattat gagcactagt     13860
     gttcacaaca atgtaatcca acacacccaa ctttttcccc tacaaaccac caaaaatgag     13920
     caccaaacaa gccatattta gttatttaca acagatcttg cagtaataca agaacatgaa     13980
     caactaacac taaataaatt ggctgatatc taccaacagt ttacttcttt tgcaaaatct     14040
     gaccactaat ccacatgcct ctcttagagc caatggcttt cccatcacca aaaatcacta     14100
     cacggagcta agaaactagc tgcagaacac acaagaacac cttcctaaac caagaaccgg     14160
     cagcatttca ctgcaactca agaaatggaa ccaagaccaa aacaacaaag gggggggggg     14220
     gaaggctcgt gtctcaccct cttgggctcg ccgttcttgc ccccgatggt ggtggagatg     14280
     atgtgcccgg tcaccgcgtc attcccctcc gcgtacggcg cctccccctc ctgctgcttc     14340
     tgctccacca agaacagcac actaaatcag cacacagcaa agaaccgcaa aaccacggat     14400
     cagcacgcca agatccggtt agtcacatac cttgtcgcag gcgacggcgg cgggcggctg     14460
     cgcgtcgagc agcatcggct ccggcgccgg cgccggctgg tccatgtggc aaagctggaa     14520
     gctgcaggtg cgtgaatggc actgcacaaa gcttaggtgt gccaccacct ggtcctcctc     14580
     ttcctcctct atggattggt ttggcttata ctgggaggga tgggtgagtg gtgggatgga     14640
     tggctttgac caagaagaag gtgggtgatg ctgctgctgt tactgcagct gctatagttt     14700
     ttagtgagag tggttagctg ctgctgctgc tgcagtgtac acagctggtg gattagtggg     14760
     gaggtggatt agattagagg aggaagacag atggggaggg aggaattgct aggtgcacca     14820
     caagcatgac agcatgagag atgaggctgt gttgtgtgat gtaaccgaaa tggtttcttg     14880
     accgttctta cgtgcagttc ggatcagggt tttgactaag cttatcagcg gcaagccaaa     14940
     caaggaggat tattagtgta ggactaatta aacattagct tttgcagact taaaataatt     15000
     tttttaataa aaagtatttg caaaaaatat cagtttgtag cgtatgaaac atacttaaag     15060
     aaagcgagga agtagctaaa catggttgat ttagggcctc atcatttgcc cctacaaata     15120
     atcaatcgct accaaaatta gattttaaaa tttaattttg ggatttagga tattttcaat     15180
     gtagtttttt taaggattgg atattaagtt gctaataacc atttcggttg cacagtgtgc     15240
     ccattttaga agatggtcca tattgattta aaaacatgtt ctccaaacat tacttctttt     15300
     ctttaggcct tgtttagcac aacctaaatt acagatccag actagttttg gagtttgtaa     15360
     gttaaattat agtggtttat tttttttatt ttctctaaaa taagaacaaa ctgattcaat     15420
     caattattat caatgtaatc acaaattcaa atccaacaat ttatggagct agaaataacc     15480
     tgttctaaac aacatttgat gtgtgccatg gccttatagc gctagacatt tattttatca     15540
     atcttgaaga aattaccggt gcctttttat cccaccaatt gtatgtaagc aaaacctatg     15600
     agcttataac gcccttacat gacttcaaac acgacccaag tatgaactat gttgtacttc     15660
     aataccatat ttcagggaca tatccgatgg aaaccatcaa ataagtgaaa acacgtgaaa     15720
     atcggaacta aaagtttaat aaattcatga aaaattactg gagagaagtg taggcatgaa     15780
     atatattcac caaatatcaa gttaaactca actttatttg ggagtaacaa aaatgccaaa     15840
     tttcggatga aaaataatag aacactattc acctaaaatt tgtcttttat attctctcaa     15900
     ataaaagttg agtttcgact tgagatttga tgtaaatgta tttcatgtct atatttatct     15960
     ctattaattt ttatataaat ttagagaact tttaaatata attttcatga gttttcactt     16020
     atttaacggt tttcacatga tatttcccca tgtttcagcc tccaaagatg acaacatgtg     16080
     tgcgatttac ctgtacacgt agcttggcaa aaggttgtag tacagcctaa ttgtccatgt     16140
     taggtggtgt ttggatcatg gacttaactt tagtctctgt tttaaacact aatttagagt     16200
     attaaatata gactatttac aaaactaatt atataaatga aagctaattt gcgagacaaa     16260
     ttttttaagt ctaattaatc cataattaga gaatgtttac tgtatcatca cataggctaa     16320
     tcatgactta attaggctca atagattcgt ctcgcgaatt agtctaagat tatggatggg     16380
     ttttattaat agtctacgtt taatatttat aattagtgtc caaacattcg atgtgatagg     16440
     gacttaaaag ttttacaaag agggtcttag tactactgct aacgaatgtg atagtgactt     16500
     aaaaatttta taaaagaggg tcttagtact actgctaagt gtagagagag agagaggggg     16560
     tgtggttagt actaatagct ttgggggtgg cgtggcgcag ggccaaattg gttgcaggga     16620
     caggctgtgg gtttgtaggc ggtcaaacga gaattccaaa agcgcccctg aaagccgggc     16680
     aagcgacatg gcggcacttg tttattgctc ctcctcctcc tctagtcctt gatgctgccg     16740
     aaatcagtac ggaaaaaaga gaaaaagaag gggggaaaat ggctgctgtc tctcacatgc     16800
     atcctgcctg cctctgcctg taggctgtag caaagcactg accgttatgt gggccccaca     16860
     tgtcggatgc tttgaccaaa acgcccctca ctgtgtacag aaccagagga gctgattggt     16920
     ggtggtcctg cattgtccag ctagagatga caatgttggt cagtcgtcag atgggatgga     16980
     attcggtcaa tgtgcaaggt tttgggtttt ggagtgaatg ttgggggttg ggccatgatc     17040
     tggccatcca attggttttc ggaaactgcg ggtttggttt tgattcccct acgactggat     17100
     ttatttttta cattttagcc ccttttctaa aaacttgatt ttgtaagtaa gccgaaaaat     17160
     acttactttt caggtttgaa tcctcccttg atccttgttt ggcgccgagg tccaaaacca     17220
     tggtgctgaa gtccatggcg tcgagcctcc tcttacccaa catagcgttc gagccctggc     17280
     tactagtgtg gctaggggtc agtgccgatg gctcgggcgc tgaccttatt tccttcattg     17340
     ctgagccagt gactttgcgc caatgccatt taactcattg gaccgcactg acttcaactg     17400
     tatgatggcg gtgaacacca gaccaacatt agttggcgtc aagcacgtcg agcgtgccat     17460
     ggtcttatgc cgctatggca gcgacatccg catgcacaag cattgtaggg ttggtcgata     17520
     gtgtgggcga tcccacacta cagcattctc aagagtgtgg tgctcggcat catgtacaca     17580
     tactgtactc ctaacttggt tgccacacat gttgtgtgtt ggcgccctag aaaagtagtt     17640
     catcttattt aggccctttg aatcgagggt tgaaaaaaaa tagaggaata ggaaaaaaac     17700
     acaggattct gataagaatg gaagtgtaaa acagataatt gcaaaacaca agaaaaataa     17760
     aaacgcagga atcggatgag agataaactc aaaggaaatt ttccaagaag ttggagctct     17820
     tgctatatat cctctaaaat ccacatgcaa tgtgtcattc cataggaatt tcataggatt     17880
     tggaaagctt tcctttgaat caaagggcca aatagaaaaa tttgctgtag gatttgaatc     17940
     ctatgaaatt cctacataaa tcctttaatt caaaggggcc gttaacttct tttacgtgga     18000
     tcactaacat gtggggaccc atcgcgtctc tgacgttcgt atataaaaac tttggcgtca     18060
     agagctaagg tccatattcc aaattacttt tcgaagaggt atatttgtaa aataatttta     18120
     caaaagggcc acagtgtaaa aaattccagt tcagtacaac tctattggtt gtgatggtag     18180
     ggtagagatg aaatgggcga tgttcagatt gatgttacgg tcatgctaat atggccattc     18240
     tcacatatta agggcccttt taaattgcag aaatgtaaaa atgaaggaat aggaaaaaca     18300
     cataattcta ataggaacat aagtgcaaaa cagaagatta caaaatacat gaaaagcaca     18360
     ggaataacca tttgtttgga ccacaggaaa aacgtaggaa tcggttgaga gagatagact     18420
     caaaggaaaa ttcccaagag gttgaagccc ttgctaaatt ttctctaaaa tatctatgaa     18480
     attgtctatt ccatagaaat ttcaaaggat aacatatgat tcaatccctt gttttaaagg     18540
     ccttcatagg aaattttcct ataggattaa aatcttgcaa aatttctatg ttttttttcc     18600
     aaatcaaagg gccctaatta ctaaaatttc agaattttga catttccaaa ttccaagact     18660
     aaacaatagt caggatccta taggctgtag agctcaaata gagggtagtt cctgcaagtt     18720
     tccttatgtt ttcgtggaaa ttgaaatcat aatatataca ttgcatggca gcgatgtgca     18780
     agatcaaggg ccattttgga ttgaagccaa acagccctca aattgattga actctatcaa     18840
     acttttgttg ttgacagcac attcaaacgg atccaagctt gaaagtataa aaaaaaaatc     18900
     ctttagccct ttggcataca cggatcaaat ttaaaaatat ggattgatgg tattaaccgt     18960
     cgtttcgatt aatgctcgta gtgattttag aggagctggt gaaaaacatg ggtaatttac     19020
     tagggtagga ttcttcctga aacgtctgag aatctcacac ctgggccatg tggccatgcc     19080
     atgtgcttgc tggtcagcga cgagatctgg aatctggata gctttctctg aacaaaatta     19140
     aataaaataa ataaatttct tgtgagaagc aacaggcaac aggaggatgc aacatgcttt     19200
     gctttctgaa agcgagctca aagtgtgttt gcctctggag aatattcaga taatcgtggc     19260
     acttgtgcct ttctatgtgt ttgattacca ggacagccga tatgttactc cagtgcaaac     19320
     aaaaaattta ggtaaaatca tgcaaataac tttagtctga agatttgctg cagtattcca     19380
     gtttttgaag ttcataaatc ttattacgta aagtacttgg ggaggcagat cagtacgaat     19440
     tgagccttag agaaactgaa ttgtttccac taataattcg attcctatga acttcacaaa     19500
     ttccaaacaa tagcatagta cttttgattt ggaagactgc aaataattcc atccaatctg     19560
     gtgaagtcca tcatttctgg acagcaatgc atatgcagct tcatcggcaa cttcagttca     19620
     ggtttgggca atcataattc atacggagta atagttaaca actaaccgat caaccgtcca     19680
     ttgcagtttc tgatgcttgt acgataaatt acaaaaggcc aaaaatatga tgcactatca     19740
     acaaatcttc cttgggtcat caacgacatt aatcatgtgg ccctcccctc tcaatatata     19800
     aaagagagaa cataaacaat gtctcaaatt gcaacccgtc acaatagttt gctgttggaa     19860
     acttgacatg cacctgaaca ttattaccac attgttattt ttttttggga acttttagtc     19920
     acattctaca gaaataataa atttgccgct tctctgaagt atgtgctgga agcttaaaga     19980
     aaacgagaaa ggaaatgcat gaaaatgctc aactggcaaa tgtttgtttt tataagttcc     20040
     agaatcctac tatatacata tacaaaaaga tacatcggcg atgtttatag gccaagctga     20100
     tgagaccaac gtattagcac aagagttaag acaacgaaca tggatctcca aagacaccta     20160
     acataattga caagccaaaa gaaaattcag cagtacattg caattctgcc agctggaaac     20220
     aacactctct gatcattccc acagggcaca accataagta ctaagccaaa ccacctaaca     20280
     tgatcactaa ttgcacatga ctagaggact tcccttcaaa ctgaaactag ctttctggtc     20340
     catcgaacta aattaatgct tgatttctaa atctaactgc ttacgattca cctcgcaaaa     20400
     tcaggaattc actggcagag gaagagaatt aagttatgga gcatactgat ctcataaact     20460
     cagcagtagt tgttagatgt agatgaaaat ttccagaaaa gtcaagcacc aacctggaaa     20520
     ctgagcattc aacttcccct tcaagtggct tctacgcttg gacactaggg ttgcacgtct     20580
     ttggagtaga acgattcttg acaagcggaa ccaacgattg aaccacatca gccattagtg     20640
     gcctgtagtc agcctcttgt tgaacacaca tggcagcaat ggcagccact tggacagcat     20700
     ctttcaatga atattgaccc tccagtgcag gatccaagat ctgcacaacc ttctctcggt     20760
     ctgtgagcat aggcaatgcc tgcatcaatg caactagcca caggtcagat atatgcaatg     20820
     tttaaatatt atttttgaag ataaataatt acatggaacc tttcctacct agtataacaa     20880
     gagaggcaga tggatcctaa ttaagctgta acgtgattca ctagcataag aaaatgacag     20940
     gaataatgaa gcagagtcga ttgaagtgca tggtaaattt tagtgttgaa gtacatgtac     21000
     tgatgtacct tagtacatat tggttcctca cttggaaagc atctcaaact tttgcaactg     21060
     aagtactaag tgttccatta cctcatttat actatgaact aaacagtagt actaatttta     21120
     taattcctga tggttgaaga aaaacagttc aaagtaaaga tacatcggta caactatgtg     21180
     atggtcagct aatgttctta cccagttaac tagaacacct tcgcctggag gcctcttcat     21240
     atcaactggc accctgccag taagcaactc cagaagtaca acaccgtaac tatagacatc     21300
     ggatttggtc gtcaaatgcc cggtcaaagc atatcttcag agtttgtgta gcatgcacca     21360
     cattagagac agtataatca gttcaacaat tcatttatat tatcaaatca aacagtaaaa     21420
     tggaaaaaga attgaatgta tcagtatcaa actcaagttc gttcacaatg ggttcagaat     21480
     ttggtcttac tctggtgcaa cataaccttg tgtgcctaga actcgagttg atacatgacc     21540
     accagctcta tcagatccaa gcttagccaa accaaaatct gacactcttg cacggaagtc     21600
     cttgtccagt agaatgttgc tgctcttgaa gtctctgtgt ataacaggtg gattaacacg     21660
     ctcgtgaaga tattccagac cttttgctgc ttcaagagct attctcattc tagtaggcca     21720
     gtccaatttt gagataccac cacaggaacc tacaatgtca gctttgtggg atatcagttg     21780
     acgagaaaaa tgggcgcgcc tacaaatcgg gtgcccgata tttttgtcaa aaatcgggcg     21840
     ttgtttcacc aagtagatcg aaaatgtttc aatcttttca aaagctgaaa cacaaccaaa     21900
     tcacctcatg aaacattttg ctacaacgta tgaaacaaac agtttccaga aaatcaggcg     21960
     ttgtttcacc ctatataaaa acaatgtttc agcaaatatg aaagaatgtt tcaattctta     22020
     aaaaaaagtg aaacacgatc agatcgctag atgaaacaat ttggttcaac gtatgcaaca     22080
     aacgatttaa agccattgca acacttaaaa ctcgtgtaca tcaacaaacc acgtgtccat     22140
     caagttgaaa atattaaaca gtatcaaaaa ttcactgcaa catgtgatcc atacatagga     22200
     aaacatcacg agtatactag ctgaaacatt gttggtggaa caaaaaatga aacggatccc     22260
     ccttaatagg gtgtttccat tatatccggg cggctgttgc aatgggcgcg cgtggtgggg     22320
     gcgcatggtg agggcgcgcg aggcgtgggc ggcgcggggc gcctgatttt ttttctcccc     22380
     atcgggcgcc cgacggggag gatttccgaa gaaaatttgg ctgaatgaat accatcacta     22440
     aaaaagatat gctacggtaa atgacaagga aacattttca gaaacttcat attttcatat     22500
     caaccaaaag aattgaaatg tggtaatctg taatttcaca gtatgccaac tacctgccca     22560
     ctttaaggac ttaaagcagt atcaatgtat accaataaag aaagaacaca atgcatatgt     22620
     aatgactgca attttgtagt gaattcactt cacttgtttt ccaaaccata acttttagaa     22680
     ctatctcggc aggccatata tacaagactc aacagattaa taactcaatt gtaaggatga     22740
     aaaataatgg tggtgctctc tcaacaaagg ccagatgacc gattttacaa tattacaagg     22800
     cttgattttt ttttgtggaa aaaacaccag atttttaaga ttgaagacac cttgttcacc     22860
     ataggactag ctaagagttc ttatctggaa gagagaaggc ctaaaacggt cagtttccac     22920
     tttcttgtac agtattaaac agactaaaat cagtaaattc acactgataa gaggttagca     22980
     tgctttcctt agcaattaaa ccaagcaaat agtgtagaca gtatatttaa atactataga     23040
     tctaggccac taaattgcta aagctttaca tgaatacata aaccatttct tgatgaactg     23100
     gaaattctgt ttgattcttt tgacattgtg actttgagat aggtgatttg ataggttcac     23160
     caattaggta agttctcttc tctaactgtc attccgaagg gatagtcaat cttcaagagc     23220
     atatgtaaac atcaaacaac gtatcctata tcagcattac agagaatgta attattttca     23280
     ttgctatatc atgtatccag accaagcagt cccaatggac tcatagaatg gcagaggcaa     23340
     atagagctct tgcacatttt cgttaatcca tgaacagaat ctagggaaaa attcataatg     23400
     aattagcata cgaccaatgg tgtctagtaa taaaaaccaa ggtacagtac atgaaatatt     23460
     caactcccaa ttcgtttgtc ttctgatatg taatactaag catcaaattt agaattttta     23520
     ttcctgtatt atttgaatct cactttccct ccttttagtc agatataagt ttgtttcctc     23580
     agcaagacaa ctgttacaac tgctccattt cttcccctca aagtatcagg acataataag     23640
     gttatcaacc aaatacttca tgtgcgctaa aagcaattaa ttcagctagg tccctagttc     23700
     tagctgtggc atcactagtg ttttgcagtt ttgccatcca aagacaatag tcaactaagt     23760
     tcagggatag cttcccagtc aatttgctct catagtttgg tgttcaaatg ttgcaacact     23820
     taactaacaa catcaaacct gcctaaaaat cattgtaaaa tatcaaattc aactatagtt     23880
     gtaattggat gctaaaaggt gtgcatacct ccatttgggt agagatgctc ctggagaccc     23940
     ccattggcca tgaattcata gaccagcagc cggtgtccac cctctgaaca atggccaatc     24000
     aagcccaaaa gataaggtga tcgaagccga ctcagcagct ccacctgcca aaagatcacc     24060
     aatgccccat attaaccgct caaacttgat tagaacagct tagaattcca gcagtagcaa     24120
     catcataacc cagatttacg gtaattagag ctccatgtgt gtgtttagag ccaactacag     24180
     gccaaaccaa gcaaccgaac actccatttt tggaaacatc tttgacaaga tgccaaacca     24240
     aaactaaccc caatagacga cagtgacccc atttcgctcg gaaactccgc agtgtctcat     24300
     tgtctccatt ggaccgcaaa atttcatcaa catatataac tcgcaatggg tggtaaattc     24360
     gaatttaccg cccgttgcat gttattctgt cccaggcccc aatctcagac ggaaacccgc     24420
     atttcaattg ctggtaatta ctcgaaacgc agattatttt ttttacctcc atctcgaact     24480
     cctcttcccc ctgcttgccg gggcgatcca tgagcttgac cgcgaccttc ctcccatcgg     24540
     ggagcacccc gcggtagacg gccccgaagc tcccctgccc caccacgtgc gcccgcccga     24600
     acccgcccgt ggcggcgtgc agctggcggt agctgaacac ctggacggcc cccctctccc     24660
     cgccgaccac gaccgccgcc gccgcgccgt cgctggcgga gttgctagac gggctctcct     24720
     tcccgagcgt cggggcattc gcggaaggag gagggggagg cagcggcggg ggcatgggag     24780
     gaggcgagga ggaggaggag cggcggtggt gcttggggag gtcgagcgag tggaggcggc     24840
     gggagacctt gcgggtgatg tagcagtagt aggcgaaggc ggcgacgagg gagaggaggg     24900
     agagcgccgc gagggagacg atgaccatga gtgccaccga ctcctcccgc ttgtagtcgt     24960
     cgccgccgcc gccgccgctc gacattggaa ccctaggtct cggaggtgga ggaggaggaa     25020
     tggaggaggg aatagcgatc gcgagaagac gacgagggtt ttgaggggtt tgggggcgga     25080
     ggtgggggcg gaagcggaag ctcttcttta tgcgcggaaa ccgaggttgg agacagggag     25140
     gagtgggggt gggcccgcag tgtcagtgaa tgcgacagtg gcgacgcttt ctcacaagtc     25200
     aacagtttcg ttttgtcaat agcacagtac tcgtagtact cccctatcgt aaaatacctc     25260
     ctccgtttta ctacctccgt actagtttag ttgttgcttg gacttttttt taatgtttga     25320
     cccattcgtt ttatttgaaa aattagtata aatatacaaa atgataagtt atacttaaag     25380
     tactattaat aacaaagcaa atcacaaaca aaataaataa taatttcata attttttgaa     25440
     taaggcgaat gatcaaaaat tacaaacaaa aactcaaagc gacaagtatt ttcgaacgga     25500
     ggtagtacaa gtctaggctc ctaattaatt acctccacaa gtttaggcct gcatagcacc     25560
     ttcgattaag gtgcttgtgg tcgtctcttc gtcttcgctt cacgttctcc atgcatgatg     25620
     agtgtttgtg aaaatggtaa atgtatttgg gccccggcaa cgtatccatg gtcttatcgg     25680
     ttggtgacct agccttcata tagcctctgc atgccctcgt cgcttcgtgc tcatcggtct     25740
     ttgaacgatg tggtggtgtg gatggatagg ttttcagcat gcatgaatct catgtagctt     25800
     agacgtcaca acagtggcgt gggaatggtg ttgatgggaa gaggagttgg tggagtcagt     25860
     tagtgtatct cctagctaga tgagattaaa agaatgaaga gttgatgaat acaactgctg     25920
     tagatggaaa ccagattaga cgtggccagc tgccttttgg cttgtcaagt cctatgtaca     25980
     acaaggactt gtaacgagat gttgatgcag acaacaacta gacgaatgtg gcttggtacc     26040
     tacttcagat ggtggatcta ctactaattc aattgattat tgatatgacg atgagcccaa     26100
     aaaggggctc tatgagagcg tcgataacaa caacaacctt ggaagaagta tatgcctcgt     26160
     cgacagaacg gtcaatagca tcattggtgt agcacaagca tgaacgactc cttggcatca     26220
     cagatgacat cgttcttgct tcatgttgat gtagatgagt gacgctccaa tacatagacg     26280
     agtggcatcc catcatattg gtatggcgaa aaggagacgt cacggagatc agcatgtgta     26340
     gtagtagtga ataatagcag cagggaacca tttatacatt cttgaattgt tttgggagga     26400
     ggacagataa atatcactga gggttgatgg ataggattga acccttctag tgtaaggaag     26460
     agggagggtg aatcctatcc ccatcatcat ggctttggac agatgtccgc ttcagactga     26520
     aggaagctgc actatttaac tcgtacgcga ccccacagct catgccccat cagtagtact     26580
     tttccctgct ctggctgtgg cgagaggtct gtgagagact tgagagttta gagctagtag     26640
     aagccttcca ggtaatacac tgaaccttgg gtgtgtttag ttcctgaaaa aagttggaag     26700
     tttggggaaa gttgggagtt tggaaaaaaa aattgaaagt ttatgtgtgt aggaaagttt     26760
     ttgatgtaat atgatgtgat agaaagttag aagtttgggg tagttgaggg tgaactaaac     26820
     acagcccttg tccattggtt tttatgagta catggctaga ataaacacct gatgtctagc     26880
     tacaagtaga tggattagtg tagaaaatat acatattagt gaaaagacta atactctggc     26940
     tggctagcag cagctacatg catgcatcga attttaatgg ctagcagcag ctacatgcgt     27000
     actccctccg tccaaaaaaa gacaaaccct ggtttccgtg accaatgttt gaccgtccgt     27060
     cttatttcaa aaaattataa aaaaaattaa aaagataagt cacacataaa atattaatca     27120
     tgttttatca tctaacaaca ataaaaatac taattataaa aaaatttcat ataagacgga     27180
     cagtcaaacg ttggcacggg aacccacagt ttgccttttt ttgacggagg gagtacatgc     27240
     aagcacctac tagcactagt tggttccctc ctttagcata gtcacatcag ctagctatat     27300
     tctagtaggc tgttagtagc tatcttgcat tcaaatttat atattgatta atatcaaaga     27360
     tttgcatatt tgacttggtg agacgcacgg ataggacggc aggaaactag gtaaggctgc     27420
     accatcaact attttactta atcatctcta actgaatttg tttacctgta ttatattgag     27480
     atgatgatac taacaatcta acaataaaca atattaacac ccgaataatg gattgatgat     27540
     tttatcagcg agaataataa cgtgattagg atacctagca tgagacggcc gatacctaaa     27600
     ataacgatat caggtgctga tatcagtgtg agatgaggaa cgcctcacac aagtaggaat     27660
     tcgacggtgt gattctcata tgagggtatc cctaattggg gacgaaaatg gattgaagga     27720
     atgaaattat gacgattact ttaatacctc tgcagtgtat ttttttaact catttactat     27780
     gttacatcct ttattattta tcggctgtta atatctatgg gtagtagtat tttctgtctt     27840
     taaaaacatc tctatagcta tatgtactaa tcttgctgag tatgtataat atactcatat     27900
     attattacca tttgatgtgc gcagaaacta gtcaagatga gatgtctgag gaaaataatg     27960
     acatgcaaac ctagtggggg tgcggtctac ttagtcctta gaagcataca agaggacata     28020
     ccatatgcta ggtatagggt atcgtcctgg tgacaataag ttggtcagtg aaccaaccga     28080
     tgtaatatgc aatgtagttg gtgaaaaata aatggaacca ctgctgtagg tgtccaagct     28140
     ccagctgtta tggttagaca ttacatcttg ccttgtatct ttatgaacat atatatataa     28200
     atagttagcg tatatgctta taaggatacg gcggactgtc atgaaaaaaa aatatttggg     28260
     ttgtgatagc atgaagactc cgcgcgtgac ggagaggaga cgtcatggat gagagacatc     28320
     acaaacagat ggcatctcat cttggcgtga caaggggggt accacggacg gacagcatga     28380
     cgactccaac acgagaggag aaagcatcat ggatggacaa ccgatgactc tggtgtgata     28440
     aagagaaaat cttatggacg gtcttgacga cagcatgcgg gcacctagca atgacacccc     28500
     gatgttctcc tcgaacagct tgacgatgag cgtgaggaag acggcattgt tgacgagggt     28560
     gaatagacgt cggtggcatt gtgaggcata ggctgcaacc agtaaagtaa ggacgcctag     28620
     catcttgatg acatagcagc gccaggatgc gtcaccgcga ccggagattc tagctagatg     28680
     gagtagtgca aactatggcg ggatgaagag agagcgatgc caacagatga gccagcttga     28740
     tgattccggc gatggcgacg cgcccgcgta ctggccttcc aacgtacatg cactgagaca     28800
     gactagttac ccatagcagt gaaccaaagt ggcgtcatat tgtttctccc ggtcgatcat     28860
     ctcctcctca acgtgtgcct tctcatggga tgccgaggta ctgcaactga ggtcgccggc     28920
     caccgagcac aggcatcctc acacgaatgc cgaagcgcta cgtcgaggca tctacttctt     28980
     ccaaggttgt cgttaccggc gccctcgtag agcccctttt ttgggttcat cgtcatatcg     29040
     atcggatcaa tagtagaccc accattcgaa agaggtgcca agccgcattc gtctagttgt     29100
     tttttgcatc tacttcttca ttaacatcgc tttacaaatc cctactgtac ccaggacttg     29160
     acaagccagg aggcgcccaa ccatgtttaa tccggctgcc atctacacca gctatcttca     29220
     acaacttttc gttcttttaa tctcagctag ccaagaggtg cccaaccatg cttattcggt     29280
     tgttgtgtac accaagtgac ttcaccaact catcttccct tcaacacctt ccgacgccat     29340
     tgcggtgaca tctaagttgt ctaagctaca cgagatccat gcatgatgaa aagcaactca     29400
     tctacaccac cacatcgttc aagactaata acgcagagcg acgagggtgg gtggagccta     29460
     tatgaaggct acatcaccaa caccagcgca cggaccgatg aggccatgga tacgttgcca     29520
     acacccacat atacatctac cattttcacc aacactcatc atgaatggag aatgtgaagc     29580
     gaagacgaag agacaaccac aagcagttta atcgaaggcg ctctgcaggc ctagacttgc     29640
     ggaggtaatt aactaggcat ctttcgagac cttaggaacc agaggaccac ttcttcaagt     29700
     tcagatatgt tcaacgacag gcaatggagc gcacatatat atatatatat atatatatta     29760
     agttgggaat ttgtatttat gatcttgaga ttataaagca tatgtttcct attttgttca     29820
     ttttgtgtac ttagttacac tggcatgccc gcatatatcg atctctaaac atagagaaac     29880
     acgtttattt ttttttgtca taaacagttt gacatgtggg ccctctggcc gtatatgtcc     29940
     tttctcattt taaaattgta gggtgttggt ggtgtggtgg tgatagattt gccactcatc     30000
     accattacta ctacaccttt ttaaaggagt atagaagttc aatattttaa agtaagagat     30060
     tttgactttt ttctaggcaa ctttgttaag tttgatcaaa tttatagaaa aattagcaac     30120
     atctatgaca ctaaattagt tttattaaat ataacattta atctatttta ataataatac     30180
     atttattttg tattgaaaat actattatgt ttctataaat tcgatcaaac ttaaaaaaat     30240
     ttagctagaa aaaagtcaaa atgacttatt ataatatgaa gtagggagag tagcaagtaa     30300
     ttagtgtaag taaatagtgt aagaaagttt tttcagaaca attttaaggg gcatttataa     30360
     atttaccact agttttttat atctagtaag aatgtcattc aaacgacatt tcagtggtaa     30420
     ctttgcaata ttctaatggc ggctttgcaa taaagatttt aaactgcagt aacaaattta     30480
     taagagtaaa ttacattggt gttacacaaa cttgttaggt gggtgcaatt tagtatatga     30540
     acttgtaaaa tgctcgtttt gatacacgaa cttatctgat ccgtgcgaac taggtccaaa     30600
     atggcttgac aaggttaatt tcacctagct gatgttgatt aggatatggc gtgcagacgt     30660
     atagtgagtt tgcataaaac attttatatt tataaatttg ttctctactt tatcatgaat     30720
     tttatatgtt tctaacccat gtatcattgc ttggtatttt atatttttct ctacaatcac     30780
     tatatctcat tctatctttt tattgaacaa gtatatatct aacagtatag tagcaacctt     30840
     ctcatatata tgtttacgta gtatcctaat cagcacctaa atcaacaaaa ttagtcatgt     30900
     aatatccttt tgaccttagt tcgcacatgc aagataagtt catgtaccaa aatgagcatt     30960
     ttacaagttc atacactaga ttgcacccac ctaacaagtt cgtgtaccgc cgatacaatt     31020
     tactcaattt tataattacc cctattttta aattgggccg agtttagttt caaacttttt     31080
     ctttaaactt tcaatttttc catcacatca aaactttcct acacacataa actttcaact     31140
     tttctatcac aacgttccaa tttaaacttc taattttggt gtaacacacc cttggtgaaa     31200
     taaataaacc tacgacaata ataatcgagt agccgaaaaa attatgacag aaatcgtgaa     31260
     gggcggtggg tcgcggcagt aattgcgcgg ggacgcctta atattttttt ttttaaaaag     31320
     gggaagggaa gaattgagta gatcgactca ctcggaattc tctctccccc cgaccgcgac     31380
     tccacgactc ctccccgtgc cttctcggaa gccgccgccc ctcccgcccg cccgctccgg     31440
     ctccggcgcc gccgaaccgc cggaggcggg gagccggcgg ccgtctcctc cgccctccct     31500
     ccctccctcc catcgccgcc cgccgccgcg agatccgctt cgcccctctc cacgtcgcgt     31560
     ggtaagccct aattcccgcc gcaaccctac ctccttatct tcccaattcc gctgctccgg     31620
     cgaggccagc cacccctccg tcctaacgac ggccgctcgc ctcgcctcgc ctcgccgccg     31680
     tgtggcgctc aaccccccgc ggacacccct ccagcgtaat tggcagcttc tgagtgactc     31740
     agttgcgttt cgccctagtc gatctccccg gtcccctcgg cctcggctcc cgagtcccct     31800
     cgcgagtccg gctgcttgct ccgccgcatg ctcgccgacg agcacccgta cgcactctac     31860
     ggtgctcgaa tttgtgttaa cattagcttc tctgatgtat gtggaagctt tactgtttgc     31920
     cttaacctca agtactaata acagtttgtt tgttacccaa aaatattggg gttcaactga     31980
     accttgatgc cccatgttag gtccgtccct gtaaattctg tatctcagtt tgaattgtcg     32040
     ccaaattgtg tttttttctt ttgttcagct agcatctctc gatagaccaa atcatagaaa     32100
     cggaatcact gccagttttg attctagtcg aattagcact gaattggaac tagaaatttc     32160
     aaattccaga taccttttca tacccagaac ataccctaag gacaatttca gctaaagttt     32220
     tgtctgaaat gcctttagcc actaaatacc agtattgcat gggggtggtt agcgacgtct     32280
     tcaacgaaaa ttttgtttac tggtaattgc tcttctggaa gtatgtgcaa tctgcgcatt     32340
     tattgattga ccaattcccc ttttattaaa tgatttcgta ttgcagttga atgttaatat     32400
     gtgtgtggct catagcaact gtactgaaga gagagtatgc aaagttcctt atcaacatga     32460
     tagttttggt gacttcttca acaacaattt gaatacatga tttgttaact ttttatgtaa     32520
     aaagtaaatt gtccagagaa acaacactac tatactataa cttttgcttc aacattgtac     32580
     tagacattga aatgtacaac tctggtgctg gatattttgt gctctttaac attcatcaca     32640
     ctgtgtatac tactctttat acttgtcctg tgcaattgtg catcctaacc caaagtaaaa     32700
     aaaaaattaa taataataat aataaaccat gatagttgtg atattcagca ccattgctcc     32760
     acggaccaat accgacgcca gggtcctcct cttctattcc tctgtatcac tactttctcc     32820
     tctccacctt ttccccaaag atggcagggc tctcaaaagt caaaagtgag gcatgccatc     32880
     tctctcagcg gtgggcgcta gatacagatc taagggaaca agagggagga ctgtgagtta     32940
     gaagccacac cacgggctat tcttaacaca gtcagtagaa aagtagccat ctcggttttt     33000
     ttctctcttg tgaacaggag caaacaatta aaatgtgggt tttctaacct ttcacatact     33060
     tgtaggaggg tttatatata tatatatata taagttacag tgaagaaaat caaactgtga     33120
     atcatctgta atttttttta attattcttt gcaggtttcc aatttttata tatttattgc     33180
     taagaaattg tgatgtttac agaaactgaa tccctctcag ccctcactat tctctaccct     33240
     tttacataac atgtcattct gtgtgttagt ttgtgacatc attgaggttt actggtttaa     33300
     tgatttacaa ttgtttttgt gctataacca tatcgttttt tagtaatacc ctccttgtta     33360
     atgcgcattt tacttctcgg acctcttctc ctaatgtatt tgatttagca gtcaatgaga     33420
     taatataagc tcagctggtg gcgatcatct agcacataat ttctcatatt cttttcactg     33480
     tgtcgtatgc tgtcaggtta cagatgaatc agcctgaggt taacggtttg ttatgtgttg     33540
     gattgcatca aacagatggg ggtgacgaat tgtatgcaac tgaatgtcta aaaatgaacc     33600
     agggttcttc acatgaaaca aacaagttgg atgcagtaat gtcagcttca acaatgcaca     33660
     gtgatcataa caatgctaat gcatgcgtag atgattacca acatacaaag atgatggcag     33720
     gaattcaacc tatggaggaa gttggttttg gctgtacgca accctttgag ctgcaatcac     33780
     aagtatgcat ttttaatgct aatgtattta tacaactagt tattcctttt tctactactg     33840
     caatattgtt attatttatc aggggatagt acctgattct gaggaagaaa gcttgccatc     33900
     tagccctgaa acttcttcaa catccaatta tgatatgcct ggtgatatgg ccaacccttc     33960
     ttcttttttt tgctttgtac tgtgtgcatc ctggtaataa ttgttgtgta atttcagatt     34020
     tagctgagca aaacttggag catatttaca atgttttggg tgaaatggta tgtatcgata     34080
     atgtatttaa ttttaaatgt atggttatag ttgatattga ttaattcagt tttagttctt     34140
     cagtaagatt gaagcaattg cataattgtt agcacttaag ctgcgaaata tgtttacaac     34200
     aatttaccag gaaaaaccaa tttgctgtag cactaatgtt ttatagttcc atttactgct     34260
     tcctcacatt ggcatggttc aagtattgat gttttgctta caaacaagct agttacttta     34320
     acttagattg aactacctga attgttggaa ttgggcggaa tgctatatct tgctgtctca     34380
     tttatggtca tatgcaccga gttatatatt gtgataattt tcttagacga catgttcagg     34440
     ctacacttgt atcatcttgt ttttttatta ctagcatatt gtccgtgcgt tgcaacgaaa     34500
     ttttaattaa agaaaattta tcattaaccc attattacca ttattttctg catatattat     34560
     ctcttagttt ctgcatatat tttttagtga catgtggaac ctttggtccc acactatcgt     34620
     tttctcttcc aaaaaagatg ggagttggtg atggggtggt ggtagattca ccactcacta     34680
     ccaccagtac tcccttttaa aagagtatag attatatcct atgcattgtc cacaccatag     34740
     caagataata gaatgccctc tctttccttg aagaatactc caaactttta agttcttcag     34800
     atgcttcttt ctttttagag taaatttcat aaaactacat gttttgttgt ctacattgca     34860
     gaaaaccaca tatactttga cacttggcat ttaagtacat atattttggt cgtgtagttt     34920
     cacaaaacca cactatcgat gaatggattc actcgcgaga tgatgtggtt gtttcacata     34980
     ggacaaggac atggcatcct attaccagcc atcacacaaa attaacagga tgccacgtcc     35040
     ccatcctaga tggaacaacc acgtcatctc acgggtgaat ccattcatcg atagtgtggt     35100
     tttgtgaaac taaactacca aaatatatgt acttaagtgc caagtgtcaa aatgtgtgtg     35160
     gttttctgca acttgaaccg taaaacatgt agttttgtga aatttactct tctttttaat     35220
     attacctttt gatctttgtc gcatattatt ttttgataat atgatggact gaaaatgttg     35280
     gtcagagtcc tgacttttaa gaacttcatt gcccctaaca ttcttcaatt acaggttgat     35340
     aaggaagggc cagttgtact tagtccagag tatgtgatgt gcggcacaac ttcgcatgtg     35400
     gaacctcgct taactttctc agcagacgga ttcaagatcg aatactggga ttcttgtgaa     35460
     aatgatgaga tggcagctca atattggaaa atttctgata ttacctgcat tgattgtaaa     35520
     tgggcacaga gtgtaagcag tttgtttatt tagttattat tgcctcccgt tattttatat     35580
     agcttaatac tggtttattt ctaatcaggt tggatctgtc ttaataactc tccatgttgg     35640
     atccggcaca gaaactggaa attctagtat gcaatttttt tattgtgctt gtggtcaaga     35700
     tattatattt cagatttgat attcttttcc ttatgctccg aagctaatga aatttactgg     35760
     ttcatatgtg acagcgatgc atgttaggca tgaaatagca ctgactctgt tggtttattg     35820
     gttgccgatt tagacctctg attttgtttt tcagtttttt ctgaaaatac aagcattacc     35880
     aaagtactta agtattttgt ttgtttggtt gattttgctt taatgcagtt ttaatgactt     35940
     acaagacggc aagactagag ctaaatgtaa aatttcttct ctattttgta gaaaatgtag     36000
     gttcctggac ttatattcac tagaaagtgg aaacacaata ccatcattga gaaatagtac     36060
     aatagttata attttaatgc ataacaattt ccatttgttt ggtgaggttt tatttttttc     36120
     tttgcacagc cctattatta actagcctga catgactaag aacagtatgt ttggtgtttt     36180
     ctcttaatat ctttctaagc aagaataatt ttatgaagtc ttgcttattt tatgttgtga     36240
     gattttgttt cagcttacca tcttgtttcg gttgcatgta gtaaactaga ctctaattta     36300
     gcaccgttta gaaactatcc actttgctaa cagatgcatg caagaataca taggtaacat     36360
     ggatgataat ttttgaactt cggatttaga tattccttca tgtttgttac agactaattt     36420
     tcttgtcttg ttatcctgta ggtcatgata gaatacagtt ttgtcttatt gattcacagt     36480
     ggccaaggaa acagcaaaac atttggcatc ttgcatcaag ataccaagaa atatggaaca     36540
     atattccatc gtaagctttc tactgatggt ttggtttgtg tgtgcatggg ttgttcatat     36600
     gcattttcat caattcatga ttttcactac aacatagagc tgctaataac ctcataacga     36660
     tgcatcatta agttggacac attcattttt gatattttcc gtgctattca tgattgcaag     36720
     gataatactg actatcaggg gtgttaactc tgaacttctt agctcagaac aaatactggt     36780
     cataccaagt gcctgcccgt attttagcct gtgtttgcca ggttgctagg ttctacttgg     36840
     gttccagatt cgttgttcta ggataggtca catcctatcc taggttgaat tatttcggga     36900
     tggagggatt agaattgatg aaataataat ttaagttgtt tataattttg tggtaagagt     36960
     tctgttataa acgacttttc agattaggta tgccacaaac tctgagatgc tatgcaatat     37020
     gtattttggt atatattatt tcattagttc tgggttgggg tatggatatc aagtcttaaa     37080
     tatgagcata tattatgaca gataatatta ttttgcattt tgagggaaca tttacatcta     37140
     attcacttta tgctgaccgt tgcagttgaa taattgtggt gtacctatat ccattacatt     37200
     cttattgtga agtttgctct gtattgttaa agtaattccg attttcagtt gtgttatttt     37260
     tatcattgct ataacaaaaa gcttatgtaa cttcatgtat tttcaggggt gattttgcat     37320
     cagagaattg gaacattgaa cccagtttgt ttttccctaa gcaatacttt tctgagtgag     37380
     tattttacac acgtttatcc tcggtctgtt ttctgttgtt tacagttgaa caatcttaat     37440
     atcaatgcta caggttcatc ttcagtgctc atatgaaagc gtttttgttg ataaattccc     37500
     agcacacttc attctttttt ctatcatgag ttcctgatga taaaaatgca cacttctcat     37560
     atcaaacatt tttttgtagt acctgaaatt gattttacta tctgtggttc tatttcctgt     37620
     agaacagagg tgtctgcatt ttttctcatt tgaggaaaag cgcattttct gcctctggta     37680
     ttattagtcc taaagtctgt aaactctgag gctcactatt tgttttcact gcatcagcac     37740
     tgaagaattt gaagatgtta tctatcccaa aggagatcat gatgctgttt ccattagcaa     37800
     aagagatgtt gagctgctgc tacctgaaac atttgtcaac gatacaataa ttgactttta     37860
     tgtcaagtag gttgattttt tttatgctat ctgatatatt agttcgattt gaaattctat     37920
     caataggaat gcaaccacag ttcttgatct ttgattttta gatttgctgc agaattgttc     37980
     tcttgtcata aattacattt aatatttaaa tcctcactcg caggcacttg agcacaagaa     38040
     ttgaacccgc tgagaagcac aggtatcact tctttaatag cttctttttt cgcaagctgg     38100
     ctgatcttga caaagatcaa gggagagctc cagaaggtag agcagctttc ctacgtgtac     38160
     gcaagtggac tcgtaaaata aacatattca cgaaggagtt tctgtttatt ccagtaaact     38220
     tcaagtaaga cacaagacga tgaaaattct gttgatgcag tgataacctt agtgcactac     38280
     taataatgtt tctgcattgc agcttgcatt ggagcttaat tgtcatttgt tatcctggag     38340
     aagtggagac atttaaaggc atgaacatga attgaaactg aaatagtact tttgacacct     38400
     ttgagtaagt tattttaatt tcctatttct ttgcttcaga tggtgacaca aatatctctg     38460
     caaagattcc atgtatacta cacatggatt ctctcaaggg aagtcatagt ggactgaagg     38520
     atatcatcca aaggtatgct caattcacgt agtggtttaa ttttctcttg agggttgggg     38580
     cagagtaaat atgctgatat tttccttgca tcaatgtttg aaaaaatcac actgttccga     38640
     gaatcagcta gatttctttc tttcttgtag tttcatacta gaaagctgtc ccttttgtta     38700
     gtagttctgt atgaagttgt ggcaggctac tgacatatac tcagaacttt tttgctgaat     38760
     actgtggttg gaaacttgga attgaccctg ttcacacaaa tattagcgac tgttattaca     38820
     ctcattcttt attttcacaa ctggttttct gaattactag acaatcagca cagctggaaa     38880
     tccctggaac cacctaaggg cttaggtgaa gttctgcacc agtgctgaat ggcactggta     38940
     cgttgccatt aggttttgag gagtattggc taattatctc ttactactta aaagtggagt     39000
     cgttcatccg cccctttcct catgtcccgt gctttgcgaa ccaccacctc cgagaaaacc     39060
     agaaaaacca aaccggtggt taaaaaagcc agctagatgg atccacaccc caagcacaac     39120
     ccaggcctgt gggcccatgc agcctatttc catctatggc tctgttgcaa atgcacgggc     39180
     atattacata gtatagtgaa aataagtaat tttattattt ggcacatctt ttggcacaca     39240
     tttgacagat gtggggctta gccctacaca actcaacaaa gatcctcccc tttagtgcag     39300
     ccaccaacta cacatattgt gtgtctcaac ttttcctcga tccatgctgc aactagctac     39360
     caccagttac cttagatgag ctttttactc ttaatctagg ccgtggccaa ctccccatgc     39420
     cacctgtgat tttgtttgat tcatctctct ttttagctcc aatgatgctt aaattcaagt     39480
     tcttcatagc actctcgagt tctagaaagc attatctgca tcaagcttgg actcagcatg     39540
     tttaacctta atgtgggagg gatattgttc agtcattcat catgaacgaa agcttgagga     39600
     atgaggagca acacatacat actttaatta tcatttaaat atatatagcc ttgcgatgca     39660
     ccaaaatagt tgaagagaaa aaagaaagag aagaccaagg taaatgagtt gcttgtggcc     39720
     ttgggcctgt tctagccaaa caatactccc ttcatcccat aatatagcaa cctaggaccg     39780
     gatgctgtct agattgtact ccctccatct acttttgata gtcatatttc caaatctgaa     39840
     aattttattt ttgataggca tatttcaatc caacaaccta tcatcttaat gattttctcg     39900
     aatttaatgc gtgactctcc attcttccac acatgattgg ctatatgggc attgagaaat     39960
     gtaaatatta atgaatctct tgtttacgag gaatgactag tagcatgttt aaatggatga     40020
     taagtaaaat tacttatcct tggtctgtgt gtcaagatga aatatgacta ttaaaagtag     40080
     atggagggag tactatgaaa tgtctcatct gatcctaggt tgctatatta ttggatggag     40140
     ggagtagtag atactccctc tattctataa tgtaaggcat ggtcaaactt ggcacggtct     40200
     tcaaaactaa tctttgactt ataatttctc atacactata aagttggtag caacaaaatt     40260
     ataaccatat atgaaagtat attgaaatac caatccaatg acaatatttt cagcaaatga     40320
     aattcaattt atattatact aatcattagt caaatgtttt taaagttgaa tgttgaaatg     40380
     cgtgcgcgcc ttacattatg gaatggaggg agtagtaagc aagcgactag caatgtttag     40440
     taccaccttc ctagtatgag tggagcttgc ctagtttata acgatgggaa cccgagctca     40500
     agtaacactt gtttgaacct tttgcatgaa gcgaggacaa aatagcaaca gtgcacagag     40560
     tagtgtggtt aaacaaattg agttcgccct agaatcgttt tcgggccctg ggtgttacaa     40620
     tcggtatcct tgcaacatag ggatctactg tagacactcc atgttggtca tatataactt     40680
     gaaatgataa tggttgatgg tttgtattga agaccatgtc catgcccatg ttataaatga     40740
     tgcatatttt ggattagagg tagtaactga aaatgttcag tcttcctgta ttagtcatgt     40800
     taggtgattc agaatcactc ctttgtggtc aatatctggt gcaaagaatc atttatgatg     40860
     ttcgattctt tattgtgcag ttatttatgg gaagaatgga aggaaaggca tcctgaatca     40920
     gcatcagatt gttcggacaa gttcttaaac ttgaggttta tctccctcga ggtttgtgca     40980
     tgctgtctta tattttatgg taccagcttc atatgcattg aattagtctg aaacataata     41040
     cagaaaactt cactgggcca ctattaaact ggaaaaagaa attcagaact agggtccttc     41100
     tgaattagtt cagctccatg catttgagct ggtgaaacaa gtgaaccata tggttatagg     41160
     ttattgttgg aactgtggcg aaccagaacc aaacaaaggc ccaaactact catcttaggg     41220
     gccacatcat atatcatgta aaaatttgaa agctatgtat aggtgggcaa ggtgagggat     41280
     tgaattcaga ttgccatggc gaagattggc tgcatgagcc atctgggcaa ctttcttatt     41340
     gcaaactaga atgcatctcc tatatattaa gggcctgttt ggcacagctc cagctccagc     41400
     tccacccctc ctggagctgg agctcagcca aacagtttca gctccaccaa aactgggagt     41460
     ggagttgggt ggagctctct cacaaaatgt actagagttg tggagctgtt atatttagga     41520
     gttggagctg taccaaacag gccctaagtg cctgtttggc acggctccaa cacctctctt     41580
     ggagctggag ctcaaccaaa cagttttagc ttcacctaaa atgggagcag agctgggtga     41640
     agcgctctca caaaatgaac tagagaggtg cagctgggtt taggctgctc cacaactcca     41700
     ctccagactc aactcctggt gctaaattta ggagttgaag ttctaccaaa caggccctaa     41760
     gttatcaaca caatctttca tgaaccacag ttgaactgca tggtccattg gtcataccac     41820
     tgaaccagtg aactgagggc accactggct aaatgaccgg tccacccttt tccactatgt     41880
     tctaaaggac cttaatggtt ggtgtctttc tgtcctaagt tccgaaaacc attttatgtt     41940
     tggtggaatg caatggttga aggggtcagg aactgaagga aagcctattc tttcggtgat     42000
     acataatcag tgtacgaaaa cctggtggta actggcccat gactggtaca ggacaaacct     42060
     gcctgaatac tccaaatttt gttaatttct tccagctgca ttttctggct agtaactgga     42120
     gtcagagtaa ccggtggccc ggttacaata ttttgaatct aaatatttga tttgaaattg     42180
     tcctgtaaat tcttgtagat caatgatgtt agaattgtgt tgccatttgc catgtggatt     42240
     attaagagga ttgatattag tatccccttt gtatatttgt gcaaaaggtt cagccaaagt     42300
     cttaactgca taaaaagttc aagatgtaaa ataattaaaa aaatcttgta tgtttactga     42360
     atttgcttgt caatattctg tatgttgacc atatttggta cgcacttggt gtgccaccca     42420
     aattttgctg agagttcaca ttttcatcct agtcggcgac cctttgctga ttgggcaacc     42480
     caactgatgg gtcaaacttg gcacaaacaa aatataaatt gatctaatag gttttaggcc     42540
     cttagcttca ctgaaattag cacttattca acaatttcta tgatttacct ggctattaga     42600
     tctttcttgg aaggcagatg gattcaatag gccctaaaac attgaacaat ttatgcacat     42660
     ccgcttgaca ggctgacaat atgagcaaaa gtatcatctg agaaaaatga aatataattg     42720
     ttttaagctt ctagcatact tgagtgattt ttttggattg taatatagtt gtgttccttt     42780
     cgtggtccag ctccctcagc aggataattc atttgattgt ggcttgttct tactccatta     42840
     cgtggaactc tttttgatgg atactccgag aagcttcaat cctttgaaga ttgactcgtt     42900
     cgctaactat gtgagctctc taatctaact tcattttcat agttgtttaa tgaaattatg     42960
     ttcgtttgtt atttttgttg gtaacatgtc ttgtttaacc ttgagccgta acactgttac     43020
     cttgagtgat cagttgtttt tcctatgatc ctagttatta tttcaatgaa tgcgaagagt     43080
     ttttgctatc gtgaacattt tgcactgagt ttgaaacttc aatagtttgt cctctaatga     43140
     aaaataaact aatgtaaatg attttattcc agttaacctg catctctgct tgacgaagtg     43200
     aaatagctat gatttgaatt tggtgcgaat taatcattac taccttgact gctaaagttt     43260
     gcattttagc aagtttcaac ttgtactttt gaatcagtta gtgcaaatga attcctacta     43320
     taatagctta tgtgagaatt ctacattgta cagatatatt gcttcttacc aaaatttagg     43380
     ctttatatga cattgggcta agttgtattt accagtagtc aattatcaaa agtagaaata     43440
     gtggtttata cgcaccagtt gaaagttaca aatggggaat tgtgtcggtt caatttaaag     43500
     cgggattttt aatattctga aattgtgcca ttttggggtg tgcaattcct aattaaatca     43560
     tctggatgga catggttttg ttatttttat atctcaggat ttgagccaaa ctttaaaaaa     43620
     tcatcctttt gtagtgcacc ccattccacc tttacatcct cttcagttgg agctccaagt     43680
     tctgtgtttt gttattttta tatctcatag cattttagag tccaactttg gttttggtct     43740
     gcatttcaac tcaaccctct acactttttt tttgctttgg taacctacaa tacagtattc     43800
     tggaaaagct aataataatt ctttttttac catgtggtct atcattagtt ttgatttgat     43860
     gatatagtcc tcttatgttt tcactcttga tgtacttttc agcttagtga tgattggttt     43920
     ccacctgctg aagcttctct caagcgttca ttgattcgaa aattaatcca taagctgttg     43980
     aaagagcctt ctcaagattt tcccaaacta gtctgctgta gtgagcagct ggataaaaca     44040
     catgggagtg agaacgctga gctagaacaa atgagtgaga atgctgagcg agaacaagct     44100
     aaagagctcc cagctcagat gtgcactgat ggtgaacctg attcagttgg caccattctt     44160
     gaaacacagc aaccatccat atcaacatgt ttcaattatt ctgatgaaaa cggcccacct     44220
     gtttctgtac acaacctaca taagttggag gtatattttt atctattggc ttctcgtttt     44280
     aatagactgg cagttattac ttttgtcaag cttgtttagt aatacagtgc tgtcaaattt     44340
     gttgttcttg tattttatta ttgttaggta tcgtctgcaa acaaggatgc cattgtctgc     44400
     ttgtcaaatc atgatgagaa aaatgagtca cctcctgcag attcttacaa tcatcttgat     44460
     ttgagatcat gcgactcaga agaggctgag acagccaagg gatcagctgg tgttgtgaaa     44520
     gatccgaata gtcataagga gcctttgctg gattctctgg ataataacca ggatatttcc     44580
     atccaagctg gagctgagat gcatgacagt atggactcca agttatgttc gatctccaat     44640
     aatgctgact taatggctag cgaggaacgt tcgttagaca agaacaccaa tgaaaatgag     44700
     gagcacaatc gaacctcaga agatatcgta gaatctgtca tgatgcttgg cggcagcaaa     44760
     agtgacactg aacttgatgc agaaccagaa aggactgcag gtgaagctga ggttcggaat     44820
     tgtgatcatt ctaaggacat agattatatt gcattaggtg atatcaacaa agatgctgct     44880
     aagcaatctt taaataggaa tattgttgaa gctgaggaca ttaaatgtga aggtactctt     44940
     gtggatcata cagtggtaga agatgcaact ccatataatg tgaatgaaac tagtgcaagt     45000
     gccgacaaga tcaatgataa tgagcataat gtttcatctg agttgaaaga aggaaataac     45060
     ggcaatggta taaccacttc aatttcctgt gaaatggaag atagaagcat tgacaattta     45120
     atggtaggtg atagcagaaa cggaacagat gaaactcgtg cagatggcca agaagctcac     45180
     gataactctg caacagctga gacagttcct tgcgaagaca atgcaacaac cagcataact     45240
     gatgctgaga tgccacacga agatagcaca tgtagcgtga agggtgaagc aatttcggat     45300
     aacacagcat ctgatgccaa aagacctctg cctgatagca cctacataga agatatacct     45360
     gacgacaagt gcttgcagaa agatgatggc gggggtgatg aagcaaaaac agagcggcac     45420
     tacaagcgac ggaagtttct ggtctctgaa gcaacatctt gagattagat tggacctgtg     45480
     taggtgctag ttttcgcttt gtgttatatg tattcatttt tattgccttt acgcaatatc     45540
     cttgtcttct ataggtgagt ccatgaaatt tgtaagttat gaatagacat agacctcaga     45600
     gctatatgaa actctgatgc ctagctgcct gcatgaccaa cttttgttaa aggtcttaac     45660
     ttagatttgg aactgaaaat tgttgtatat gggcgaactt tgtcatgtgc tgctaagatt     45720
     tccgataccg gtaatcatca taatttatag gggctggcgt gttagtgagc taggctcgaa     45780
     gtttcaaatc tatgtttctt ttgagatttt tagcatgcag gctaatgttc atttttagca     45840
     gagcttcagc tgtttggatc ggttggacat tgatgacatg aatagccggt agctaatgtc     45900
     agtttgtctc atccatatat tgcttgcacg gcaatgccaa tgaagtttgg ttttgtgcga     45960
     ggtgaccggg atattaagca aagtttctga ggtggattcc gttaagaact ctacttctgt     46020
     ggtcggtggt cactgcacca aactatcaat tatgtacctt actcagtact taagtacatg     46080
     tactgtggct atcgacgcat gtttgcacgt atttggttgg aaaaaggacg gcaaaaatac     46140
     acttgtggtc gtgctattcc aatgcgaagt tcaccatggt ccaacaaaat ttatgttgga     46200
     tcaaggacac ctggtgcaat gaccttggaa caatgaacag tatcaattta attgtcatgg     46260
     caaacacatg tagtgcaaag ggggtaaccg aaccgccttc atttccggta ttcgcggaaa     46320
     ctgtttgaaa accttgacta acagtgaaat ttgaccaaat tttatcaaaa atttaaaatc     46380
     cagtttgacc ttgactagtt taccgaatgg tttatgatct cgagtcgata agaaaccttt     46440
     ggttgcaaac cacaacttag gtgaaaacca taaaactcaa agtttctaaa aaaaaattca     46500
     cattatattg tgcaactata caaaatctca aaagcaaact tgactttgtt tgtgaaatat     46560
     gaaattaact gatgttgaaa aaaacacttt cctaaaaaaa aattctctgc aatttggcaa     46620
     tttcatatct cacaatcaaa tgaagtagag ctccttattg aaattttgca tggttgtcta     46680
     atgttatcaa actactatac aaaatctcaa aagcaaactt gactttgttt gtgaaatatg     46740
     aaattaacta attttgaaaa aagcactttc ctaaaaaaaa tttctctgca atttggcaat     46800
     ttcatatctc aaaatcaaat gaagtagagc tccttattga aattttgcat ggttgtctaa     46860
     tgttatcaag ctatatgtaa ggttttcttt attccttgac attgatggtt cttttgccat     46920
     tcataaccgt gcaccactta tatgtagcac cccacttaca ctttcattct tcataacgaa     46980
     caatgtctta taagttgatt tcactcttaa tttaactatc aaggtggtat taatcaagtg     47040
     cacatggcac tcataggtca cgtagacaat attttaattg ggttaggatg tcagagtggt     47100
     caacgcggtt attaaaccgt ttggaagagt atttgtgtgt ttgcaagttg tgtaaaatta     47160
     ttttgccttt atcccgggtt tttgttagta aagacatctt tagggaaagt gatgcttcag     47220
     ccaaagaata tcccctaatg tccatttcac ttttgcaatg taatgcatga gccaaagaat     47280
     aaaaagtctt aggaatgaaa ggagtttaaa ggaactgtta caataaaaaa aagcatcttt     47340
     tctttataaa gtgcgaaata ttttatattt gaagattcga aactttttgt agttacaatg     47400
     gttagcctct gtgtagtcat atatagttac caagtcaacc aaatatgtta accccaacgt     47460
     tgggagacaa caatgcacaa aatatgacct tttcctatcc tctcttttcg ttcaaaagat     47520
     aaacattagc cagccaaatc ttcatttctc tctctacatg tcaatcgata ctattgtttt     47580
     aaaggataaa tagcaatgtg cccatgtaag atgatctgct gtccgcgtaa gcatgtccaa     47640
     cagttcacat aaactcaatc tcctaaatct cttttctaat aaggagaatt taagacatgg     47700
     aaatattatt cttccccaaa tatactctaa tttgagccct aaataataat aaagaaaagg     47760
     gccaacctcc ctttccacac tttgggctat ctcctgtggg tggagcgtaa ttcctctcct     47820
     ctccgctcag tgcaaggaaa gtagctacga gtgaggattt tgtgacaaga gtggctccca     47880
     acttgtgagg accgaatttt atgggggaag agaactccaa tccttaggca aatagacata     47940
     gaactgttag ccatgctcta aggttgtatt taacaaaacc ttttgtattc tctctgttcc     48000
     ataatataag agattttggg tggatgtgac acatcctact acgtctgtcc agattcatca     48060
     tactaggatg tgttacatcc acccaaaatc ccttatatta tgggacggat ggagtatgct     48120
     ttaggtccgc tatagaaaaa cttttagaac ttatttataa ttttatcaaa agggtcaatt     48180
     tattcactct atccaaaagt gttacacatt tcggtatgtt gtttttcttt ccaaaagaga     48240
     tggtcatatt tatagtctca tgctaaatta aattgttgac cgaaatatga acaactatct     48300
     tagtcctcat tggttacatg catagtataa ttcattagtt tctggtgggt tttgttttta     48360
     taatttttag aagtctcgtc aaacactatc actatagtcc gctacggtcc atccgctgcc     48420
     ttatctattt attgtcattg tgattttaaa aattgaacat aattatcgtt tgagtttatt     48480
     attttactct ctataagtct agtaaaatca ttagcggctt cgtcattata ctcctctaca     48540
     gcttgcccgc tgcttccgct ctttattgct tttgagattg taaaagtcca acattattat     48600
     cattggggtt tattttttta ctttccagaa gttccactaa tcgtcgtgac tggtgctgct     48660
     taatggcatg ctcgttgttc ctcctcttaa tcatcatagg gattcaattt gggactctgt     48720
     ttatagtttt tagatgttcc atcaatcacc actaccctgc ttcattacct tctcccatct     48780
     tttattgcca tttgtcatta ctgttctaga tgtttttttt ttgaaaattt catatttttc     48840
     attcctatat tttttattta tataaattgt attcctacat aaactcttat aattattctt     48900
     ctattttcta aatttatttt atttattatt tcgaatttta ttgatcgtgt tttagatggt     48960
     catttctttc aatagttttt attttttaat tataaatttt agctatttat aaattgtatt     49020
     cctagttgaa ctcttattta ttttaaattt tggaattcat tttatttttt atttcaaatt     49080
     ttaatttaac aataactgaa attcacaatt aaaaataagc aatattttaa tcccaaattt     49140
     taatttccga gtcgtaactg cggcggcaac gacactccga cggcgacggc agcaaatccc     49200
     ccctcccccg ccgccgtccg gtgacgtggc cttcctcctc ttcccaccgc agcctcaagt     49260
     tgggggcgtg gcccacgcac tgggccccac acccgcccac catagctggt gcccacactc     49320
     caacctccca attcctccat gaacgtagcc caccatacac cacccctctc acaagttcac     49380
     aacacctcac ccacgggccc acctgtcagt cactcaacca tccccaccca tccgtagagc     49440
     gggtccaccc gcccagtcca ccatcgtcgt cacccacgag gagacgccgc agcacgggaa     49500
     cactcttttt tcttcaattt cacaggaaat aacatttttt gtaatttctt ttataatttt     49560
     ttttaatgcg cgtcggcgtt aataaagcgc aacggcaggc agcgatctag gcgcccgtcg     49620
     tccactcctc ctcgccttcc tcgccttcct cgcttttatc gccgccgccg ccgccgccgc     49680
     ctccgccgcc gccgaggagt aggagtagta ggaggaggaa gccggtagcc ggaggaggag     49740
     cggggagatg gcggacgcga agcagcagca gcagcagcag acggcggcgg ccgccacggg     49800
     ggtctggaag acggtgaagc ccttcgtcaa cggcggggcc tccgggatgc tcgccacctg     49860
     cgtcatccag cccatcgaca tggtcaaggt actggacgct gtgcttcctc ctcctcccta     49920
     gggtctgagg ttggcgacgg gatcggggtt ttggggtggg tcgggttgct tgctcggggt     49980
     ggagggcttg gatccgttgt aatggagggg gatctggtgg gtagctgcgt aggagtgggt     50040
     tggatctgat gatgcgtggg ttcgagtggt gcagtggagc tcgcttatag gggtggctgg     50100
     gtgtggatcg ctttagatct gttgcaattt gtcgatggcg tccgcgcgga tgcttgggaa     50160
     ctcatttccg ttagctaatt attgtctcgg atggagttcg gtcgccacga tctattagat     50220
     ccgtggagtt tgggttttac gtgatgcgga ttgtagtaga gccgggccag tttggtgttg     50280
     ctcgctgttc tctgtgcttt cttgaggtat ttcatatcgc catcttaggt aaatttgtca     50340
     gtggattgtg tagtaaattg cctaattggt cgatcctgag atgatccatt aacatttaat     50400
     ctgtgaaaat tgtagcagta gcagatttag tgtatggctc tacatttgtg cagcggcatg     50460
     caaacgtgct aattttttag tctggtgggc ggagaagatg cattccttgc tattcctttt     50520
     cgtgatctgt tatcgattag tagcacaaaa tggggaaaaa aatgtcagca agatctgttg     50580
     gaacatggga attggctagt agccatcact atcaatgtgc tgatggcttg gtttatggtt     50640
     ggtacctact ttatttagca cgtgagcttc ctgtacataa ttcttccttt tattttgatt     50700
     tcaggtgaag atccagctgg gagagggatc tgcagctcag gtcacaaaga acatgcttgc     50760
     taatgagggt attggttcct tttacaaggt tcgttctact gaaggtgctt tagattcatt     50820
     ttcaaacatt ttaatgtgtg ttctcaatgc tggttatgtt aggttactat gagattttac     50880
     tgggtccaac ttggacattg ttatccagta tatattgttc gtatcaataa tgatttgatc     50940
     cttgtttaac cttgaaatgt ctcaatatac tatgttagca ttttagcttg aaccaacaag     51000
     gattcactat tttgcacttg ttacaccatg ttcggttgtt agttttggat tgatatgttg     51060
     ttgaagttct tcagcacctc atttgcaggg tttgtcagct ggtttactaa ggcaggcgac     51120
     atatactact gctcgtcttg gatccttcag gtttgtatag atcacttgtt ttccatgggc     51180
     agaaatattt taaatggtta ctgcttttgt tgtattattc tcataatggt cagaatcaat     51240
     gatttcaaat tggaaacttg cgtctagtct cctcggtacc tactaggacg attaatacta     51300
     attggatgac tttacgacta attgtggtta taattgagtt gccttattac tgactaggat     51360
     gactaatcgc gattaggttg acgatttgaa aacatgactc gaatcttgta gttaccagct     51420
     aggatctttc tgctacattc cttaggggaa gtcatattaa ttcgatgacc atatttgttt     51480
     caagtttaag agtgccagtt cttctcacct tttgtactgt accaggaact caaaatttag     51540
     ttatgtgtgt gcatgatatc tgatgtgaca cgtcctgtta ctggaagcaa aacaaagcct     51600
     ttttaggtct acgaaactat atcattacct aacaatgatg aatgggcctg cttcactggg     51660
     caagagagcc aaacatgtgc ataaactatg ctgattgcta tctgttgctg tcttgctgat     51720
     gagtaactga aagaaatgtg ccaatgctgt tttgctcgat aactttgagg aaaattaggt     51780
     taccggggat atcattattc tttattttct gggatttttt taagagtgat taggctgtgt     51840
     tcggatagta gggatgggaa cccaatctcc ccgcacggaa aacggagcgg tccattagcg     51900
     cgtgattaat taattattag ttaatttttt tttaaaaatg gattaatttg atttttttaa     51960
     ataactttca tatataaact ttttacaaaa aatgcaccgt ttagcagttt gaaaaacatg     52020
     cgcgcggaaa acgagggaga ggggttggga acttggagtt ccaaacacag ccttaatcat     52080
     gctattagca gaattatttt gtagtacact tggcctgatg tatcatttgc tattttggag     52140
     ttttaaggaa tatttcatct ttttctttat tgttctcctg cggttgttcc attttactgt     52200
     gtagagaaat ttgatcatca taaagctgga ttagttgagt ttattgcttc atgattctaa     52260
     gtatttattc tgatttagat ggttgtcaat atttaggttg gaacttgata tttgattatc     52320
     taattcaggg ttctgacaaa caaagcaatt gaaaagaatg atggaaagcc attgccttta     52380
     gttcagaaag cttttattgg ccttactgct ggagctattg gagcatgtgt tggtagccct     52440
     gctgatttgg cactcattag gatgcaagct gattcgacct tgccaattgc acaacgccgt     52500
     aactacaaga atgctttcca tgcgctctac cgtattattg ctgatgaagg tgtccttgcc     52560
     ctttggaagg gagcaggacc tactgtggtt agagctatgg ccctgaacat gggtatgctt     52620
     gcttcctatg atcagagtgt tgagctattc agagacaaac ttggtgctgg agaagtttcg     52680
     actgtacttg gtaagattac agcattgagt actttattgt ttttctttgc taaacttgta     52740
     gaaaattttc acctattttg ttatggtgca tagcttttgc tttacatgca ttaagaattt     52800
     gctgtagttg agtaaaatat gatctttcaa tattgcacat tactatcaaa tttatgtaag     52860
     cacatgcctg ctgcccttct tctatgctca ggacaaagtt ttcatatgaa atattacaac     52920
     ttcttttaca ggagccagtg ctgtttctgg gttctttgca tcggcctgca gtctgccttt     52980
     tgactatgtg aagacacaaa tccagaagat gcaacctgat gccagtggga agtacccgta     53040
     caccggttct ttggactgtg ccatgaagac cttcaagagc ggtggcccat tcaagttcta     53100
     cactggcttc cctgtgtact gtgtcaggat tgctccccat gtgatggtaa tgtttaagca     53160
     catctttgca ctgtacttgt accacctttt gtctctagtt ctccacatgc atcctcactg     53220
     agtggtattt tgtgcagatg acatggatat tcttgaatca aatccagaag ttcgagaagc     53280
     agattggaat ataaggtctt cagttggagg ttaatatgcg gagttatcat ttgctcgagt     53340
     ggagataata acgttccagc tgcttacact atcggtagtt ggttttggta gacaaaagtt     53400
     taaaccaagt tatcctagct taaatgttgc cgtggtggta ctattgtgtc ttttacaata     53460
     atcgaatcat ttgttgtaac tggggcgatt tttttggggt ggacatactt tatttttgtt     53520
     ggctgggact cagccatgag gggggatact tcctgcttgc gccattgaat taaatgggac     53580
     catattttat acagatttcc aaaatctctc aaatgatctt cagcaattgt ttctattgga     53640
     agccaacgtg ttcttattgg aatcggacat ttgtctacat ggcaatggcc acaaaagatc     53700
     gcatgtgaca aatatgtccg accagtggaa tggatctgtg ttttgctaac ctagtacttg     53760
     tacgcgaaaa caaatacagc agtcatgcgt ccgatagcca aatcggttgt gtaattttca     53820
     gctcaaagca atctattgtt ttctctcttc atttatataa actataaatg aaacacgatt     53880
     tattcggaaa ctcaaattta ctatcctagg taccatataa ttataagcta gtacttagca     53940
     ttcagaaact tgaagtcaag atcgtagcat tcagaggggc agcatattca gagaagagta     54000
     cacggcatcc agaaaagcag ggagctgcgt aaacagttgg gccgtcaatt tgttgggcct     54060
     attgtgtctg tttaccaatt ttccttgtag gggaccaaca agtcaacaac ccatatactg     54120
     ttttcaacat ttgagatcga gaatttccca aaaatacaat aaaaaaactc aagaagactt     54180
     aaaaaaaaga gatttctaaa acattcataa attggatatt atggtggtgt gatgccatta     54240
     atttacctta caaatggacc atgcaattta agcaaaagga gaacacattc tatcacctat     54300
     gtccaacaat caacactaaa ccaccagtcc accacacaac aaaagaacag aaaaaaacaa     54360
     taattgaaat tcatcttgaa cttggaaata ccagaccact acccccaaga tcattatgaa     54420
     acacaaacaa gaataaaaaa aaaatcaaaa caacaattca aagcaaagga aacaacaagg     54480
     gaaacagcac atatctgatg atcaatatct gccactgcac ctagataatc tgtcacatca     54540
     attccgagga ctactcagtg gcgacacctc cgacactgcc ggcagctggt tcttctccga     54600
     cgctgctgtc gccggcgagg tccagcagat gtcgttcagc gacggcctga ggtctctgtt     54660
     gcagaacgcc tggtactcca gcgtgtcgcc ggccgttttc ttcacctcga cgacgtagca     54720
     cgacggcgaa acctcgaaga tctcggcgtc aatggcgagc tgccctttcc tcccttcctt     54780
     ccacccctgc agcttcaccg ccatcccgtc ctcttcttgc ctcttcttct gcttcttctt     54840
     caccgtgaag tgctccgtct ccgcgatctc ctccagcctc gacacgatcg ccgtcgccgg     54900
     cttcccggtg acgaacagct gatcctgcgt cctgctgctg tggccatggc agcagaacat     54960
     ccctgacagg tcgaatccct gcgagagcga gatgatgtcg aacgcgttca agctcgccgg     55020
     cttcatgttc atggcggcgt tcgctggttt ctcctcctcg ttgagtttca tggtgttcga     55080
     gcttgccggc cgcttggtgt gtcccttctt gaaccatgga tgcttgacga gctcgtcgat     55140
     ggtgatgcga gttgtagggt ttgggtcgag gagtctggag atgaggctgc gtgcgtcggg     55200
     ggtgaaccag tcggggacct tgaactcgcc attggtgatc ttcttgtaca tctccatgag     55260
     gttggaatcg aagaacggga ggtagccggc gaggaggagg aagaggatga cgccgcagga     55320
     ccagacgtcg gcggtggccc cgtcgtagcc cttgtcgccg atgatctccg gcgcgacgta     55380
     cgacggcgtg ccgcacgtcg tgtggaggag gccgtcgtgc cgccgcgacg cgctgagcgc     55440
     gctgagcccg aagtcggtga ccttgaggtt gccgccgccg ccgctgccgt cgtcgtcgac     55500
     gaggaggttc tccggcttga ggtcgcggtg gtagacgccg cggctgtggc agaagtcgac     55560
     ggcggcgacg agctggtgga agtacctcct cgccgcgtcc tccccgaggc ggccgccgcc     55620
     ggcgaccagc ctggcgagga gctcgccgcc gcggacgagc tccatgacga agtagatctt     55680
     gctcctgctg gccatcacct cgtggaggcg gaccacgttg gggtggcggc cgacgagccg     55740
     catgacggcg acctcgcgct cgatctggtc gaccatgccg gcgccggcgc gcagcgcctt     55800
     ctccttgtcg atcaccttca cggcgacggt ctcgccggac acgaggctcc tggcctggta     55860
     caccttggag aacgtgccgt gccccagcga gcggccgagc tcgtaccggc tcatcaccac     55920
     ggtgcccttc tccggcatct tgacaccggc gcccggcggc gccgccaccg gcagctggtg     55980
     gaggcgacgg ccggattagt gtatgttcac ggcggccatg gctgaacgtg gagagcccat     56040
     gtcgttaatg ggtgagagac gaggaggaaa tggaggtgtg gaggagccat ttttgaagga     56100
     agcaatggca atggtttggt gtttttgcaa atccgccatg ggaggaggat gagagcatgg     56160
     aggatggagc ttagcagtgg taattaattg tggtcttctc cgtaacacaa ggtgaggtca     56220
     tttccatgtt aaatttcacc atttgtgaac tgcctaaaaa taggatataa gacgatacaa     56280
     atttagctaa tattatttat caatttaagt ctattgagtt atttctctca ttgatttagc     56340
     tgagcctaag gccttcttag tatgacttaa cattaacaaa ggatcccttg ttgctttcgt     56400
     ggctaatgtc aatgcttttc ctaaattcca gaggcatttt gatgaaatta tcctgggaga     56460
     aggccaatat agagttatgt ttcgcatatc actaatatat attaatatat attaagatta     56520
     tcatctttgc caatattaga ggataatttt gtgcttgaca atgcgaaact gtatctagca     56580
     aatgtttttg caaactttag gagttcatca ataccaatga taagtcatta aaaaggttag     56640
     agaaagacat cgcacatttt aaatacgcca cttgcccagt tcatatgacc tttctcctac     56700
     taaactacga tcatttttca gaattgtaat attcagtgag acaaagtgga gcataattga     56760
     cttgttttat cactttgtat atcaataaga aatacaaaat actaagaagc aagctaagta     56820
     agatcatgta tttgatggca aagataaact ttactaagga gagagagaga gagagagaga     56880
     gagtagcaac tccaaattta atgataataa agctcatata ttccttataa ggggaaataa     56940
     aattgcctct atatcttacg tatacatatc ttgatttttt ttcttatgta tgtttttttt     57000
     gcaagaaata gggacatgct taatgtcctg gtttgacaaa gtattacaaa agaaaattaa     57060
     tggcattatt tttaggttga atcattatga gacgttctcg aaattatggc cttgttattc     57120
     agccacattt ctagtggata atagatgtct cattaagata gagacacttc attcctagaa     57180
     attttttaca tcgatcatta cttagatgat aatttactaa gtaaaattaa atttaaatca     57240
     tgtgattcaa gttgatggaa aatcatatat tatgattcca ttgcataaat aataaaatca     57300
     gtgggagctc atcaaaatct ccaacaagag agattattct acctcattta tgattcatat     57360
     ctccattatg tggatgctaa aattttgcat gagttgtaaa agttttgcaa aacatttttt     57420
     catctcttaa cagtgacttg caaaaattaa tatacatagc atagcctgag ttggtttttt     57480
     gttgtggaaa gacaagtcac atatagggtg tagacttaag aaatctattt gtggagttaa     57540
     tcaagcatca atgatgtttt aaattccgtt gcatcattag tgaactaagc ttaaataaga     57600
     atatggtgga taatgatgtc tgtaatgatg gaagtgagac gtcattgaaa ttatgacatg     57660
     tcatttatgc cacattgttg attccaaaat ttggaacaat tttgaatcat gataaaacat     57720
     tagttaagac ttcaaaccca gtatgttatt ttttacttag gaattttaaa attaaattat     57780
     gtatatgtta taattgagtc tactctacat gtaatacaac ttgatattta ataattatga     57840
     atataagaat tattaaatca tcaaaaagct taactccaaa ccaagattat ttatgtacct     57900
     attaattcaa acttgctaaa ttattttata gcaaatgctt acaagagaca ccaaaagatc     57960
     agtacaaatc tatacttcta gtattgaatt tttaaattat gaaatttcaa aaaaataaag     58020
     taatagaaga aatattagaa tggattatat aagaaattac taattctgtt tttggcatct     58080
     ataattatat agaaatgttt tgtatcaact tcctttaaaa caaaatttac ttatgaattt     58140
     aacaacataa tttatcatta tccagtgaaa ttttaatatt ttatattcac aataggccat     58200
     gaaacataca agttgacggt tagtaagact aatcaaactt gaactgtttt tccttatttt     58260
     ttgggtcatt ttacggcgcc ccctcccccc gcccccggca aatagtagtt gattttcatg     58320
     ggtattttag attttttttc cttaattaag gtagaaaggt attttggtat gttgccttgc     58380
     tcccagtctg tgattgctac cgccctcggc tcttctctcg cgacagcgca agcctgactc     58440
     tgccacaacg gtgatgcatg gtgccgcccc tccgcccaag gtgcccaatg gtcatcccgt     58500
     ccgtgcccct ccactccgct atacgcacaa catgcggcta ggtggcgacc cttgttgaac     58560
     gaattggcgt cctctggctc cgcctcccac ccgcgtgctt gaagctccga gctcgccgcc     58620
     cctccacctt tcttgctcgc cttcaggagt gagggaccac tgccactcct tgcgcgaata     58680
     atcctctctg tggaggcggc acccctcatt tgtatgcggt acgtcacaag agccgctgcc     58740
     accactgcat tcagtctgga gccactgtaa tcattcttcc gtttgttttg atccgattca     58800
     tgaagcaatg tctcaatgta catatgcaag ggaattttta tgccaatatc tttcgctccc     58860
     cagtaagaga ttgtcttgag taagatattg ttgcccaatc tgctactagg gttatcatcg     58920
     gaggtgttcc tatgtagtgt ttcccgggct caccacacct gggtaaatta ttcaattcta     58980
     gctaatttgt accatattaa ttaatatgtt agctaataat tagataatta atatgtattg     59040
     gatccccgat aatttttgtc ctgggatcac cattggttat catagttcaa ttcgtgaatg     59100
     aaattactaa tattatcaag aaagaaatat attgacataa ttggtaggaa catccttgtt     59160
     gcaacatcct tgtagtatta gagcaagtga gcgtgggggc gatggcatgg aaaacaatgc     59220
     ttttctcgtc gaagagcacg gcagcaacat tcgacctctg gctccaggtc tatgtgactg     59280
     cacggcgcct tggcagaaac tcgcaacaca aacctagctg tggtgaacca aagggtcagg     59340
     cttattgtac atttgtaacc ctgtcatatt actgattaca gagatttata ccaatgccac     59400
     aatttttttt tcagatgtac ccttctacta cacctattac actaactata ctaatgtagt     59460
     agaaataaac ctccttcttt ggatctaatc taatgaatgg ctcacattca cccaagggta     59520
     ctttaaaaaa aattcatgtt ttgacgagaa tatttcgccc ctttgcttca gaagtcatga     59580
     acctaatgtg ggaactacat cactaatgga tgatgacaca acaaaaaatg aatgagctga     59640
     ttggcatgga tcatgtggat tacttcttca gtataaatgg gagagtgacc tatgtaaaat     59700
     aaatatttag ctaatcaaac atttcggcat tcaactacac ggacctgaag gtgttgatag     59760
     cgctaggatt tctctgatgg gtctgaccat attaaactaa aaaaaggtct ttttcattga     59820
     tcggtttgcc ctggagccga gtaatgactt tgctagggtt ttactccaaa gtcatttatg     59880
     ctctgagata gagagagaac agacctagga gagcagctac ctttataagt tacaagctga     59940
     gtctgtcaaa ccatttcgct ttggcccttt tcttaatgtt ataattagaa agaagggaaa     60000
     gacaaagaaa gaaagagatc aaggatttat ttaccattgg agaaagggga tattggagta     60060
     aaccaaataa aagttatgtc tatgtgtgat ctggttgcaa gtatgaatgt ttttatgttg     60120
     gagatatcgg aacaagatga tgccatttac tcaatttgac atgttgtata agtaaatgag     60180
     aactaactgt tcgaatgaga gtttttgtct tgagaaagaa aggatgactc ctcagggaga     60240
     ttttgatgtg tttcttattg tcgtattaac ataattgaac atataattcg tatgataatg     60300
     ccagtgcctg tttggcctaa ttggatgggc acattgtata ctattcattt aaattctttt     60360
     aaattggtat gataattttg gagtataaat atgatgcaaa catgcaatca tcagctatta     60420
     gttgcatggt aagggccatc tcttgttgta aaaactatta agtcaggacc cactgcaaaa     60480
     tcaattcaat tcatatgttt tgcattgtat gtgcatcttt atgtgggtcc aataataaac     60540
     tgaaataatc tatatttatg tatcctcgct gttcatttga taaccatgtc gtctcggttc     60600
     ccatgctttt tatcatattt ttatatgggt aattgcactt tgaccatatt ttaaagacta     60660
     aataccaatt tgaccatatt tttcgaagtt tgatcatttg actttttttt aaaaaaataa     60720
     aaattaggtc tgaccctgtt ccgtgaaaac agtataacag tgttaactta tagaaaaaat     60780
     gacgctcatg ccttcattca gatggacaac cgacaggtac agtggaacaa aagttcagag     60840
     ctttccaata gagcaagaat cagaactaaa ctattgtctt caaattgctt cgattgctaa     60900
     gttcaaccag aaaatctcag aatatcccta cgaagaaatc cacttggact gctctgttca     60960
     cacaaaaata aaaaaatcat gaacaacaaa gatagagacc ggaggaaaaa atattcttag     61020
     agcctgcacc tacagctgct gaagccggtg accacaagat ttggggttcc actgctatgc     61080
     gagcaaccga ccactgtctc cctccgtccc ggtcattagc cgagcttcgt gccgggcgtt     61140
     cgccgagcac catgccggtg agttcacatg cctccttgct gcgaaccccc gcttctcttt     61200
     ccgagccatg cgccggccgc agatccattc cccttcttcc cgctcctcca caccccgcac     61260
     cggccaccgc gagccaccat cctggcctcc gtccattgca ggtcgcgccg ccgctctctc     61320
     catgcgcctc agctatcttc acgcatgcct ccgcgagcct ttgcctcggc ctcgatgagc     61380
     tagccgcctc gccaccggga tgagaccagt caggatcctc tgcggtcgac tacgtcagtg     61440
     gcaaaggtac agtacaatcg tcttttcagg cccacgtatc agtgacaaaa atacgatgca     61500
     gtcaactttt tgggcccaca tgtcagtcat ccatggtcga ggtcggggtc ggcttggatg     61560
     aagtgaaagt tgtttggtca ttttgatgtg tactcgtggc attttggtta ttttgtacaa     61620
     gaagaaggga aacttaatgg tgtaatgaaa ataggggcag acggttactc tgaatttaaa     61680
     aagcggggtc aaataagcaa acttaaaaaa atagggtcag tagttagctt tcaaaatatg     61740
     gtcaaataag caattatcct tttttttatt gtgacggttc agaagtctac acattttggt     61800
     ttttgaagaa ttacctccta aaatattacc atcatttgaa ttaccccatg aaattttaat     61860
     accagatgca actgttcaaa ccggcaaata acacactaac tcaatctgaa acagttttag     61920
     tcctacgtga caatccagtt agtatttttt tataaaaaaa agtcattggg ccgatctgtt     61980
     agatttttgc ccttatcgca ttcccctctt tcccacaagg tcgtgactgt gtgtggcatc     62040
     aacgcccttc ttcctctgtt gcacagtgga gacctcggca ggcacgggcg ctagcactca     62100
     ctacgaggcg tgaggaagac ctcagcagga aacaacacac ccagtgccgg tgccttggcc     62160
     tttctcggga aagattgtgg gggattgaag cgccactgcc cgccaatctc ttgggttctt     62220
     gtccttttcg agagaggagg ggtagggtgg ggtgagagat gacatatggg cctacttgga     62280
     attttttttg ttgctgattg gagtgctagg ttgtcgccat gtgtgcaatc ctaggccaaa     62340
     atctctttaa acagtactgg gggtatttaa ttcaaccagt ttgaagagtt ttggtaaatg     62400
     tttggtattg tggttagggg gtaaatctta ctgcgtcaat agtttagggg gtaattcgga     62460
     ctttattact atcaaatata caacgactcg atttattacg tacactagag atggcatggg     62520
     ctgctttaga acgcacgatt ttgaaaacat ggagtaggaa atatacaaga ttagaatgtc     62580
     atgccttgta aattcctaca tgaaacaaaa acacaagatt cttaaataat agtcgtttgg     62640
     atggcactca agaaatacat aggaattgaa ggcacaaaaa gagaagtcca tgaggtgaga     62700
     ccttatgtta atttttatct aaaattccta tgaaatggtc tattccatag gatttctcaa     62760
     ggaattttaa gggttcaatc ttttgttcca aatcgctcca taggaattct atccatagaa     62820
     ttcaaatcct ctgaaaaatg cttcactttt cctttgttcc aaaggagtca taagataagg     62880
     gaacttatag gtttctcttt tggatttaac ctatactgta taaactggca ctattttgca     62940
     cgatccaata atttttaaga caccagacta tgattaattt gcaatctttt tgcagtccga     63000
     ctccagagct agctcacatc actatggata tgtaggcttt tgttctggat ctgatctata     63060
     gctatagaat gctccatccg ttggaaaaca aatcaattca tatatcctta ctatcatctt     63120
     accacgaatc gagaagcttc attgtaccta ttcaatgccc ttatgtacct atagtccttt     63180
     ttatcactaa agttcctatg caaagcgaga ctttgtttta tttaggatag agggagcaga     63240
     tgtgcttcac gattttgtat gaaccaaaag cttgtgagac agcatgactg aagtcaataa     63300
     cgctaaagcc actcccaata atgggagttt cattcttatt ccgtattaaa tattgtatca     63360
     tgtcaacatt tttcatgatg tggtaagaaa ttaataatga agtaagagat gaaatgggtt     63420
     taatcttgat gaaaccatat gcccgatgtt ttcaatatag cttggtctct tgcatgtatt     63480
     gcgtatgcaa tattaaaaat aaaacaataa atttcatgtg ctatttcaat catcaattaa     63540
     acatctgttt ggttcaatgt atggaattgg tcgggttggt tcaaacccat tatttagggt     63600
     gttcggtttg aggatatatg agatggattg aactctgaag gagaatattc cctaagacca     63660
     gagtcagttt tactggacca atcccaccca ctttctttca ctgagatacg ggcctttcct     63720
     atccctcaaa ataataagac cactccatct cataccaaac agataatttg accatcccat     63780
     caaaaaaata gccacctcat tcttaaacca aatacatgtt taatgtctta ttagttttgt     63840
     gacactctaa aaacatgaaa aataacacct ttcactgggt gggctaaggc gcttgaatgc     63900
     tatgctttta tatcctgaga gttgtttaga tctgacgctc agtctaagtg ctcttttgta     63960
     ctgtgtttct taaaaaataa gtgctctttt aaactatatt atattatagc tagaactcca     64020
     attcgatact tctacactat tagtaactag catggcagcc cacgcagatt gcgcggctag     64080
     catcattata atagcatata tatttctcaa tttattatta aaatatatta aaatgaaaac     64140
     ataattttaa attttgtact aactttacca aactaccaat atgtaatatt catactattg     64200
     tacatacatg atagttataa ttatttttaa tatcaaattt tagttatttc taaattgtat     64260
     tcctatatgg acactagact tgtcttccat tattttaatt ctgaattttc gttatttgta     64320
     aattgtattt ctatataaac tctatactct tcttccaata ttatttatat ttaattccga     64380
     attttgaaaa tttctaattg tatttatacg tggactttaa acagatcttt cgatattctt     64440
     tatttttaat ttcgaattac agttacttct aaattgtatt cctatttgga ctctagattc     64500
     ttcttcccat ttttttaatt taaaattttt gttgtttgta aattgtattt gtatatggat     64560
     tctaaactct acttttaact ttattatttt tattccgaat tttagttaat tctaaactcc     64620
     tatatgaact ttatactctt cttttagtat tccttatttt ttaattccga atttctatta     64680
     tttcttaatt gtatttctat atgaactcta tgctcttctt ctaatatttt tttatttttt     64740
     taattccgaa tttcagttat ttataaattg tatttctata tggactctat acgcttcttt     64800
     cgatattctt ttttaatttc gaatttagtt atttctaaat tttatttttt atggactcta     64860
     acctaatttt aattttctta tttttttaat tctgaatttc tattaattct aaattgtata     64920
     caacatagac tctagtctca tcttccaata tttctaattt ttaattctga atttcagcta     64980
     tttctaattt gtatttctat atggactctt ttttttcttt ttcgttgatt aatatgagaa     65040
     tttctaggcc atgagagcga acgtgaaggc tcttttttct attgctttaa taagttaata     65100
     gatgtgcatg tgacagacaa tgaccaagtg taaccatgga agagctcaca cagcagtact     65160
     ttatgttgag aaacttgggc ttttggccca tggataacaa cctcactatt aggtagtctt     65220
     ttgaaaaaac tcaatattag gtgtacatca atatggcaat atcttgttag aacatacaag     65280
     ctccatccgt tttatattat aagactttgg gtttgcccta agttaatcct cttcaaattt     65340
     aagtaagttt gtagaaatat atagaaacat ttccaaaaca aattaaatat actataaaaa     65400
     tatattgaat ggatttaatg aaaactttgg tgttatagat cttgctatat tttcctataa     65460
     acatgattaa atttaatgag gtttaactta gaacaaagac aaaatgactt aatataaaac     65520
     aaatggagta acgatcaagg caagcgtgat ttagggtctg ttcagattga tgccaaaatg     65580
     aacctttcta aaatttgggt aaattggcaa cattgccaaa ttgtagtagg atgtgctcaa     65640
     tataatgttg tcaaaattcc atagtcatta ccaaaatttg gtaacaaaat aaatatatat     65700
     agctacataa ttgtcatctt taccaaataa tggcatggtt taaaatgaca tcaatctgaa     65760
     caagcccata atataagtca gcatcaaaac attttattac ctagctgctt acctatatcc     65820
     atatattcaa agagaaatta gtggtgtgca ttgaagattt ttagtcattt gagttttgcc     65880
     tttgtgtcac tgcacgcata tgttatgcat ataggatcag ccagtttctg cttttgatgc     65940
     ataggctcat ccagtttctg ctcccatgca ccatgtcatg ttctcttgtc gttgcgtctc     66000
     aagggtagtt tctgttcgat gcaccaaaca tgtatggcca aatccgtatg tcaactaagt     66060
     tgtataagac tcatcaaact tgattttttt cctttttttt ttccggcaat attttccccc     66120
     tttggttgag aagtcatgca tgaagctaat gtgggaacta catcactaat gcatgatccc     66180
     ccaacaaaag cagaatgaat ttattggcat ggatattgtg gattattttt ccagtataaa     66240
     tgagagagca accttgtaca agcaatatat atttagccaa tcaaacattt tggcattcaa     66300
     ctaagtggtt tttcacaagt cctatttgct agcagatata tttgcaggga actagtatct     66360
     gaaggtgttg atagggttta atttatctga tggttctgac catattaaat agagggtcta     66420
     ttttatcgtt tgtctgtctt ggagccgaac aagtaaggcg ttcggcaatt tttcacttca     66480
     aagttcttta cgccctgaga aagagcatac ctatgtgcga ttgagtcgta ggttgcgacc     66540
     gagtttatca aaccattatc acttttgcct ttttcttttt ttagaattag ggatgaaaga     66600
     aaaaacacaa agaaagagat cgggaaactt tatttataac cggagaaatg ggatattaga     66660
     gtaaaccaca tgaaagttag gtctatgtga aacagaacgg gaaactttat ttatgaccag     66720
     ataaatagga tattacggta aactacacaa aaattagacc tatgtaccac acagaagtta     66780
     ggcctatgta cgattagttc acctaaacaa atgtaaatgt ttatgtccat attgatctgg     66840
     attgcttttg tgtcacatag ttgtacagtt cttgattgga aaagaagaat tctccaacac     66900
     atgtgtggga gattttgatg ttactaatat aattggttca atacaatctt ggcatatatt     66960
     tctcattgtg ctactaacat aattggtaaa atacagccat ggtagcacct gtttggccca     67020
     attgcatgtg catcttgtgg agtactattt tctcaaatag gcatgattat tttgcaatat     67080
     aaatgtgatc aaattgacgt cgtctaggtg tataatcatc gtctaggatt caggtgcatg     67140
     gtaagaccat ctcaagtact gataaaaact atcctatata tttatatagt tgatcccacc     67200
     tactgtagtt attattgcta atttcatgtc ctctcgtgca gccacatcat cacttttatc     67260
     ttcatcgtta gatgaatcta tatctttgat gtcagcagtt ggatagaatt ctctcccatg     67320
     atacagtccg gcaataaaca accaattcat gagcagtcga gtgcgagcca ccacagccgc     67380
     aatacgcaag cgagcgcgaa taccagtctc cacaattcca ttaggcatgg ttgtggtgat     67440
     agagcttctg cactggatga gaattgtaat tggcagcgaa gcccggccgt caacctgtcc     67500
     tcctgcctcc cctatcgaaa ctaccagacg accactcgac tttgataact acaagaggca     67560
     tcgatctttt gttttaagag aagggtattt tttttacctg gcctctatat acaatcggat     67620
     atatacggct ttttaaatta gaaacttagc ctattaaata aggaacttag ctctcaaata     67680
     accaaatttg aaattcgcta ctatggagat ttgaactcaa gaccttaggt gctactcatg     67740
     tcactgcatt gataggaact tagcctatta aacaaggcat caatctgatc caacgagcat     67800
     tgctattacc tcttaatttt acttcctttc gattaatctt cctctcacca ccatactata     67860
     ttgctggagc ctcccaagca catcaacgac aagcgtgctc ctcgctcata ggacggcttc     67920
     gcttttcctc tcgctctgca tagcacagga tgcagagcag atccccacag caaccctggt     67980
     atacatgttt ctctttgttc tttgatcaaa ataaaattgt cttttccttt ttatttactc     68040
     tttgcagcaa acaatgttaa caacacccgc tcatttcttt tcagtttaca ctgtatgttt     68100
     gttcgagtat atatatgcac cgactgggtg taaccaaaca agctcactct tttcagtata     68160
     tgtatgtttg ttcaggtata tgtatgctcc tcgcccgcca acttttttag tttgagttag     68220
     acctcaaaat ttcatagaaa ttccttcgga ttaagtttca gtattgttta gctcaatttc     68280
     aaattaatta ttgttctcgt tgacaaaact tgccgattca atcaattgtc tgtgaatcac     68340
     tcttcctcgg ttgggacagt acctatatta agttaatcga tcaatgtgca attttttata     68400
     tcctcaataa ttaaggatgt atagttggtg ataactgata actaattagc ttcagtagtc     68460
     ccagtagaaa gacttgtcac ttttacttag cataactgac gctactattt gctactacta     68520
     aataagtaga tttacaagct atggcaattt gcaggttgta tttcacaatt gcattctttt     68580
     ctccaactaa ggttggatta aattttggat actcgtggca cgcttttcaa actactaaac     68640
     ggtgggtttc gtgtgaaaac tttctatatg aaagttgctc taaaatatca tattaatcta     68700
     tttttcaagt ttagaataat taaaacttaa ctaatcacat gttattataa cctcgttttg     68760
     cgtgaaatat ttaatcttca tcttcatctt caggacatta aaaaccacca tagagtgctt     68820
     gaattatctt ttcagtaaaa acttgctgag gtttcatttt gaataattca attactgtat     68880
     aatgttcccc aaggtattat ttgcagtgat gtacaaatgt acattacaaa ggctctcatc     68940
     ggatggccta ttcagccaaa gaaaaagcca aattttgaat tttcaaactt aattttgata     69000
     ttgattttga gatattttca acgtagtttc ttttttagca ttggctttta aatcaccgag     69060
     aacacatata taaaagcttt acatgtaaat ttatttttat tctctaataa gccgttttgg     69120
     cttatctatt atatactaaa agtccattaa tcttcctaca aacgctccta agccgccact     69180
     tggcgctcta ataaattaga gaaatcaaaa aaattctgag aaaaaagaaa agcatctatc     69240
     cattgatttt tacttaaaat agtgggtcca ctagtagata ccgtcagatt aactatattg     69300
     atcttaaaac gtacaattcc acaccatccg taggtacgta cgtacgtacg gttccatctc     69360
     cttccctcct ttttcttttc atatatatat aatcgagata acagttaata tagttaaatt     69420
     ttatataatc ataacttata tgattatatt atgatatatt tctttccaaa ataaagttta     69480
     caccactata tttttaccca ttaaataaag gtatacgtga accctttatg tggagcatta     69540
     ttttcaaatc atacactatt taaataaagt ttataaagtt tataccgtta cattctgtac     69600
     gcattaaact aacaaagaaa tatattaact aatttatact taaacgtgct atttcagact     69660
     ttttaataaa ggccggatta attttacgag tctttacaat tatttgtacc ataaattata     69720
     tatctatttt tatttttcaa ataaatatat aattttaaca tctatattgg atttattgca     69780
     ttctagacct acatccatct tgagtgctcc actaaataaa agaaaatatt aaaatttgtc     69840
     attgaaaatc aaaatatgct agcttatttt ttaatgaaac taacccatta aaagtacatt     69900
     gttagacatc taatgacttt ctaccaactt aattaatttc ttcataaaaa aactttatta     69960
     atttctcaca acatacacgt gggggctatt tacatatacg aattgatctt gatgcttttg     70020
     taaataaatg atattttaaa tttaaaagat aaataaacga tcttaaaatg atcatagcat     70080
     ctaaatcata catatgattg ctcctagcac tcctataaac acttctaagt cgctatgtgg     70140
     cattctatta attaaaaaac actcatataa tcgaccatcg gtttccactt aaaccgatgg     70200
     acccaatttt tataatatca tatctatctt ttgggaaaaa aaacaaagtc tatcagaatc     70260
     tctgtctggc tcactgcgta acatgcatgt gtgcgctcct atacctttta acaagtgttt     70320
     atttatggta catgaaattc caaaaatatt acggtgcaat gatatttcga cgttattgta     70380
     ttcctgctag gttgcgtgga gcctctcatt cactctacat gaaatgttca taggtagatc     70440
     gcctctcaaa atatatcaat catattagac tatataaaac cgtgcatttt tcgtgtagct     70500
     taatgtccca cccaattcat cctttaacat attatgataa tatattatac aattaaaaaa     70560
     aataaaaaca ccttaatttt tattttacac ttacttttac tttcgttgac atgttttcta     70620
     aagaaaataa atctaccttt tttttaaaat gatgaagaat attataaata attacttata     70680
     gatactactt atatttgata taatataaat ctaataggtt aaaatattat taaagaataa     70740
     attaatgctg acaaaaataa tttatggaga aatcgtggca gatgttctcc tgttaatatg     70800
     tcgcttttat aaatacctca aacttggcgt acgactcatg cccgcgcgaa cgcgcgggct     70860
     accttcctag ttaaaataaa agccaaacga tgggcccaaa atgtccggtc gcaacgtgta     70920
     gggtaccatc aagttaaact agatcacact gcaaaatcaa ttcaattcat actgttttgc     70980
     attgtacgga cgcatcttta tgtgggccca acagtaaact gaaatcctat aagcatatac     71040
     aactgatcct cacttattgt gcttattatc aatttcgtgc actttggttc atccacgtca     71100
     ttcgaattaa tagcagccgt tggatgaaaa cgcagtggtc agatctcctc ccgagtactg     71160
     cacagttaca tgtcaaggcc taattgacag agtaagccaa ttaatcccac cactctgccg     71220
     ttccacttcc cttcttttgt aaagcgtcag atcatgtgct ccagtcaatt aatcctatta     71280
     atttctttgt tgagctaccc atttcaacaa tcaccaccaa taagtatact acttccagtt     71340
     gattggtgaa gtgaaatttc tttcgcacat gtatgcagtt gccagcatca atacttcaat     71400
     agtaactaga aaataataaa gcgccccagt tggcgcgccc actaaattat aacccatgtg     71460
     tattatttag caacatacgt cgaaagaatt ttatcaaaat tagcataatt gttataatgt     71520
     tctttttagg aaatatacat tcaaggtgat tctttaatgg gttttcaatt ttgtgtttat     71580
     ataaaaatgt ccaggaacta atcatggcag atggtgatat tagagaaaaa aaaagtaaaa     71640
     ttttgttttc taaaaattgt tctttttcgt acaataaaat gtgtttacat gtgagtcatc     71700
     taatttgtat aattagctga aaatatgtat cctaaaatta atgtgtctta gattaccgat     71760
     ttctatctac atattatttc atttttctat aaatatagga cacaccgaca tggtaaatat     71820
     atttttgttg ttatcgactc tctccgtctc attttaagtg tagccatgct tttccgtgct     71880
     taattttaat catccatctt atttaatttt ttttaaaaaa ataaaaatat gagtcatgca     71940
     taaagtacta ttcatgtttt atcatctcac aacaacaaaa atactaatta taaaagtttt     72000
     caaataagac ggacgatcaa atttggacac ggaaactcac cgttgcactt aaaatggtag     72060
     atattttgga acattcacgc ataaatacca tctagttttg ctacatattg ttttcattct     72120
     atagaaccat agggatttgt cttgaatttt ttattaaacc tatagtagat catacttatt     72180
     cgaagatttt taactatccg tacatttaat tttactattt attactccct ccgtcccaaa     72240
     atatgagcat ttttagcatt gacaagtcaa acatttttaa ctttgaccat taatagcaaa     72300
     acaataaaaa agatctatga tgtaaaattg atgttattag atttatcatt aaacaaacta     72360
     tcataatatg caacactttt tatttaaaac attttactat aatagatatt attgatcaaa     72420
     gtagcatctc ggaggccgtg ccagaatcca aaaatactta tattttggga tggatggagt     72480
     ataaatgtta acaggatgaa attactacgt tgattttgat ttaacttttt gaataaattt     72540
     gctaaacatg gaaatctatg aatcctgaca ttttccccct tctatctcat tcttttattt     72600
     atttatattg cacaactgtc ttaggtcgca tgctgtcgat gatttttttt cctaccaggc     72660
     tgacatacga atcacgcaca gccctggagc gagcggccta gccgcatctt tttctttttc     72720
     tttttactgc acgcacgcac ggttcgtttt ctttccggat ctctccagcg gtatgttcac     72780
     ctgtttcttt gtgccacgtg tcaatcaaac agaggaccat caactgaacc aatcagatgc     72840
     cggcatccac cgccggcttt agaagaatag atatgaccta tttatcacaa gtaacattgt     72900
     tcttcgctca ttgttgattt taacccacac ataaacaggt tgatagcgct cgccgattgg     72960
     attgtgccaa gactaagctg taactattga tcacacgtac tccctccatc caaaaaaaac     73020
     tcaacctaag agggtaggga gctagtatga tccagcagcg gaatgacata acaaattaag     73080
     tgcaaatcac cccccccaaa aaaaacagaa ttagcataaa agtccatgtc catctggacc     73140
     aacctcccaa accccattgt ttttcgttgc tatttcttag aaaccgaaat ttttggagac     73200
     gaaccttttt ttttttaaga taatggaata taatatcccg gcctttactc aaaagagcta     73260
     cagccaatta ttacatagta gttttcatga acatagtgta aatctaaata aatagaacac     73320
     accgaagatc attattattg aaaccagcct aacgtaagga gatcacaatt attgaagtct     73380
     atttgtaaat ctccaaccat aattggcaaa tagttgcata accgtggttt ggagacgaac     73440
     ctaaaagacg ccgatcaaac tgaatcccgc tcctaccaac aacagttttc tcacgaattc     73500
     tgcttaaaga ctagaatggt gtgaaaggtt atctgactga atgagtatcc atttatccaa     73560
     ggtaaatatg gtggttccgc gtgtgtgaca atatgggaca tcgagatttc tttttttttt     73620
     taaaaaaaaa catcagttac acaactctgt gtgattatca caagagaaga ttgttttcat     73680
     acagattttt caccttgcct gagcactatt agtcctacta cagtctgcag attaataata     73740
     atatatatag tacacttact tcaatttaat actagtataa atataatcct aaaattctag     73800
     tatcacttta caaaattcta accataggct catcacttca aaacatatga attacggcat     73860
     ctagaatcac tagagtaatt ggggaagcac cggtgacatg gtggtaaagt cataggtgca     73920
     caattcaggg ttaaaattct gatgtccatg attaatacac acttgcaagt aggctttcaa     73980
     ctaaaacttt atgagattag ggatgtgctc ctggttttca tctcttcaag cgcatgtgtg     74040
     agtacgcatg tgtgtgtata gagtgtgttt ctgtgcgtaa ttagaagaaa acaaaaagat     74100
     cacacgagta attcaactag tcaggtgcac gacaatcaag aaaaatttag ccaactttaa     74160
     attcacaaaa ccgaacaaaa agaaatgtat gaactactct gtagtgtgct gcttgtatca     74220
     acacgaaaac cttgcccatc aacatgtata tcaactatta caaacacgct ggccaaaatg     74280
     aaaaaggaaa acataaaacc acaaaagaaa agagacatac aaacattcta tacacactaa     74340
     aaaaaaataa aatcagtcag cttcagtttc aaagtgacat agcctgttct cagccagctt     74400
     ggtcctgtag gctgaagcct tgtactcccg ccaggtgaac tccctgtacc ggcggcgccc     74460
     gccatcctcc gccaccagcc atggcagcgg cgctagtcgc tcccgtggcg gcggcccggc     74520
     gaagaagatg actgacaccc gtggccgcgg gctactcacc atcacccggt gcctcacgct     74580
     tcgaaatctc ccgttcgtta gaacctgttc gaacggataa ttataaagct ttattatgca     74640
     tgggtgcaat aattagtcgt acattattat gttattggtt gtaattaatc tcaagaattt     74700
     atggagtgta aagtgcaata ctacaatttt tgtattgaga ccaaaagtgt aaaagatttt     74760
     tcactatcta aaaatataac aataaggtgt ttttttaaca taaattctat caatgcaatg     74820
     aagttgagtt ctcatatcga accgaatgaa tcaatctttc ccttgtgtga tggcaattgt     74880
     gcatctgatt caactttttt ttttgaaact aaaccggcag gagaactgcc aattatattt     74940
     tcaataagca ggagtaaaaa ccctagacgg gttacaagaa aagaaaaaac aactaccggc     75000
     tggctgaata gctgcaccgc acacgccaca actcactaac aacagaaacc actgacggag     75060
     cccaacatag aacgtcgtta ccaagcttga ccaagacggc aaaggggttc cgaccttgca     75120
     accgtgtcat tgttgccgag cttgccgcct agcgacacag cagctccgac ttcaaatcgg     75180
     ttgcatcatc catacctaac tcgctgtcaa tggtcaagtg gcttcaactt cccacgaaga     75240
     acttcagcca aagccgtcta aacgccacat cctattcacg gccaacaaac aaaaccccta     75300
     gaaagagaat gcaacgtgtc atcgttgccc agcttcgtca ccctacgaag cagctccgac     75360
     ttcacctagc aaacacaagc aaggagcgaa gattgcccgc cgcaaaacaa aaagtgggac     75420
     tagacagcga aggcctcatc aaaaccaagt actgaa                               75456
//

If you have problems or comments...

PBIL Back to PBIL home page