(data stored in ACNUC30630 zone)

EMBL: AE000513

ID   AE000513; SV 1; circular; genomic DNA; STD; PRO; 2648638 BP.
XX
AC   AE000513; AE001864-AE002092;
XX
PR   Project:PRJNA65;
XX
DT   01-JAN-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Deinococcus radiodurans R1 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Deinococcus radiodurans R1
OC   Bacteria; Deinococcus-Thermus; Deinococci; Deinococcales; Deinococcaceae;
OC   Deinococcus.
XX
RN   [1]
RP   1-2648638
RX   DOI; 10.1126/science.286.5444.1571.
RX   PUBMED; 10567266.
RA   White O., Eisen J.A., Heidelberg J.F., Hickey E.K., Peterson J.D.,
RA   Dodson R.J., Haft D.H., Gwinn M.L., Nelson W.C., Richardson D.L.,
RA   Moffat K.S., Qin H., Jiang L., Pamphile W., Crosby M., Shen M.,
RA   Vamathevan J.J., Lam P., McDonald L., Utterback T., Zalewski C.,
RA   Makarova K.S., Aravind L., Daly M.J., Minton K.W., Fleischmann R.D.,
RA   Ketchum K.A., Nelson K.E., Salzberg S., Smith H.O., Venter J.C.,
RA   Fraser C.M.;
RT   "Genome sequence of the radioresistant bacterium Deinococcus radiodurans
RT   R1";
RL   Science, e1252229 286(5444):1571-1577(1999).
XX
RN   [2]
RP   1-2648638
RA   White O., Eisen J.A., Heidelberg J.F., Hickey E.K., Peterson J.D.,
RA   Dodson R.J., Haft D.H., Gwinn M.L., Nelson W.C., Richardson D.L.,
RA   Moffat K.S., Qin H., Jiang L., Pamphile W., Crosby M., Shen M.,
RA   Vamathevan J.J., Lam P., McDonald L., Utterback T., Zalewski C.,
RA   Makarova K.S., Aravind L., Daly M.J., Minton K.W., Fleischmann R.D.,
RA   Ketchum K.A., Nelson K.E., Salzberg S., Smith H.O., Venter J.C.,
RA   Fraser C.M.;
RT   ;
RL   Submitted (08-NOV-1999) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; f3df114d0657154bf1ca879d1331a4c9.
DR   BioSample; SAMN02603976.
DR   EnsemblGenomes-Gn; DR_r01.
DR   EnsemblGenomes-Gn; DR_r02.
DR   EnsemblGenomes-Gn; DR_r03.
DR   EnsemblGenomes-Gn; DR_r04.
DR   EnsemblGenomes-Gn; DR_r05.
DR   EnsemblGenomes-Gn; DR_r06.
DR   EnsemblGenomes-Gn; DR_r07.
DR   EnsemblGenomes-Gn; DR_r08.
DR   EnsemblGenomes-Gn; DR_r09.
DR   EnsemblGenomes-Gn; DR_t01.
DR   EnsemblGenomes-Gn; DR_t02.
DR   EnsemblGenomes-Gn; DR_t0253.
DR   EnsemblGenomes-Gn; DR_t03.
DR   EnsemblGenomes-Gn; DR_t04.
DR   EnsemblGenomes-Gn; DR_t05.
DR   EnsemblGenomes-Gn; DR_t0595.
DR   EnsemblGenomes-Gn; DR_t06.
DR   EnsemblGenomes-Gn; DR_t07.
DR   EnsemblGenomes-Gn; DR_t08.
DR   EnsemblGenomes-Gn; DR_t0852.
DR   EnsemblGenomes-Gn; DR_t09.
DR   EnsemblGenomes-Gn; DR_t10.
DR   EnsemblGenomes-Gn; DR_t11.
DR   EnsemblGenomes-Gn; DR_t12.
DR   EnsemblGenomes-Gn; DR_t1264.
DR   EnsemblGenomes-Gn; DR_t13.
DR   EnsemblGenomes-Gn; DR_t14.
DR   EnsemblGenomes-Gn; DR_t15.
DR   EnsemblGenomes-Gn; DR_t16.
DR   EnsemblGenomes-Gn; DR_t17.
DR   EnsemblGenomes-Gn; DR_t18.
DR   EnsemblGenomes-Gn; DR_t19.
DR   EnsemblGenomes-Gn; DR_t20.
DR   EnsemblGenomes-Gn; DR_t21.
DR   EnsemblGenomes-Gn; DR_t22.
DR   EnsemblGenomes-Gn; DR_t23.
DR   EnsemblGenomes-Gn; DR_t24.
DR   EnsemblGenomes-Gn; DR_t25.
DR   EnsemblGenomes-Gn; DR_t26.
DR   EnsemblGenomes-Gn; DR_t27.
DR   EnsemblGenomes-Gn; DR_t28.
DR   EnsemblGenomes-Gn; DR_t29.
DR   EnsemblGenomes-Gn; DR_t30.
DR   EnsemblGenomes-Gn; DR_t31.
DR   EnsemblGenomes-Gn; DR_t32.
DR   EnsemblGenomes-Gn; DR_t33.
DR   EnsemblGenomes-Gn; DR_t34.
DR   EnsemblGenomes-Gn; DR_t35.
DR   EnsemblGenomes-Gn; DR_t36.
DR   EnsemblGenomes-Gn; DR_t37.
DR   EnsemblGenomes-Gn; DR_t38.
DR   EnsemblGenomes-Gn; DR_t39.
DR   EnsemblGenomes-Gn; DR_t40.
DR   EnsemblGenomes-Gn; DR_t41.
DR   EnsemblGenomes-Gn; DR_t42.
DR   EnsemblGenomes-Gn; DR_t43.
DR   EnsemblGenomes-Gn; DR_t44.
DR   EnsemblGenomes-Gn; EBG00001181282.
DR   EnsemblGenomes-Gn; EBG00001181283.
DR   EnsemblGenomes-Gn; EBG00001181284.
DR   EnsemblGenomes-Gn; EBG00001181285.
DR   EnsemblGenomes-Gn; EBG00001181286.
DR   EnsemblGenomes-Gn; EBG00001181287.
DR   EnsemblGenomes-Gn; EBG00001181288.
DR   EnsemblGenomes-Gn; EBG00001181289.
DR   EnsemblGenomes-Gn; EBG00001181290.
DR   EnsemblGenomes-Gn; EBG00001181291.
DR   EnsemblGenomes-Gn; EBG00001181292.
DR   EnsemblGenomes-Gn; EBG00001181293.
DR   EnsemblGenomes-Gn; EBG00001181294.
DR   EnsemblGenomes-Gn; EBG00001181295.
DR   EnsemblGenomes-Gn; EBG00001181296.
DR   EnsemblGenomes-Gn; EBG00001181297.
DR   EnsemblGenomes-Gn; EBG00001181298.
DR   EnsemblGenomes-Gn; EBG00001181299.
DR   EnsemblGenomes-Gn; EBG00001181300.
DR   EnsemblGenomes-Gn; EBG00001181301.
DR   EnsemblGenomes-Gn; EBG00001181302.
DR   EnsemblGenomes-Gn; EBG00001181303.
DR   EnsemblGenomes-Gn; EBG00001181304.
DR   EnsemblGenomes-Gn; EBG00001181305.
DR   EnsemblGenomes-Gn; EBG00001181306.
DR   EnsemblGenomes-Gn; EBG00001181307.
DR   EnsemblGenomes-Gn; EBG00001181308.
DR   EnsemblGenomes-Gn; EBG00001181309.
DR   EnsemblGenomes-Gn; EBG00001181310.
DR   EnsemblGenomes-Gn; EBG00001181311.
DR   EnsemblGenomes-Gn; EBG00001181312.
DR   EnsemblGenomes-Gn; EBG00001181313.
DR   EnsemblGenomes-Gn; EBG00001181314.
DR   EnsemblGenomes-Gn; EBG00001181315.
DR   EnsemblGenomes-Gn; EBG00001181316.
DR   EnsemblGenomes-Gn; EBG00001181317.
DR   EnsemblGenomes-Gn; EBG00001181318.
DR   EnsemblGenomes-Gn; EBG00001181319.
DR   EnsemblGenomes-Gn; EBG00001181320.
DR   EnsemblGenomes-Gn; EBG00001181321.
DR   EnsemblGenomes-Gn; EBG00001181322.
DR   EnsemblGenomes-Gn; EBG00001181323.
DR   EnsemblGenomes-Gn; EBG00001181324.
DR   EnsemblGenomes-Gn; EBG00001181325.
DR   EnsemblGenomes-Gn; EBG00001181326.
DR   EnsemblGenomes-Gn; EBG00001181327.
DR   EnsemblGenomes-Gn; EBG00001181328.
DR   EnsemblGenomes-Gn; EBG00001181329.
DR   EnsemblGenomes-Gn; EBG00001181330.
DR   EnsemblGenomes-Gn; EBG00001181331.
DR   EnsemblGenomes-Gn; EBG00001181332.
DR   EnsemblGenomes-Gn; EBG00001181333.
DR   EnsemblGenomes-Gn; EBG00001181334.
DR   EnsemblGenomes-Gn; EBG00001181335.
DR   EnsemblGenomes-Gn; EBG00001181336.
DR   EnsemblGenomes-Gn; EBG00001181337.
DR   EnsemblGenomes-Gn; EBG00001181338.
DR   EnsemblGenomes-Gn; EBG00001181339.
DR   EnsemblGenomes-Gn; EBG00001181340.
DR   EnsemblGenomes-Gn; EBG00001181341.
DR   EnsemblGenomes-Gn; EBG00001181342.
DR   EnsemblGenomes-Gn; EBG00001181343.
DR   EnsemblGenomes-Gn; EBG00001181344.
DR   EnsemblGenomes-Tr; DR_r01-1.
DR   EnsemblGenomes-Tr; DR_r02-1.
DR   EnsemblGenomes-Tr; DR_r03-1.
DR   EnsemblGenomes-Tr; DR_r04-1.
DR   EnsemblGenomes-Tr; DR_r05-1.
DR   EnsemblGenomes-Tr; DR_r06-1.
DR   EnsemblGenomes-Tr; DR_r07-1.
DR   EnsemblGenomes-Tr; DR_r08-1.
DR   EnsemblGenomes-Tr; DR_r09-1.
DR   EnsemblGenomes-Tr; DR_t01-1.
DR   EnsemblGenomes-Tr; DR_t02-1.
DR   EnsemblGenomes-Tr; DR_t0253-1.
DR   EnsemblGenomes-Tr; DR_t03-1.
DR   EnsemblGenomes-Tr; DR_t04-1.
DR   EnsemblGenomes-Tr; DR_t05-1.
DR   EnsemblGenomes-Tr; DR_t0595-1.
DR   EnsemblGenomes-Tr; DR_t06-1.
DR   EnsemblGenomes-Tr; DR_t07-1.
DR   EnsemblGenomes-Tr; DR_t08-1.
DR   EnsemblGenomes-Tr; DR_t0852-1.
DR   EnsemblGenomes-Tr; DR_t09-1.
DR   EnsemblGenomes-Tr; DR_t10-1.
DR   EnsemblGenomes-Tr; DR_t11-1.
DR   EnsemblGenomes-Tr; DR_t12-1.
DR   EnsemblGenomes-Tr; DR_t1264-1.
DR   EnsemblGenomes-Tr; DR_t13-1.
DR   EnsemblGenomes-Tr; DR_t14-1.
DR   EnsemblGenomes-Tr; DR_t15-1.
DR   EnsemblGenomes-Tr; DR_t16-1.
DR   EnsemblGenomes-Tr; DR_t17-1.
DR   EnsemblGenomes-Tr; DR_t18-1.
DR   EnsemblGenomes-Tr; DR_t19-1.
DR   EnsemblGenomes-Tr; DR_t20-1.
DR   EnsemblGenomes-Tr; DR_t21-1.
DR   EnsemblGenomes-Tr; DR_t22-1.
DR   EnsemblGenomes-Tr; DR_t23-1.
DR   EnsemblGenomes-Tr; DR_t24-1.
DR   EnsemblGenomes-Tr; DR_t25-1.
DR   EnsemblGenomes-Tr; DR_t26-1.
DR   EnsemblGenomes-Tr; DR_t27-1.
DR   EnsemblGenomes-Tr; DR_t28-1.
DR   EnsemblGenomes-Tr; DR_t29-1.
DR   EnsemblGenomes-Tr; DR_t30-1.
DR   EnsemblGenomes-Tr; DR_t31-1.
DR   EnsemblGenomes-Tr; DR_t32-1.
DR   EnsemblGenomes-Tr; DR_t33-1.
DR   EnsemblGenomes-Tr; DR_t34-1.
DR   EnsemblGenomes-Tr; DR_t35-1.
DR   EnsemblGenomes-Tr; DR_t36-1.
DR   EnsemblGenomes-Tr; DR_t37-1.
DR   EnsemblGenomes-Tr; DR_t38-1.
DR   EnsemblGenomes-Tr; DR_t39-1.
DR   EnsemblGenomes-Tr; DR_t40-1.
DR   EnsemblGenomes-Tr; DR_t41-1.
DR   EnsemblGenomes-Tr; DR_t42-1.
DR   EnsemblGenomes-Tr; DR_t43-1.
DR   EnsemblGenomes-Tr; DR_t44-1.
DR   EnsemblGenomes-Tr; EBT00001760131.
DR   EnsemblGenomes-Tr; EBT00001760132.
DR   EnsemblGenomes-Tr; EBT00001760133.
DR   EnsemblGenomes-Tr; EBT00001760134.
DR   EnsemblGenomes-Tr; EBT00001760135.
DR   EnsemblGenomes-Tr; EBT00001760136.
DR   EnsemblGenomes-Tr; EBT00001760137.
DR   EnsemblGenomes-Tr; EBT00001760138.
DR   EnsemblGenomes-Tr; EBT00001760139.
DR   EnsemblGenomes-Tr; EBT00001760140.
DR   EnsemblGenomes-Tr; EBT00001760141.
DR   EnsemblGenomes-Tr; EBT00001760142.
DR   EnsemblGenomes-Tr; EBT00001760143.
DR   EnsemblGenomes-Tr; EBT00001760144.
DR   EnsemblGenomes-Tr; EBT00001760145.
DR   EnsemblGenomes-Tr; EBT00001760146.
DR   EnsemblGenomes-Tr; EBT00001760147.
DR   EnsemblGenomes-Tr; EBT00001760148.
DR   EnsemblGenomes-Tr; EBT00001760149.
DR   EnsemblGenomes-Tr; EBT00001760150.
DR   EnsemblGenomes-Tr; EBT00001760151.
DR   EnsemblGenomes-Tr; EBT00001760152.
DR   EnsemblGenomes-Tr; EBT00001760153.
DR   EnsemblGenomes-Tr; EBT00001760154.
DR   EnsemblGenomes-Tr; EBT00001760155.
DR   EnsemblGenomes-Tr; EBT00001760156.
DR   EnsemblGenomes-Tr; EBT00001760157.
DR   EnsemblGenomes-Tr; EBT00001760158.
DR   EnsemblGenomes-Tr; EBT00001760159.
DR   EnsemblGenomes-Tr; EBT00001760160.
DR   EnsemblGenomes-Tr; EBT00001760161.
DR   EnsemblGenomes-Tr; EBT00001760162.
DR   EnsemblGenomes-Tr; EBT00001760163.
DR   EnsemblGenomes-Tr; EBT00001760164.
DR   EnsemblGenomes-Tr; EBT00001760165.
DR   EnsemblGenomes-Tr; EBT00001760166.
DR   EnsemblGenomes-Tr; EBT00001760167.
DR   EnsemblGenomes-Tr; EBT00001760168.
DR   EnsemblGenomes-Tr; EBT00001760169.
DR   EnsemblGenomes-Tr; EBT00001760170.
DR   EnsemblGenomes-Tr; EBT00001760171.
DR   EnsemblGenomes-Tr; EBT00001760172.
DR   EnsemblGenomes-Tr; EBT00001760173.
DR   EnsemblGenomes-Tr; EBT00001760174.
DR   EnsemblGenomes-Tr; EBT00001760175.
DR   EnsemblGenomes-Tr; EBT00001760176.
DR   EnsemblGenomes-Tr; EBT00001760177.
DR   EnsemblGenomes-Tr; EBT00001760178.
DR   EnsemblGenomes-Tr; EBT00001760179.
DR   EnsemblGenomes-Tr; EBT00001760180.
DR   EnsemblGenomes-Tr; EBT00001760181.
DR   EnsemblGenomes-Tr; EBT00001760182.
DR   EnsemblGenomes-Tr; EBT00001760183.
DR   EnsemblGenomes-Tr; EBT00001760184.
DR   EnsemblGenomes-Tr; EBT00001760185.
DR   EnsemblGenomes-Tr; EBT00001760186.
DR   EnsemblGenomes-Tr; EBT00001760187.
DR   EnsemblGenomes-Tr; EBT00001760188.
DR   EnsemblGenomes-Tr; EBT00001760189.
DR   EnsemblGenomes-Tr; EBT00001760190.
DR   EnsemblGenomes-Tr; EBT00001760191.
DR   EnsemblGenomes-Tr; EBT00001760192.
DR   EnsemblGenomes-Tr; EBT00001760193.
DR   EuropePMC; PMC1855645; 17293531.
DR   EuropePMC; PMC1951845; 17496087.
DR   EuropePMC; PMC2672173; 19415112.
DR   EuropePMC; PMC3152330; 21478170.
DR   EuropePMC; PMC331404; 14718065.
DR   EuropePMC; PMC5635168; 28675659.
DR   EuropePMC; PMC94815; 11092850.
DR   GOA; P83589.
DR   GOA; Q46578.
DR   InterPro; IPR003664; FA_synthesis.
DR   InterPro; IPR012281; Phospholipid_synth_PlsX-like.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF01053; Deinococcus_Y_RNA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE000513.
DR   SILVA-SSU; AE000513.
DR   StrainInfo; 681593; 0.
DR   UniProtKB/Swiss-Prot; P83589; HCDH_DEIRA.
DR   UniProtKB/Swiss-Prot; Q46578; PLSX_DEIRA.
XX
CC   On or before Dec 28, 2005 this sequence version replaced
CC   gi:6457659, gi:6457669, gi:6457680, gi:6457693, gi:6457707,
CC   gi:6457721, gi:6457732, gi:6457740, gi:6457750, gi:6457764,
CC   gi:6457778, gi:6457790, gi:6457800, gi:6457811, gi:6457820,
CC   gi:6457832, gi:6457844, gi:6457853, gi:6457865, gi:6457878,
CC   gi:6457890, gi:6457902, gi:6457921, gi:6457928, gi:6457936,
CC   gi:6457944, gi:6457959, gi:6457973, gi:6457982, gi:6458001,
CC   gi:6458011, gi:6458024, gi:6458032, gi:6458045, gi:6458057,
CC   gi:6458070, gi:6458079, gi:6458087, gi:6458103, gi:6458116,
CC   gi:6458129, gi:6458144, gi:6458151, gi:6458162, gi:6458174,
CC   gi:6458188, gi:6458198, gi:6458217, gi:6458228, gi:6458240,
CC   gi:6458253, gi:6458262, gi:6458271, gi:6458281, gi:6458294,
CC   gi:6458307, gi:6458318, gi:6458330, gi:6458343, gi:6458357,
CC   gi:6458372, gi:6458383, gi:6458395, gi:6458409, gi:6458421,
CC   gi:6458437, gi:6458450, gi:6458461, gi:6458481, gi:6458490,
CC   gi:6458504, gi:6458517, gi:6458528, gi:6458542, gi:6458553,
CC   gi:6458563, gi:6458577, gi:6458589, gi:6458611, gi:6458624,
CC   gi:6458634, gi:6458642, gi:6458655, gi:6458665, gi:6458680,
CC   gi:6458691, gi:6458699, gi:6458712, gi:6458725, gi:6458740,
CC   gi:6458751, gi:6458764, gi:6458776, gi:6458790, gi:6458805,
CC   gi:6458820, gi:6458833, gi:6458843, gi:6458855, gi:6458869,
CC   gi:6458881, gi:6458892, gi:6458905, gi:6458915, gi:6458930,
CC   gi:6458941, gi:6458956, gi:6458972, gi:6458983, gi:6459001,
CC   gi:6459010, gi:6459022, gi:6459034, gi:6459045, gi:6459059,
CC   gi:6459074, gi:6459086, gi:6459097, gi:6459109, gi:6459123,
CC   gi:6459135, gi:6459149, gi:6459162, gi:6459180, gi:6459193,
CC   gi:6459202, gi:6459214, gi:6459223, gi:6459233, gi:6459244,
CC   gi:6459259, gi:6459271, gi:6459282, gi:6459292, gi:6459302,
CC   gi:6459316, gi:6459325, gi:6459336, gi:6459345, gi:6459358,
CC   gi:6459366, gi:6459377, gi:6459394, gi:6459402, gi:6459414,
CC   gi:6459430, gi:6459448, gi:6459461, gi:6459473, gi:6459484,
CC   gi:6459494, gi:6459504, gi:6459515, gi:6459527, gi:6459537,
CC   gi:6459547, gi:6459562, gi:6459573, gi:6459590, gi:6459602,
CC   gi:6459614, gi:6459627, gi:6459639, gi:6459655, gi:6459667,
CC   gi:6459681, gi:6459692, gi:6459703, gi:6459715, gi:6459726,
CC   gi:6459742, gi:6459753, gi:6459766, gi:6459777, gi:6459790,
CC   gi:6459810, gi:6459824, gi:6459838, gi:6459848, gi:6459859,
CC   gi:6459872, gi:6459886, gi:6459901, gi:6459915, gi:6459929,
CC   gi:6459945, gi:6459965, gi:6459976, gi:6459990, gi:6459999,
CC   gi:6460010, gi:6460024, gi:6460037, gi:6460050, gi:6460059,
CC   gi:6460070, gi:6460082, gi:6460095, gi:6460110, gi:6460121,
CC   gi:6460134, gi:6460149, gi:6460163, gi:6460176, gi:6460186,
CC   gi:6460196, gi:6460209, gi:6460218, gi:6460231, gi:6460244,
CC   gi:6460257, gi:6460272, gi:6460285, gi:6460295, gi:6460306,
CC   gi:6460315, gi:6460327, gi:6460337, gi:6460347, gi:6460360,
CC   gi:6460372, gi:6460383, gi:6460395, gi:6460405, gi:6460412,
CC   gi:6460427, gi:6460435, gi:6460446, gi:6460455.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2648638
FT                   /organism="Deinococcus radiodurans R1"
FT                   /chromosome="1"
FT                   /strain="R1"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Deinococcus radiodurans"
FT                   /db_xref="taxon:243230"
FT   gene            complement(1..1182)
FT                   /locus_tag="DR_0001"
FT   CDS_pept        complement(1..1182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="similar to SP:P52851 PID:1321894 percent identity:
FT                   54.97; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09595"
FT                   /db_xref="GOA:Q9RYE8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:4TRT"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE8"
FT                   /protein_id="AAF09595.1"
FT                   /translation="MMKANVTKKTLNEGLGLLERVIPSRSSNPLLTALKVETSEGGLTL
FT                   SGTNLEIDLSCFVPAEVQQPENFVVPAHLFAQIVRNLGGELVELELSGQELSVRSGGSD
FT                   FKLQTGDIEAYPPLSFPAQADVSLDGGELSRAFSSVRYAASNEAFQAVFRGIKLEHHGE
FT                   SARVVASDGYRVAIRDFPASGDGKNLIIPARSVDELIRVLKDGEARFTYGDGMLTVTTD
FT                   RVKMNLKLLDGDFPDYERVIPKDIKLQVTLPATALKEAVNRVAVLADKNANNRVEFLVS
FT                   EGTLRLAAEGDYGRAQDTLSVTQGGTEQAMSLAFNARHVLDALGPIDGDAELLFSGSTS
FT                   PAIFRARRWGRRVYGGHGHAARLRGLLRPLRGMSALAHHPESSPPLEPRPEFA"
FT   gene            complement(1904..3268)
FT                   /locus_tag="DR_0002"
FT   CDS_pept        complement(1904..3268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0002"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="similar to GB:D26185 SP:P05648 GB:X02369 GB:X12778
FT                   PID:40014 percent identity: 67.12; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09596"
FT                   /db_xref="GOA:Q9RYE7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYE7"
FT                   /protein_id="AAF09596.1"
FT                   /translation="MRKNVSDLEYTTWFAPVKPLGVQEGSLLLGVRNSFTKDWFRDHYL
FT                   ELLLAALRSLGAEHPQVEFQVLPAAQDALLLPNDPPPAPEAAAPTPKTKAAPTPPPSTP
FT                   GDNRKTLNPKYTFENFVVGPNNNLAHAAALAVAESPGKAYNPLFIYGDVGLGKTHLMHA
FT                   VGHYLAERFPEKRIEYVSTETFTNELINAIRDDKTTQFRNRYRSVDLLLVDDIQFLAGK
FT                   ERTQEEFFHTFNALYESNKQIILSSDRPPKDIQTLEGRLRSRFEWGLITDIQSPEYETR
FT                   VAILKMNAEQGHITIPQEVLELIARQVTSNIRELEGALMRVVAFASLNNVPFSRAAAAK
FT                   ALSNVFAPQEAKVEMTDVLRQVAAHYGTTPDLIRGSGRARDIVVPRQVAQYLIRALTDH
FT                   SLPEIGQFFGRDHSTVMHAVSKITEQMGKDPELAATVNTLRNRIQGKEEEEEVGA"
FT   gene            3412..4287
FT                   /locus_tag="DR_0003"
FT   CDS_pept        3412..4287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0003"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09602"
FT                   /db_xref="GOA:Q9RYE6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYE6"
FT                   /protein_id="AAF09602.1"
FT                   /translation="MGTGDPSPLASQGPLPLVEGQKMKKPPPVRRGMNEAMEDRGSFFM
FT                   ALVSAYALHLARPFPALALAAGYLFVEGEDGCVAPRFAFLNGAGGHGVDVGQPQQFGAR
FT                   QAVAGGLDAAFLTYRRAVLAKDGAVADAAELTVDPALATVPGDGGEQFAPGASAFQSGS
FT                   EPAPGVRLGVALGNLGSHAHVALHGAGEQLPRPLLPAPGFGGVEGEGKRHEIGHAHGGL
FT                   GSGAEVAVRLGQAVFDQRRFPALGEPELLLGGGGVKQTVRADRQPHGAEIEGQRSVLHT
FT                   DILAQIMFLT"
FT   gene            4378..5430
FT                   /locus_tag="DR_0004"
FT   CDS_pept        4378..5430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0004"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GB:AE000666 percent identity: 56.14;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09597"
FT                   /db_xref="GOA:Q9RYE5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE5"
FT                   /protein_id="AAF09597.1"
FT                   /translation="MVVMSYLSELRAVWGHRALPAAGVSVLLQDETGRVLLQRRGDDGQ
FT                   WGILGGGLEPGEDFLIAAHRELLEETGLRCPNLRPLPLSEGLVSGPQFWHRYPNGDEVY
FT                   LVGLRTEGTVPAAALTDACPDDGGETLELRWFALDDLPPLNTNINRVSMNVLRARRGLP
FT                   PLPLLDVPSPPPPGDWLRDLRALVGSRPLIAPGANVAVTNERGEVLLLKHAGTGNTVTG
FT                   KWTLPGGSLEPGESFAECAARELHEETGLRASRLVPVELFAGAEYRFTSLNGDVIDNIS
FT                   VLFRAEDVQGELALDTAESHGAAWFAPDALPPADELSGPLIRAKVRRWQELEPSPNEGA
FT                   CPGAAPHRLC"
FT   gene            5438..6115
FT                   /locus_tag="DR_0005"
FT   CDS_pept        5438..6115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000666 percent identity: 54.66;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09598"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE4"
FT                   /protein_id="AAF09598.1"
FT                   /translation="MSAVIHLQALGLTEYEARAYTALLALGRAVPARVARQAGIPRPKI
FT                   YETLERLEGRGLSAKVGQNPLEYAPLSAREYLSRSRRSFDDRLAALDRDLSRLAPDPAP
FT                   EAVYHLNGEAAIRSLAEDLVLNARRCVYLAGEQSLAERLERLTPRGVELLRADLSDLPP
FT                   IAAQGQRAFLLARDTEAALVGHFIAEGESGEAHGVHTHNPVIVHLIEGYVKLAAQKAVQ
FT                   NRS"
FT   gene            complement(6162..6944)
FT                   /locus_tag="DR_0006"
FT   CDS_pept        complement(6162..6944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000782 percent identity: 64.04;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09599"
FT                   /db_xref="GOA:Q9RYE3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYE3"
FT                   /protein_id="AAF09599.1"
FT                   /translation="MKRLRSGGGDKRAQHPHAVAPPHSYSGVPGGNLMLKIRSLGHSTF
FT                   FLDDGTHRLLIEPFLEGNPRCPVTLGEVQSWQPSAVLISHAHGDHWGNALDFGRAGVPI
FT                   IATAEIAGYAGAHGANNAVGMNIGGTYRAEWGSVSLTPAWHSSSFPDGTYGGMPTGLVI
FT                   EFGGQRLYFAGDTALFSDMRLIGDRELDLAFLPIGDHYTMGPEEAGRTLDLLRPRVAIP
FT                   MHYATFPALTGDPAVFRTEGERRGVEVRVLDPGETTEL"
FT   gene            6986..7822
FT                   /locus_tag="DR_0007"
FT   CDS_pept        6986..7822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 68.67;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09600"
FT                   /db_xref="GOA:Q9RYE2"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE2"
FT                   /protein_id="AAF09600.1"
FT                   /translation="MPVGDRRSLLPLTTLSSLNLLGITLRDLLDILLVAALLYQGYKLV
FT                   VGTRAVNVLRGIMVFAGVWVAARLLGLVTLTDLLGRAGTVGLFALVVLFQPELRAALER
FT                   VGRPRGAAERDGAALQDLARALERLAERKTGALVAIERRTPLGEYAATGVPLDAVVSVP
FT                   FIEALFVRNAPLHDGGVILQGARIVAAGCLFPLQASDGTYRRYGTRHRAAIGLSEVTDA
FT                   VVLIVSEERGSMRIALNGRLGPDLTPTELREQLRELVYEREALSPLPAVPAPEGRP"
FT   gene            7819..8859
FT                   /locus_tag="DR_0008"
FT   CDS_pept        7819..8859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09603"
FT                   /db_xref="GOA:Q9RYE1"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE1"
FT                   /protein_id="AAF09603.1"
FT                   /translation="MSGGEAQGKRKQWQRWLSPRYVWRRLRHNIGPKLVSLGAALVLWS
FT                   VSTGDQRAQVQQSYDVPITVRDTTGASGSDERRAVSDLNPETVRVTLTGRPERLNELRP
FT                   SNIEALLDVTGVPEGSFNRPVQIVAPSNTVLSKQVPERVQGFVDSELSRTLTVTLGVAS
FT                   PAENSLPRFEVRPSEVQATAPSRVLNQVTRVVTSPVDLDPGEEREAPLIALDSRGRVVE
FT                   PVTLHPASVSVQRLDTGTLPVKTLPVVLGAPPASLRVQSQTLQPRTVRVVAAPELLGRL
FT                   REVSGQVDYRVGSSTLPVTLRLPDGAQALETVSVSLVVERIKAPDPGAGAPTQQKSGAS
FT                   SSSGGN"
FT   gene            8925..10283
FT                   /locus_tag="DR_0009"
FT   CDS_pept        8925..10283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 55.07;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09601"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE0"
FT                   /protein_id="AAF09601.1"
FT                   /translation="MTKFVSAPLICGLALLGALSAAHAQTGIPALPPIAQPLPVPAPAP
FT                   VTPPAPTVPVPQEPAPVPQPPMPQPSVPQTPAPQKPVTPRPAPAPSRAPLLIQARANVP
FT                   ALVAGKKTTVPVLKTLTIPAERAAQLRQRGEVSASLQADLDTFLKSLAAPRDARFEQQD
FT                   DGQWAVVQPNGLKVDAQATRAAVAKVLRDPRGVSANVVVTGQVAPQRTLDFFASRGITT
FT                   FLATGFTSYYGSSPERVKNIHVGAQNFKDRLFEGDVFSFNKFIGPVSERNGYVPGLVIA
FT                   GDQTASGVGGGICQVSTTVFRTLYGAGLGIVQRQNHSYQVFYYDPQGLDATIYQPQLDL
FT                   KFANTTGGPIWFQTEWDDQEATLTITAFGQARDYQVQVDAPKTLKTVAPPKDRLIPDAS
FT                   LPAGQRKQVDWAAPGATIEVTRRFTRGGKTFKQDTLRSVYRPWPNIFRVGTKK"
FT   gene            10413..11663
FT                   /locus_tag="DR_0010"
FT                   /note="This region contains an authentic point mutation,
FT                   causing a premature stop, and is not the result of a
FT                   sequencing artifact; similar to PID:2257467 percent
FT                   identity: 94.06; identified by sequence similarity;
FT                   putative;transposase, putative"
FT   gene            complement(11855..12736)
FT                   /locus_tag="DR_0011"
FT   CDS_pept        complement(11855..12736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:U14003 SP:P39315 PID:537052 GB:U00096
FT                   PID:1790656 percent identity: 71.94; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09604"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYD9"
FT                   /protein_id="AAF09604.1"
FT                   /translation="MNSTSSPTIAVTAATGKLGQLVVSSLLERGVPADHIVAIVRNPAK
FT                   AQGLFAPGVQIRQADYNSPEGWDRALAGVQRLLLISSSDLNDRADQHRTVIEAASAAGV
FT                   ELLAYTSLLKADTARMSLAADHQATEKLLTESGVPFVLLRNGWYLENYDLAQALQTGSV
FT                   LGAAGTGRISAASRKDLAEAAAAALTRDGQAGKVYELAGDEAFSLSELAAELSKQSGKD
FT                   VQYRNFAPEDYQRTLEGFGLPAPVAQMLVSSDEGVARGELELPNSDLRELIGRPSTSLK
FT                   EAVASQLAGQQA"
FT   gene            complement(13333..14199)
FT                   /locus_tag="DR_0012"
FT   CDS_pept        complement(13333..14199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0012"
FT                   /product="chromosome partitioning protein"
FT                   /note="similar to PID:1916915 percent identity: 62.50;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09605"
FT                   /db_xref="GOA:Q9RYD8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYD8"
FT                   /protein_id="AAF09605.1"
FT                   /translation="MSKKSSLGRGLDALLTKKGEPVAQAGTGTQVQTLKIERIAQAAYQ
FT                   PRQVFEPESLAELAQSIREKGVLQPLLVRPRGDAFEIVAGERRWRASQLAGLTELPVMI
FT                   RDLGDREALEIAIVENLQREDLGPLEEARAYQALLDQGLNQEGVAQAVGKGRSTVTNAL
FT                   RLLTLPEPVLRALDEGSISASHARAVLTQPEADRLWAFEQIRSRGLNVREAEALKRERG
FT                   GRDKGQGAPIKVNPPRAYRQLELDLSRRTGTRVKITGEDKGRVELNYGSREELDRILQI
FT                   LGYEAEE"
FT   gene            complement(14183..15073)
FT                   /locus_tag="DR_0013"
FT   CDS_pept        complement(14183..15073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0013"
FT                   /product="chromosome partitioning ATPase Soj"
FT                   /note="similar to GB:D26185 SP:P37522 PID:467381 PID:580906
FT                   GB:AL009126 percent identity: 70.08; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09606"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYD7"
FT                   /protein_id="AAF09606.1"
FT                   /translation="MTDHAGGDPAARHSENCSRLWTCAPLRGSNRQAPRRCAGGARSDR
FT                   RGMKTIGVVNQKGGVGKTTTAVNLGAYLAAGGRRVLVVDMDPQGNATSGLGQRGAEQGL
FT                   YEALGEPARSADFTLGTTQKGLDVLPATPDLAGAGVELADDPDALARLLASVQGYDLVL
FT                   VDAPPSLGPLTVNVLAAVDALLIPVQAEYYALEGLAGLMETVERVQGGLNPRLKVLGIV
FT                   LTMLDSRTNLAQEVETMVRQHFGELVFWSVVPRNVRLSEAPSFGKPINAFAPLSSGAAA
FT                   YKRLAEEVLQRVEKI"
FT   gene            complement(15101..15862)
FT                   /locus_tag="DR_0014"
FT   CDS_pept        complement(15101..15862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0014"
FT                   /product="gidB protein"
FT                   /note="similar to GB:D26185 SP:P25813 PID:40027 PID:467384
FT                   GB:AL009126 percent identity: 61.11; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09607"
FT                   /db_xref="GOA:Q9RYD6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYD6"
FT                   /protein_id="AAF09607.1"
FT                   /translation="MIPDALTPAGRELLRRGADDLGLDVAPHEEQFARLLALLRAGNER
FT                   LNLTALKTEEDIVLKHFVDSLTTLRGGHLDGEWKTLDLGTGAGFPALPLAILRPELRLT
FT                   PLDSIRKKIDFVRETAAELGLSNVTPQVGRAETLGQSAEHRGSYDRVVARAVAALPVLA
FT                   ELALPLLRVGGVFVAQKGPLSEEELDAGRRAAGEVGGRIIEVDPFTLPVSGDARTLIVL
FT                   EKQRPTPAKYPRREGVPTHQPLFWKAKEQSR"
FT   gene            complement(15859..16215)
FT                   /locus_tag="DR_0015"
FT   CDS_pept        complement(15859..16215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09611"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYD5"
FT                   /protein_id="AAF09611.1"
FT                   /translation="MGRARRGAHMTELNDFQRGLLLGILIGEGHFGGDGKQPHVTLRMH
FT                   TRHQRLFETLLGMFPESKLYGPYTHGGRSYFQWMMRGQTLRESLIPLLDELPLEQTDEH
FT                   AYERYQDMKRRYGL"
FT   gene            complement(16307..17047)
FT                   /locus_tag="DR_0016"
FT   CDS_pept        complement(16307..17047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 62.82;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09608"
FT                   /db_xref="GOA:Q9RYD4"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYD4"
FT                   /protein_id="AAF09608.1"
FT                   /translation="MDLSQARAALKAARRVAVLTGAGISAESGIPTFRDAQTGHWARFR
FT                   PEDLASPDAYRRDPDLVWEWYAGRYRDVLAAQPNRGHELLAELERRKGPGFFLATQNVD
FT                   GLHARAGSGSAGGELVELHGNLLQARDELTGEVFPLAAPDELTLPPLSPNGQRMRPHIV
FT                   WFGEYLPVDALDAAQRAFAGAEVALVIGTSSVVYPAAGLAAETLRRGGAVIEINPEATD
FT                   LTPDATFSLRESASRGLELLLEDD"
FT   gene            complement(17147..17557)
FT                   /locus_tag="DR_0017"
FT   CDS_pept        complement(17147..17557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:3582247 percent identity: 51.81;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09609"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYD3"
FT                   /protein_id="AAF09609.1"
FT                   /translation="MTGPGRFALQKLPTLYHPPMRPLPLPFPDETEAPLVTELRFPTSG
FT                   TTVRGVFELNEFATLTPENLEFLRLYIRVRGNLKEVERVLGLSYPTVRSRFDALLRAMG
FT                   YEPEAPDPQDEVLSQLERGELTPEEAARKLRR"
FT   gene            complement(17568..18185)
FT                   /locus_tag="DR_0018"
FT   CDS_pept        complement(17568..18185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09612"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYD2"
FT                   /protein_id="AAF09612.1"
FT                   /translation="MREDRMREKVVRLLGLVQAGRLTLDDAAPLLAALSPKLALEGSDR
FT                   ELLASLLARENLSAEQLAEHLLLLRGLRDPSPRTPQPGRGRPGGREAMTDRTAELVGRT
FT                   LDSAADSPQQHLNWGSPQPGPSARVLSVHTESSDGSEYHAHFPLSLAPHLHKLIPPHGV
FT                   RALEAAGFSLEALQLLIEADPPPGDLVTAEDSAGNEIQISIR"
FT   gene            complement(18182..19063)
FT                   /locus_tag="DR_0019"
FT   CDS_pept        complement(18182..19063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09613"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYD1"
FT                   /protein_id="AAF09613.1"
FT                   /translation="MNEEQHEQFRSQVEHLVATGKLTAEEAAELLDGLAGDEPGEPLNL
FT                   APLTAATDTPPNLHLDVTGYALHVVQDSAAPHPQLHVSEPGRVELTATPQGWQVREVKD
FT                   TARRGWLGGDWRNVRAVLTLPFAPRDVQAEVHGGQVALPGLGGELQITLHGGNVRTAAM
FT                   ASLSARIQGGNLSVGAVMGGTDLTVHGGNVSVAGSTALSARIHGGNLNWNGELASGEHQ
FT                   LKLHGGNARLALRPDSSLRVDARVTGGLFAADFATRKSGEFGSARYQGQLGDGAALLSC
FT                   QVAGGQIRLGTA"
FT   gene            19258..20643
FT                   /locus_tag="DR_0020"
FT   CDS_pept        19258..20643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0020"
FT                   /product="ribonuclease II family protein"
FT                   /note="similar to GB:AE000520 percent identity: 56.01;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09610"
FT                   /db_xref="GOA:Q9RYD0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040596"
FT                   /db_xref="PDB:2R7D"
FT                   /db_xref="PDB:2R7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYD0"
FT                   /protein_id="AAF09610.1"
FT                   /translation="MTQPELTPAQRTEVELLARGRADKSRVLRDLKLPETPEAAHALLL
FT                   RLGVWDEARTPYADRLRAALNAVELPVPDFDPAEERLDLTHLPTFAIDDEGNQDPDDAV
FT                   GVEDLGGGLTRLWVHVADVAALVAPDSPLDLEARARGATLYLPDRTIGMLPDELVAKAG
FT                   LGLHEVSPALSICLDLDPDGNAEAVDVLLTRVKVQRLAYQEAQARLEAGEEPFVTLARL
FT                   ARASRRLREGEGALSIDLPEVRVKADETGASVFPLPKPEMRTVVQECMTLAGWGTAIFA
FT                   DDNEIPLPFATQDYPTREVAGDTLPAMWARRKTLARTRFQPSPGPHHGMGLDLYAQATS
FT                   PMRRYLDLVVHQQLRAFLAGRDPLSSKVMAAHIAESQMNADATRQAERLSRRHHTLRFI
FT                   AAQPERVWDAVVVDRRGAQATLLIPDLAFDVQVNTPAAPGTALQVQFADIDLPQMRVRA
FT                   RSV"
FT   gene            20768..21034
FT                   /locus_tag="DR_0021"
FT   CDS_pept        20768..21034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09624"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC9"
FT                   /protein_id="AAF09624.1"
FT                   /translation="MTAASLPCDIVSLRMAHCRAEHAAGSRQYHLAVLHYRTCLEVAER
FT                   REDCRAMQFFALRLAECYDEMGLRTKAHSFRHLADADDTALLG"
FT   gene            complement(21162..21761)
FT                   /locus_tag="DR_0022"
FT   CDS_pept        complement(21162..21761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:2190953 percent identity: 53.09;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09614"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC8"
FT                   /protein_id="AAF09614.1"
FT                   /translation="MPHHVPLQAHLQDLRARVAPRGLDIPELDPAGGGVNSRILCLLEA
FT                   PGPQAAQSRGGSGFISMDNDDHTAHTMFQLIADSGVRREQLLLWNIVPWYVGDDHRIRG
FT                   VKQGEIQEGADLLAELIELLPELAVVVTLGRAAASGWARVKGRAVSRTVTLNSWHPSGQ
FT                   ALNGHPERYEHLLMTLRLAQQISEYRQSPFRPSWSS"
FT   gene            complement(21938..22010)
FT                   /locus_tag="DR_t01"
FT                   /note="tRNA-Phe-1"
FT   tRNA            complement(21938..22010)
FT                   /locus_tag="DR_t01"
FT                   /product="tRNA-Phe"
FT   gene            complement(22035..22107)
FT                   /locus_tag="DR_t02"
FT                   /note="tRNA-Asp-2"
FT   tRNA            complement(22035..22107)
FT                   /locus_tag="DR_t02"
FT                   /product="tRNA-Asp"
FT   gene            22233..22766
FT                   /locus_tag="DR_0023"
FT   CDS_pept        22233..22766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0023"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /note="similar to SP:P72157 PID:1621600 percent identity:
FT                   75.16; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09615"
FT                   /db_xref="GOA:Q9RYC7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC7"
FT                   /protein_id="AAF09615.1"
FT                   /translation="MSDLSADSASPRVGVVMGSRSDSETMQGALDLLSQLEIPYEVRVL
FT                   SAHRTPGLLSTYAARAERLGLACIIAGAGGAAHLPGMLAAFTRVPVLGVPVQSRALSGQ
FT                   DSLLSIVQMPAGVPVATFAIGQAGAKNAALFAAALLATTDAGVRTRLEAFRAAQTQAVL
FT                   DDPYFDGHPQAGTE"
FT   gene            22763..23875
FT                   /locus_tag="DR_0024"
FT   CDS_pept        22763..23875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0024"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /note="similar to SP:P72158 PID:1621601 percent identity:
FT                   59.05; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09616"
FT                   /db_xref="GOA:Q9RYC6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC6"
FT                   /protein_id="AAF09616.1"
FT                   /translation="MSDQPAATLGILGGGQLAQMLALAALPLGVQVRVLEPDAEAPARL
FT                   CAEHVHAPYTDPAGLDALAACDAVTLEFENVPVESLDALRGRVPVRPGAGLLARSKHRA
FT                   REKAALQEAGARTAPFVVIQREADLDGALDRVGGQGILKTSELGYDGKGQVRVASDTDL
FT                   RQGWAELGQVACILEGFVTFEREVSLAVARTADGRLAFGPLVENVHRDGILRTSVYPAA
FT                   VPDGTEARAREMARAVAEGWGLEGLLTLEFFQVPDGDLLVNEVAPRVHNSGHLTQDGGG
FT                   ASQFEAQVRAVLGLPLSDWSPLLPCAMVNYVGVEGAAPDWAAIDALPGTRVHLYHKAHR
FT                   TGRKLGHVNLAAPDLPTLHQRLAQLEQLIP"
FT   gene            23983..25182
FT                   /locus_tag="DR_0025"
FT   CDS_pept        23983..25182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 53.97;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09617"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC5"
FT                   /protein_id="AAF09617.1"
FT                   /translation="MKRFLLPLLLTWPGAALAAQPAPQLALAQDLQLTFKGELKKIDDG
FT                   QLVTAPVTKSWTLPAKWVARSREYNKLSSYLTPYLDRVEKETFVRGRPAKFEQVGNKWV
FT                   ATDQPEWKLDRPATEAKLLEAIRTGATTLPVVFSEKVPQRSVALLAERGVMRNLASARS
FT                   SFTGSPDFRVKNIVVGSSKLDYQWVAPGEDFDFNKSMGDINAANGFVPGYIISGGTLAL
FT                   EDGGGICQVSTTIFRALWEAGLPIVERNQHSYRVHYYDPVGYEATVYAPSKNLRMKNDT
FT                   DAYIFIQASWNTATQKLRFDVFGPDTGRKTQISAPVVTDVKPAASPTFTPDKRVVLGQQ
FT                   RLLDQPMEGMTSVITRTVTFRDGTSQQDSIKSVYKPWGAVYGVHPSDPRLKQTEAQAKK
FT                   "
FT   gene            25273..26082
FT                   /locus_tag="DR_0026"
FT   CDS_pept        25273..26082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0026"
FT                   /product="methyltransferase, putative"
FT                   /note="similar to GB:L35560 GB:L37338 PID:532249 percent
FT                   identity: 53.75; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09618"
FT                   /db_xref="GOA:Q9RYC4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC4"
FT                   /protein_id="AAF09618.1"
FT                   /translation="MTTDQQRRAANARQFDRIAADYDALGFLTQAALALAAALDVPPTG
FT                   RVLDVATGTGTVALTLAPKVAEVMGTDIAPAMIEQARQRAAGRSNVQFVLAEATALTFA
FT                   DQSFDVVVCGAGLFFVPDMVAALREWRRVLRPGGEVVFSAFGRGLLGPLPGLWRERLAG
FT                   EGVKPGAPPLGRIGTVEAAKDLLIQAGFAEVTAELTPLPYTLATPADRWADIRAGLEGL
FT                   PLAQFTPEVQARLEDEHLAELQPLFAAGPLTVPILLIVARGRKAVSD"
FT   gene            complement(26166..27968)
FT                   /locus_tag="DR_0027"
FT   CDS_pept        complement(26166..27968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0027"
FT                   /product="gidA protein"
FT                   /note="similar to GB:D26185 SP:P25812 PID:40026 PID:467385
FT                   GB:AL009126 percent identity: 63.95; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09619"
FT                   /db_xref="GOA:Q9RYC3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYC3"
FT                   /protein_id="AAF09619.1"
FT                   /translation="MKGWNVIVIGGGHAGLEAAWAAAKFSRVALLVGNPATVGRMPCNP
FT                   AVGGPGKSQLVFEVQALGGLMGRLADDTAIHTRMLNASKGPAVQSLRVQNERDAYAERA
FT                   QDVIFGHSEIEIVRGEAADLEQDGQGGWVVVTSDGRRLHARSVVLAAGTFMRGVTWYGR
FT                   QSRPEGRQGEPPSRFLSAPLERGGHVLKRYKTGTPPRVRADSVRFADLLEIPADPQPRG
FT                   FTGTPGPRAAESPTWQTHTTPQTHALIQENLHESPMYAGDIEGLGPRYCPSIEDKVVKF
FT                   AHHDRHLLFVEPDGVQTSEVYLQGFSSSLPPRLQDELVRTLPGFEQAVIQRYAYAVEYD
FT                   VVDSTELTLNLESKKLPGLFTAGQLNGTSGYEEAAAQGLVAGTAAARRSLGLDEQVIGR
FT                   ETSYLGVLLDDLVFKGSDEPYRMMTSRVEHRLLVRQDNADERMTPIGHALGLVDDAELI
FT                   RVQEKYARVQSGIKSLSKQRMQGQTADAWLRRPELSLADVETLGATLPAELGASEREAV
FT                   EIRVKYAGYIARAESQLRSEAKARELSLSGVNFAGITALSNEAREKLTRLQPQTVEQAS
FT                   RISGVRHADISALLVHLKGQRVGS"
FT   gene            28040..29674
FT                   /locus_tag="DR_0028"
FT   CDS_pept        28040..29674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0028"
FT                   /product="aminotransferase, putative"
FT                   /note="similar to GB:AE000511 PID:2313511 percent identity:
FT                   58.47; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09620"
FT                   /db_xref="GOA:Q9RYC2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC2"
FT                   /protein_id="AAF09620.1"
FT                   /translation="MDLATLRAHNSGMDFASLRADLIGSEAVIRTPFGERRVTYADYVA
FT                   SGRALRSVEDQVRRLALPLYANTHTEDSATGAHSTHLTHEAHEYVKAQLGADASCKLVF
FT                   CGSGSTAAVRRMQDILGLSVGCAHRLTVLDALPEHERPVVFVGPYEHHSNEVSWRETLA
FT                   EVVEIPLCARGNLDLDALITALKDPRYARRPKIGSFSAASNVTGLLTDTRTVARILHRH
FT                   GAYAFFDFAASAPYVAIDMKPGQPDGYDAVFLSPHKFVGGPGTPGLLCFRAELYRLSSP
FT                   STAGGGTVRYVSRTKHTFVDDIEAREDAGTPAILGKIRTALAFRVKEELGVRALTEREH
FT                   ELFGRAVTRLGIHPRVQLLGNPDAPRLAFLSFLVKAEDGTYLHPRFVVRLLNDLFGIQA
FT                   RGGCACAGPYGHALLDIDDERSERYFQCVMSDLDGLKPGWTRLNLAPWATDEEVDFLLS
FT                   AIEFVAEHGEKFLPLYDFDWKTGAWTHPQDAAPPSLFGDAVPQRGRGEVPYAAYLREAA
FT                   ERAQMLNVAARRPIPEQVPGDLVFFAY"
FT   gene            29796..30941
FT                   /locus_tag="DR_0029"
FT   CDS_pept        29796..30941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0029"
FT                   /product="2-oxo acid dehydrogenase, E1 component, alpha
FT                   subunit"
FT                   /note="similar to SP:P11960 PID:203121 percent identity:
FT                   55.26; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09621"
FT                   /db_xref="GOA:Q9RYC1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC1"
FT                   /protein_id="AAF09621.1"
FT                   /translation="MPPAVRVPGGLKFMIQPFTADPIRFVAEDGRPVLALPERYTPALL
FT                   RELHRLMLQGREFDRKLITLLRQGRTSFYSQASGMEATQIGLAKAIRAGHDWVWGYYRD
FT                   QVLGMGLGVPMFTLISQCLGSNTDECRGRQMPHHFSSRAHNFVSASSSIASQVPPAAGN
FT                   ARAQKYLGTDEITVVTFGDGATSEGDWHTGMNMAGAMQAPCLFVCENNQWAISTHIRHQ
FT                   TASENIHIKAKAYGMPGFYVDGNDVVAVMEVCHHAAEWVRAGNGPALVECLTYRVGSHS
FT                   NADADAEKSYRTRDEVNEWLGRDPIQRVENLLEHLGDPISAEERAGMIAEIHKQIDDDV
FT                   RRAEAAGYPDWRIMFEDVYSDMPDHLRQQAAMLREEQGGSA"
FT   gene            30938..31972
FT                   /locus_tag="DR_0030"
FT   CDS_pept        30938..31972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0030"
FT                   /product="2-oxo acid dehydrogenase, E1 component, beta
FT                   subunit"
FT                   /note="similar to GB:M97391 SP:P37941 PID:142612
FT                   PID:1303943 GB:AL009126 percent identity: 71.16; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09622"
FT                   /db_xref="GOA:Q9RYC0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC0"
FT                   /protein_id="AAF09622.1"
FT                   /translation="MTATQEKQAQGKQAGTEQPAVRTLNLIQAITEALADELERDPNVV
FT                   LFGEDVGARGGVFMATAGLQERFGKKRVFDTPLAEGSIVGAAVGMAVRGMRPIAEIQFA
FT                   DYIGPGFDQILSQAAKIRYRSGGQFSAPLVIRTPSGGGVKGGHHHSQSPEAYYCHMAGI
FT                   KVVMPSTPYDAKGLLKAAVRSDDPVMFFEPKRLYRAAKGEVPEHDYVVELGKAAIRREG
FT                   DDLSLIGYGGVMPDLERAADALAAEGISVEVIDLRSLVPWDRPLVLQSVEKTGRAVLVS
FT                   EAPRMANFMGEVAYTIQNEAFDSLSAPVQQVAGFDTPYPYIQDKIYLPGANRIVAACVK
FT                   ALNY"
FT   gene            32002..32244
FT                   /locus_tag="DR_0031"
FT   CDS_pept        32002..32244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09625"
FT                   /db_xref="GOA:Q9RYB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB9"
FT                   /protein_id="AAF09625.1"
FT                   /translation="MPDPLRPVLGLLGLVIGFGLYALAGRLAEPWQSVTLALLFALLGA
FT                   AAWGYAQGERWIHVLAGVLLAYALFRLLFPFLNPR"
FT   gene            32248..33825
FT                   /locus_tag="DR_0032"
FT   CDS_pept        32248..33825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0032"
FT                   /product="2-oxo acid dehydrogenase, E2 component"
FT                   /note="similar to GB:X53560 SP:P11961 PID:580909 percent
FT                   identity: 61.98; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09623"
FT                   /db_xref="GOA:Q9RYB8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB8"
FT                   /protein_id="AAF09623.1"
FT                   /translation="MKELLLPELAESVVEGEILKWLVEEGDAIALEQPLCEVMTDKVTV
FT                   ELPSPFEGTLHKRMANEGDVVAVHAVIALIDDGAGAGAGAIPSATQAIQDSAENPTTTE
FT                   VTLPAQAEEEREAMGGSIVEAGHIAKADDDSTSLFKTFANDEEVKVQGLGARSGSGAPG
FT                   SSTAGTGTLDRAPETAPASPTPATANGGRVLAVPAARQAARELGIDLAAVRGSGPNGRI
FT                   RVADVLAHQQSGQAQPQQTQPQQAAASQAVAPQPQAAAPAAPAPAGKLAAPSAHLPAPV
FT                   QYRTPKGYEDRETRVPLRGMRRAIANQMQASHLYTVRTLTVDEVNLTKLVEFRQRVKDE
FT                   AKAADVKLSYLPFIFKAITVALKKYPSLNTSFDEATQEIVQKSYYNLGMAVATEAGLTV
FT                   PVIRDVDRKSIFDLARDVVDLAGRANAGKLSPDELTGSSFSVTNIGSIGALFSFPIINV
FT                   PDAAIMGVHSIVKRPIVDEHDNITVAHMMYLSLSFDHRLIDGAEAARFCKEVIRLLENP
FT                   DRLMLEGF"
FT   gene            complement(33903..34376)
FT                   /locus_tag="DR_0033"
FT   CDS_pept        complement(33903..34376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:2181995 GB:AL123456 percent identity:
FT                   67.80; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09626"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB7"
FT                   /protein_id="AAF09626.1"
FT                   /translation="MVGMRGVERKTAELTLGPQGDIRTLPWAMRQNIAGTSPWEDTVGY
FT                   SRAVRVGNIVQVAGTTATVDGEVVGVGDAYWQTKVALGLIRQALEQAGARLEDVVRTRM
FT                   YVPDISRWEQVGRAHGEVFGAIRPAATMVQVAALIDPRHLVEIEAEAVLSCLS"
FT   gene            34348..34695
FT                   /locus_tag="DR_0034"
FT   CDS_pept        34348..34695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09632"
FT                   /db_xref="InterPro:IPR025438"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB6"
FT                   /protein_id="AAF09632.1"
FT                   /translation="MRSTPLMPTIRTAADLGLRLRTAADIPDLIGAAYGADSVILHADD
FT                   LAPEFLDLRSGLLGELFQKATNYRLPLALVLADTDAYGPRFSELALEHRQHPLICFFDS
FT                   EEAARAWLERV"
FT   gene            34829..36046
FT                   /locus_tag="DR_0035"
FT   CDS_pept        34829..36046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0035"
FT                   /product="adenylosuccinate synthase"
FT                   /note="similar to SP:P29726 GB:D26185 GB:M83690 PID:467328
FT                   GB:AL009126 percent identity: 66.50; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09627"
FT                   /db_xref="GOA:Q9RYB5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYB5"
FT                   /protein_id="AAF09627.1"
FT                   /translation="MPGIAIVGAQWGDEGKGKIVDFLAPEAEYVVRYQGGANAGHTVNA
FT                   KGKTFKLNLLPSGVLHEGATSILGDGMVIDPEKFIEERRNLMEGGLNPRLKISDRAHIV
FT                   LPHHKYVDGRKDFVGTTGKGIGPAYADRARRVGIRFGDLLDEGVLRERIERLLEAKPNS
FT                   TRDAGWATVEDGLKSLAPIREQLAPFIADTGSELRQAIKDGRKVLFEGAQATLLDLNYG
FT                   TYPFVTSSHPTVGGILVGTGVNHKALHRVYGVAKAFNTRVGHGPFATEVHDEAGILRLR
FT                   GDGSQPWDEYGTTTGRPRRVGWLDLELLKYAVDVNGLDGLVINKMDILGGLDEIPVCTG
FT                   YDEGGQPVFKKMKGWSSTDGVTSRATLPKEAQAYLDLIEDTVQCPVVIFSAGPEREKTY
FT                   GEVHWG"
FT   gene            36181..36831
FT                   /locus_tag="DR_0036"
FT   CDS_pept        36181..36831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0036"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="similar to SP:Q54769 percent identity: 77.22;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09628"
FT                   /db_xref="GOA:Q9RYB4"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYB4"
FT                   /protein_id="AAF09628.1"
FT                   /translation="MPQARGEGATPPTSLPNPSLKGVPLPDNPNNLEPLTREWLAAIGE
FT                   DPDREGLQRTPQRVAKAWAYMTEGYGQTLAQVVGEGVFAAEGSEMVIVKDIEFYSMCEH
FT                   HMLPFYGRAHVAYIPGTRILGLSKFARIVDLYSRRLQVQERITTQVADAVEELLAPKGV
FT                   AVLMEGIHLCMAMRGVQKQNSSTTTSAMRGLFRSDPRTRAEFMSAVQGTLRGR"
FT   gene            36859..37464
FT                   /locus_tag="DR_0037"
FT   CDS_pept        36859..37464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09633"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB3"
FT                   /protein_id="AAF09633.1"
FT                   /translation="MAPFCVCPYPDPMLAPFLLLTLAATSVPGKAPVPGAPALPYGQDL
FT                   RVPGSKASVRLEKDGMGTNISSLFLDEQYDTLGKTFVQFRCGEGGQLNFFLKTKVPLLS
FT                   EADLVSGRSPSLSYRVDGQQPRAFPGVLTRKSGDFDRFVLAVSDASDARFLAAFQAARK
FT                   KVELRVARTGGAAPLTLTFPVKGFREGLQVLAGCPALP"
FT   gene            37446..38756
FT                   /locus_tag="DR_0038"
FT   CDS_pept        37446..38756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0038"
FT                   /product="serine hydroxymethyltransferase"
FT                   /note="similar to PID:1652200 percent identity: 77.11;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09629"
FT                   /db_xref="GOA:Q9RYB2"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYB2"
FT                   /protein_id="AAF09629.1"
FT                   /translation="MPGVAVSRGPFFLDTPQSAGGRRLYHLFMTTADQPQAVRDDAVFD
FT                   LIAQEAERQRTGLELIASENFTSAAVREAQGSVLTNKYAEGYPGKRWYGGCEVVDQVEQ
FT                   LAIDRVKQLFNAEWANVQPHSGSSANLAVYNALIQPGDTVLGMDLSHGGHLTHGNKANF
FT                   SGMRYQMVAYQLDRETERIDMEEVRRLAHEHKPKMIIAGASAYSRVIDFAAFREIADEV
FT                   GALLFADIAHIAGLIAAGEHPNALPHAHVVASTTHKTLRGPRGGIILANDPEIAKQLDR
FT                   TVFPGYQGGPLEHVIAAKAVAFGEALRPEFKDYARQIIKNAQALAGEFQQKGYRVVSGG
FT                   TDNHLFLLDLRPQGLNGTKATRLLDANHITISKSTLPYDTEKILHGGGIRIGTPAVTTR
FT                   GMTEAHMTQVADLIDRALKGEDVQAKVHDFAGGFPLP"
FT   gene            38823..39977
FT                   /locus_tag="DR_0039"
FT   CDS_pept        38823..39977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 63.75;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09630"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB1"
FT                   /protein_id="AAF09630.1"
FT                   /translation="MLGGGTGLECPRMTPDASLSPQLPELAQLSPSQLTLRLTRLGLQA
FT                   PDLGSAMQPMLEALVVCTGAAGAGYFQWRDATLAYHARAAAGEMPAGPAMEAILAHGLP
FT                   GHLPLIGALSTAEDTLFIGDTRQEAVALGFPELGVLGLCAAPIRARDGELVGAILAHTF
FT                   TPSPWPEPDRVLIGNVTGTLSLLAARLHAEEREQAAHEGALRALGLSLEARDAETKGHT
FT                   DRVTRLAERLGERLGLDFDERRELRWGAYLHDLGKISLPDEILLYEGPLTAALRRQMQG
FT                   HVQEGVRLAGQLPFLPQSVLDVIGAHHERWDGAGYPLGLRGEEIPLPARIFAICDVYDA
FT                   LSSARPYKKAWERADTLAYLRAVSGEQFDPQVVTALLDLLDGEG"
FT   gene            complement(39999..40475)
FT                   /locus_tag="DR_0040"
FT   CDS_pept        complement(39999..40475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0040"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09634"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB0"
FT                   /protein_id="AAF09634.1"
FT                   /translation="MQGLTHAVKIGHTASLEQFSAFRAAEKSAPRHSLPQLARPKVTLW
FT                   TLPSTIGPMRPAYLSAARHLQLGREYAVGGESHRALTAYHSALDLLLTLPPEHTRDVLL
FT                   AHTHLAFYQTLALGNDADTGQAHLQLGVSYARTTRDPLARAIAEECLSGLEVVL"
FT   gene            40458..41036
FT                   /locus_tag="DR_0041"
FT   CDS_pept        40458..41036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09635"
FT                   /db_xref="GOA:Q9RYA9"
FT                   /db_xref="InterPro:IPR009168"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA9"
FT                   /protein_id="AAF09635.1"
FT                   /translation="MREALQNSMSTWATLEVRGDQARVVPAPDLEQLIAELDRLAPQWS
FT                   LNWGCDAASPYVVRARLDVAGVSREGLAQAPTLSDAKLAALAELARLFGISGGEGRWVD
FT                   YDPEDGPNVADLDAERELPTSPRTSALPPEPPRDPQMDKARRHIDELLEQLKAAGKGGE
FT                   ATRILMRGYGETVDESRALYKQLKAILDQ"
FT   gene            41050..41823
FT                   /locus_tag="DR_0042"
FT   CDS_pept        41050..41823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09636"
FT                   /db_xref="GOA:Q9RYA8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA8"
FT                   /protein_id="AAF09636.1"
FT                   /translation="MHKFIAIGDVHAEWDTFWEALRAASCVDADGLPTPPVRLGRYQVV
FT                   VIGDLVHPKSPEAYTRLTGCDPFDMNDEDHRLIAAREQVRQLEKLQRYQAAAPHAVHVI
FT                   LGNHDDAVLDPRFVLGTSGGLKHVEFDPEHGGLLLPPPLHGWMSHFPRELRVGRLQFAH
FT                   VSPLPAHLYYDDLFYSDRSAKTWFRDTPDYVDMAGLVFGVYGHTKTDGGVLLHHAPTGQ
FT                   PLFAIIDALTEREYLEVLYDAAAEVPLRGVSVVPF"
FT   gene            41882..41954
FT                   /locus_tag="DR_t03"
FT                   /note="tRNA-Lys-2"
FT   tRNA            41882..41954
FT                   /locus_tag="DR_t03"
FT                   /product="tRNA-Lys"
FT   gene            complement(41990..42775)
FT                   /locus_tag="DR_0043"
FT   CDS_pept        complement(41990..42775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0043"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09637"
FT                   /db_xref="GOA:Q9RYA7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038764"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA7"
FT                   /protein_id="AAF09637.1"
FT                   /translation="MTVPGYVIRDVTDPQAMRELEDVQAAAWGFEDREVLPATMFRISA
FT                   ATGGIVLAAYRAEGGPAVGLAYGFPALGGLLGRELPGRGHDLWHHSHFLALRPEVRGSG
FT                   LAVALKLAQRGRALAQGLTRMTWTFDPLVARNARLNFGKLGVTASTYLPDWYAPHADRL
FT                   LVEWDLTRPHVPAPASPPLGTVVLRGVGARPGTPDLSADAPTVLAEVPLAVSDEERAPW
FT                   RLALRDTLTAYLGRGYRVTDLARESERAFYVLKRHPEGQ"
FT   gene            complement(42772..43899)
FT                   /locus_tag="DR_0044"
FT   CDS_pept        complement(42772..43899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0044"
FT                   /product="N-acylamino acid racemase"
FT                   /note="similar to GP:975627 percent identity: 63.19;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09631"
FT                   /db_xref="GOA:Q9RYA6"
FT                   /db_xref="InterPro:IPR010197"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:1R0M"
FT                   /db_xref="PDB:1XPY"
FT                   /db_xref="PDB:1XS2"
FT                   /db_xref="PDB:2FKP"
FT                   /db_xref="PDB:2GGG"
FT                   /db_xref="PDB:2GGH"
FT                   /db_xref="PDB:2GGI"
FT                   /db_xref="PDB:2GGJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA6"
FT                   /protein_id="AAF09631.1"
FT                   /translation="MAHTGRMFKIEAAEIVVARLPLKFRFETSFGVQTHKVVPLLILHG
FT                   EGVQGVAEGTMEARPMYREETIAGALDLLRGTFLPAILGQTFANPEAVADALGSYRGNR
FT                   MARAMVEMAAWDLWARTLGVPLGTLLGGHKEQVEVGVSLGIQAGEQATVDLVRKHVEQG
FT                   YRRIKLKIKPGWDVQPVRATREAFPDIRLTVDANSAYTLADAGRLRQLDEYDLTYIEQP
FT                   LAWDDLVDHAELARRIRTPLCLDESVASAADARKALALGAGGVINLKVARVGGHAESRR
FT                   VHDVAQSFGAPVWCGGMLESGIGRAHNIHLSTLPNFRLPGDTSSASRYWERDLIQEPLE
FT                   AVDGLMPVPQGPGTGVTLDREFLATVTEAQEEHRA"
FT   gene            43942..44520
FT                   /locus_tag="DR_0045"
FT   CDS_pept        43942..44520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09638"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA5"
FT                   /protein_id="AAF09638.1"
FT                   /translation="MTEPTLTVFAGEKRLLTGSLREVLTYLKVQEPAQVLIFDDQTGRP
FT                   RDFDLSGSLEDVLARELPGAPAGSLKPGRPKLGVVAREITLLPRHWAWLEAQPGGASAA
FT                   LRRLIDEERRRHPGAEAASQAQAAADRFLSAGWGDLPGYEDASRALYARDEARFLALSE
FT                   GWPADVRAHALGLAAPAFAPQGTVADDEA"
FT   gene            44596..45102
FT                   /locus_tag="DR_0046"
FT   CDS_pept        44596..45102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:1575691 percent identity: 47.58;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09639"
FT                   /db_xref="InterPro:IPR004830"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA4"
FT                   /protein_id="AAF09639.1"
FT                   /translation="MAGHPNTPPETLAALGAEFPAEVLGNPALPLLRLAQPGLLARWPV
FT                   RTLEALAAAPAAPVWLLRLAAAHEKIDVQLAAVTRPDLPGDVLLKLSHSPFWTIREAVA
FT                   RKPQLPPGVLGQLGHDLDYGVRLSVANRSDLSRELRGALRRDPHPLVRAVVILGEPQVS
FT                   ELSLS"
FT   gene            45124..45321
FT                   /locus_tag="DR_0047"
FT   CDS_pept        45124..45321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09649"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA3"
FT                   /protein_id="AAF09649.1"
FT                   /translation="MTPEFLRRRNALWAKLRSLPPGSPEFETVLGDLAQLIGWDRPRIL
FT                   AGLGLNEPDSESNMSPGERP"
FT   gene            45318..46082
FT                   /locus_tag="DR_0048"
FT   CDS_pept        45318..46082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:U00096 SP:P75839 PID:1787135 percent
FT                   identity: 58.18; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09640"
FT                   /db_xref="GOA:Q9RYA2"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA2"
FT                   /protein_id="AAF09640.1"
FT                   /translation="MSSGGGAQAVQSLDWQRMFLGDYDLLFYVEIVIRTLIILVWLLAL
FT                   LRVAGKRGVSQLSPLELAIVIGLGSAVGDAMFYAEVPLVHAMLVMALVVGFQRLVAHLI
FT                   ISQEKVETFLEGTPVELVRDGVMQLGGLKRSALSYEDLFERLRPEGVRQLGQVQRAYFE
FT                   QDGQLSVFCHPDGKAPPGLPIVPPWDLEVPAPPPDHYAGLLACLRCGRIHEQSAEELPV
FT                   PCGCGGTAWTPAVLDSLSGDAGQDKSRDKRGD"
FT   gene            46123..47349
FT                   /locus_tag="DR_0049"
FT   CDS_pept        46123..47349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:U00096 PID:1787201 percent identity:
FT                   51.40; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09641"
FT                   /db_xref="GOA:Q9RYA1"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA1"
FT                   /protein_id="AAF09641.1"
FT                   /translation="MSAPASSAPRLRLRVSKAAELHIRDGHPWVYESSVREQNREGEPG
FT                   ELAVVYDRRDRFLAIGLYDPFSPLRLRVLHTGMPTQLDDAWWAARLDAALARRAALFGP
FT                   LTAFGDTDGYRVLNGESDGFPGLVVDRYAGVLVMKLYTAAWFPHLRRMLELFAARAPDF
FT                   AVVLRLSRNIAERAADLGLHDGQVIYGELAGDSVVFRESGLRFEAEVRQGQKTGFFLDQ
FT                   RENRRRVEGLSEGRRVLNAFSFSGGFSLYAARGGASEVTSLDISAHALRSAERNFALNP
FT                   ELSAVHKTVQADVFEWLPAGKGSGADYDLVILDPPSLARREAEREGAIRAYGKLAEGGL
FT                   TRLAPGGILVSASCSAHVSAEEFEEAVMSAVRRSGRRWRKLLSSRHAPDHHASFAEAEY
FT                   LKAVFLQMD"
FT   gene            complement(47370..47891)
FT                   /locus_tag="DR_0050"
FT   CDS_pept        complement(47370..47891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09651"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA0"
FT                   /protein_id="AAF09651.1"
FT                   /translation="MPNNTNIDLLLESFRRNGRVNDTLLAALTPADLDLSDGRGGWTVG
FT                   QHLGHLAHFRPGWLSAISPADAEGIPDVIEGTWQKFDLSERDLSKLAEAFRLGDEAALR
FT                   AVQSALAEGRTFPDPHSEGTYQSNPAHFLQHIIVHDSHHRGQVLSLLRLGGRTPEQMDA
FT                   LDDHWAIWRE"
FT   gene            complement(47912..48268)
FT                   /locus_tag="DR_0051"
FT   CDS_pept        complement(47912..48268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0051"
FT                   /product="HesB/YadR/YfhF family protein"
FT                   /note="similar to GB:L42023 SP:P45344 PID:1008789
FT                   PID:1205952 PID:1221876 percent identity: 50.62; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09642"
FT                   /db_xref="GOA:Q9RY99"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY99"
FT                   /protein_id="AAF09642.1"
FT                   /translation="MTPAAREQICALGGVLRISLEPGGCCGTAYAFALTRQENDMVFSE
FT                   ESVELRFSPEAASVLYGATLDYGDRLKPPRFRVLNNPNTPLRCACNRSFGQPFPGRATP
FT                   DCRASCPMPWKARP"
FT   gene            complement(48296..49051)
FT                   /locus_tag="DR_0052"
FT   CDS_pept        complement(48296..49051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09650"
FT                   /db_xref="GOA:Q9RY98"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY98"
FT                   /protein_id="AAF09650.1"
FT                   /translation="MPSLQVCLNGARSQAEHPAVPHTPAELTRDVAQLFAAGARAFHLH
FT                   VYRGGQQTLAPEAVADTLHAIRAVCPDAELAISTAEGIAATPAERARLVAGWTAWPDTL
FT                   CVNLSETGIDDVLALAEARGVALEAGLWTPADVQKFRTLQHLSWRRVLLEPLSGDPDTA
FT                   HAELTILLGALNDFRPDLPRLAHGIDDATWPLLRRAAALGFESRIGFEDVLTLPDQSTP
FT                   AGNLDLYQAGRRLMRAGEAEASRLAHHRT"
FT   gene            complement(49054..49548)
FT                   /locus_tag="DR_0053"
FT   CDS_pept        complement(49054..49548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 48.99;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09643"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="PDB:6IZ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY97"
FT                   /protein_id="AAF09643.1"
FT                   /translation="MSDKLLLSPAELLAHWQGHRDLTRRVIEAFPEEGFAAHHAPDMRP
FT                   FQAMACELAGMVEYQLDWFRRGQPTWDENDQKKELPGRAELLAWWDKLTAELGAEVPQV
FT                   STEMWATPATTPFGKMSPLMSVMYLIDNEVHHRGQGYVYLRELGVTPPAFYERRNLPPL
FT                   G"
FT   gene            49657..49992
FT                   /locus_tag="DR_0054"
FT   CDS_pept        49657..49992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000782 percent identity: 55.86;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09644"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY96"
FT                   /protein_id="AAF09644.1"
FT                   /translation="MSDLKLVLHVSEADRWHAVLSNLVNLTALEDRPEVRVVVNGSAVY
FT                   VLQGEHDQLAQMAKAAAAGVTFQICNNSLRAHDIPAANLPNWAQTVPAGVLALAEAQRG
FT                   GFAYIKP"
FT   gene            49989..50939
FT                   /locus_tag="DR_0055"
FT   CDS_pept        49989..50939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0055"
FT                   /product="repressor protein, putative"
FT                   /note="similar to PID:567887 percent identity: 54.84;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09645"
FT                   /db_xref="GOA:Q9RY95"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY95"
FT                   /protein_id="AAF09645.1"
FT                   /translation="MTYDPSLRVLTVLELLQAREEVTGAELARRLEVSPRTVQRYVARL
FT                   QDLGIPVEGRRGVGGAYRLKPGFRLPPLMFTGEEALALALGLRALQHLGLSDLLPAAEV
FT                   AGAKLSRTLPPELRDTVAALEQVAQLSVSPWVTSTDARLLTTLFQAAREGQRAELTYRS
FT                   GAAQHTEREVEVYRVVHVDGRWYAVGHCRLRGALRCFRLDRIETCRLREETFTPPADFD
FT                   ALAFLQQELPAAHPYEISVWLAAPPEHLRGAVSVWHTDLRAEEDGTRMTCQRENLHSFA
FT                   AFLLGVGVDFRVDSPPELREVLRTLAGRCQQAGEG"
FT   gene            51060..52361
FT                   /locus_tag="DR_0056"
FT   CDS_pept        51060..52361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0056"
FT                   /product="benzoate membrane transport protein, putative"
FT                   /note="similar to GB:M76990 SP:P07775 PID:141751 percent
FT                   identity: 61.68; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09646"
FT                   /db_xref="GOA:Q9RY94"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY94"
FT                   /protein_id="AAF09646.1"
FT                   /translation="MRVSFSVKCSRQAAKSSDCERRTLGNMTTLSPARRSFWQDTHPSA
FT                   VLAGLIAVVIGWAGPNVLIYSVQQAGHLSDAAAMSWLWGHAVITGIVGIYLSLRTRMPI
FT                   LSTWSTPGIALLVTALPGMPFAEAVGAFLVSAALVFLLGTFAPLTRAVQAIPTHLAAAL
FT                   NAAILLPFAFKAVQAFGTQPLLVGLMVVTYFLGRQFAPRWAVALVLLVGVAASALLGAW
FT                   HPAPVPLAPTVPQVVAPAFSVRAMLNLALPLTLLAFTGQFVPGFGVLKANGYEPAPGPI
FT                   LRACGVASAAAALVGCHNLTLGALLANIVSGPEAHPDAARRYTAAIWAGIFNILFGLFA
FT                   GTFLHLMGILPAEALAALAGLALLAATGGSLQAAFTPGQSASGRGAAQPGSLAAAVIIA
FT                   VTLSGVSFFGIGAAFWGILAGLAVHGLEGVRRAG"
FT   gene            complement(52370..52624)
FT                   /locus_tag="DR_0057"
FT   CDS_pept        complement(52370..52624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653216 percent identity: 56.00;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09647"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY93"
FT                   /protein_id="AAF09647.1"
FT                   /translation="MTPLPTLTLYHRPGCHLCEQAQTHLDELGFAYQLHDISGDAALTA
FT                   RHGDHIPVLALGDRVLLRGVLSRSRLSTLKLRLLREQEA"
FT   gene            complement(52646..54421)
FT                   /locus_tag="DR_0058"
FT   CDS_pept        complement(52646..54421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0058"
FT                   /product="serine/threonine protein kinase, putative"
FT                   /note="similar to PID:2078052 GB:AL123456 percent identity:
FT                   51.22; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09648"
FT                   /db_xref="GOA:Q9RY92"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY92"
FT                   /protein_id="AAF09648.1"
FT                   /translation="MGGSDVFFQDYEVLERVGIGGMGSVYRAKRRQDGRVVALKVPQEK
FT                   YLADAKFVKRFYREAEVLKRFTHPNIVRVYDYRMQAPEHYIAMEYLDGDSLEDLLERQP
FT                   FTFSESVQMLRAMSDALRHIHMQNVVHRDIKPANVMVLRGAFENGKLREGGIKLMDFGI
FT                   AVGKVLTRLTMPGARVGTPIYMAPEQAKGNRVDARSDVYSLGLLAYEMVTGVTAFRGSY
FT                   EAVVHQQVFEQPKPPKQVNLEVPGKLSDLILHMIEKDPALRPTLDEVIARIDAGVLEDE
FT                   VFNDPVALAVSTEEKGGTLRLLDLAGNLRVSLCDQGAQPGQLPLPPAAVTSDAQGHLYL
FT                   ALPEYQLGQGQRAQGQEASLIRKLGPQGEEELAFGSYGLHPGQLLRPVGVAVWQDQIYV
FT                   LDAETQFVSVFGPRGAFLFRFGGPGTGQGKFGRPATLKFGPDGQLYVLDCGNHEVQRFT
FT                   PRGEYVSRYAFRLDRNSEQLRGLDGLGVDPKGGVYIVDSVARKVRKIEPDGTPGSTFAL
FT                   ETLVGEPNDAPWLLEIAADGRIYAVRQGGQVLRLFSPAGDLITQRDMYAPLHAMALVQR
FT                   PAAALPAGAVLPAGD"
FT   gene            54831..55115
FT                   /locus_tag="DR_0059"
FT   CDS_pept        54831..55115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09656"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY91"
FT                   /protein_id="AAF09656.1"
FT                   /translation="MHVHHQHQQAQRGHRQHRDATQHPLAQPPEQQQEQRHHEQCQQQQ
FT                   QAHSARLQQRSRKSAGTGQQWGRERGNIGSQCTCPALQLTYTLTVFTSR"
FT   gene            55152..55580
FT                   /locus_tag="DR_0060"
FT   CDS_pept        55152..55580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0060"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09657"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY90"
FT                   /protein_id="AAF09657.1"
FT                   /translation="MPTSEPPSDLALAWLLELFEYQVGDLLAGREPRGGERSVRELRGH
FT                   LRQSACPPPLRRRLIQADRQYSAWWQARSQAQAGAPHHPPAPDWSAPATHNAEEAAAWA
FT                   ELRQLAWHADLMAELHAVDPAAAPGARAAHPARAVRGD"
FT   gene            55573..57009
FT                   /locus_tag="DR_0061"
FT   CDS_pept        55573..57009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0061"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09658"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY89"
FT                   /protein_id="AAF09658.1"
FT                   /translation="MTENAERAQRRLPTPFPVPGAGDVLVSLGNSEVVRQLARTLGDLL
FT                   LLPGGAAQVWQALDRVEDDPFPPQPGDDALFAQLAAIRQRGGSPHERAQLEEVLRAGAG
FT                   PQSALRADPRERPLLREAAQRIRRWLARRLARAPGQLPGTVPAHSVLYAQEEASALSAP
FT                   AAGDGLTLHLGGPDRLAHWQGLRLSWRSLGPNWQLLVQDETSQPVSGGQLALLRPDLPA
FT                   SERQLFLTVGGQQLQVLFSGDYVLLRRRADAAQTRHLARLAALGRACALLLLPAEQHGR
FT                   LRLARTLARRLRGDPPRADDPASGQVAFAQTPAECLAAARRSLQRLEPLLGRFSPAQVA
FT                   HEAQVAQALLHLPPHYAAQVQQAAEHAASAAEPLREAATDPLVGREAGPPVLPATGHFI
FT                   VFPLGPDPLEVRLPGDRLLTLRPDYRAELVAVLPGQAAVTVGDLLVLPLHDLSVVIARE
FT                   GSQVALCALLPRMLEAAAQA"
FT   gene            complement(57084..57154)
FT                   /locus_tag="DR_t04"
FT                   /note="tRNA-Gln-2"
FT   tRNA            complement(57084..57154)
FT                   /locus_tag="DR_t04"
FT                   /product="tRNA-Gln"
FT   gene            complement(57231..58217)
FT                   /locus_tag="DR_0062"
FT   CDS_pept        complement(57231..58217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0062"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to GB:L42023 SP:P44531 PID:1003156
FT                   PID:1222040 PID:1204385 percent identity: 67.34; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09652"
FT                   /db_xref="GOA:Q9RY88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY88"
FT                   /protein_id="AAF09652.1"
FT                   /translation="MTAAAPALSLRGLSKAFGAVQAVGDVSLEVQAGETLALLGPSGCG
FT                   KSTVLRSVAGLERPDAGQVLVGGRDVTALPPEARHLGLVFQDYALFPHLSVLDNVAYGP
FT                   RRRGSSRPDAAQQAREALALVGLSEHERRLPAQLSGGQQQRVALARALATRSPLLLLDE
FT                   PLSNLDEKLRSELRHDLRGLFGQLGAGVLLVTHDQREALALAHRVAVMRAGHVVQEGAA
FT                   ADLFARPATAWVAEFLGWTNVFAHPQVSGQALLVPESAVQLGAGGELLRVLSRQRSETG
FT                   ETVTLAHPLGPLTLSLSPREAAAASGDELRLTVPSAALLQVPDDREG"
FT   gene            complement(58272..59153)
FT                   /locus_tag="DR_0063"
FT   CDS_pept        complement(58272..59153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09659"
FT                   /db_xref="GOA:Q9RY87"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY87"
FT                   /protein_id="AAF09659.1"
FT                   /translation="MLLRRRAAAPPPSLKVIVDATADLSEADLARSGVWQLASVVRVGG
FT                   QSYSSTELSPERLLALIEAQGAAPVIEPPSVDAYEQVFRQALAQSDEVLSLHLSSRLSV
FT                   SFACGQEAARAFGSRVRVLDSPAGSYALGLQALRAARLAAGGHNAAAIVSALRAVQARQ
FT                   LMHFTVSDVRFMHLSGRITPVTAPLERSHDVQPIFRYHHGLVELTARAPDHEAAMRQLA
FT                   RSVTKFVTETLPEGARVAFLHSPGGEEGAERLRTLLSASGLTYEDAGTRSIGNHLLAVT
FT                   GPRATGVVAEPL"
FT   gene            complement(59243..60433)
FT                   /locus_tag="DR_0064"
FT   CDS_pept        complement(59243..60433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000511 PID:2313781 percent identity:
FT                   62.36; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09653"
FT                   /db_xref="GOA:Q9RY86"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY86"
FT                   /protein_id="AAF09653.1"
FT                   /translation="MTAAFPPLSPELGQLALDRAAQGERLGADELESLYHLPLPAVAAV
FT                   AHDLRMQRRDPDVVSFLIDRNINYTNICNVGCNFCAFYRTRRQSDSYTLDYEQISAKIR
FT                   ELEAVGGTRILLQGGVNPELGLDYYTGMLRHVKAHHPTIQIDAFSPEEVLFMEKSFGLS
FT                   LDDLLDTLMDAGLDGLPGAGGEILEDDVRQKAAPARIRSGDWFRIIDAAQRKGLYTIAT
FT                   MVIGFGETYAQRVSHLLKIRAQQDKAQREYGGNGFFGFALWTLQTEHTRLHGKAPGATA
FT                   HEYLQQLAVARIALDNLPNLQASWPAQGFKVGQAALYYGANDLGSTMLEENVVSAAAGH
FT                   DRHAATVRELIRIAVDAGFTPAIRNSRFEILSYPDVDAALGRLAANPEAERGVGAN"
FT   gene            60568..63186
FT                   /locus_tag="DR_0065"
FT   CDS_pept        60568..63186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0065"
FT                   /product="ATP-dependent helicase, putative"
FT                   /note="similar to GB:AE000666 percent identity: 52.53;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09654"
FT                   /db_xref="GOA:Q9RY85"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY85"
FT                   /protein_id="AAF09654.1"
FT                   /translation="MLPARSPYARLELFLRDILGAGATLLHEEEVREAQTVSAASLGWS
FT                   QAVQRGFGFSEVYAHQADTYRLMHAGKNVIITTPTASGKTGAFFPAVFERLEQKPEATA
FT                   LFVYPLVALGQDQRDKLRAFREKGGFGWDIAAFHGSAQPGDVFTGNVRMVTATPDKLHW
FT                   ALDKPAVRDFLRRLEFIVLDEAHTYRGGFGSEVAGMLRRLLDLARALGANPQVVLSTAT
FT                   IGNPAEFARELVGVEAEQVGESGAARHGKRYYLADHRGQPRRFWDSVVSASIHHDLKVL
FT                   AFFRGRSRAARLYSTYRSQSRYAPHVHLYMAGTSDREGRLSEFRRTKSGVMFATNALEA
FT                   GVDIGDLEVVIIDGYPGSRMAFRQMAGRAGRVAPGLVLYLPALNEQGVPQPVDAFYSNL
FT                   GNFRELLTGPLEKAVVEAGNPYLSPRHQARRNAEFRAAGLPALPRPGPSYWNLRGEGSA
FT                   TFAVIEEKDWQERGLRAFDAPLESPSQHYALTEKHEGAVFTLDGQGYKVLRWEDTARGT
FT                   AIIVEKHLAADLFTRGLYSTQVRPVKMGEWVRRGPLAYRHGEVVVQRIYTGYTVMRQVF
FT                   ERVCTGCDRDPAPLERVCANCGGRIQDRMQDQKLAEQLYDDPIELPPFRTSALEVGIDP
FT                   ARTERPTAVAHTLKHLLMKLIPERVACDEGDLAGAFREGHDAYFFLYDDWRGGLGVSRR
FT                   AFEQMDDLLRRAHVLATKTCCTSPHGCFECIAVSRCFSPLLPSGERRPTDKQATALFLQ
FT                   ELLGLQPAPAEAEVIPDVAPALPGDWPQQARELLDLHGLSLPEVSARLGIPSRELQRAV
FT                   NTTAPLRLAHAKFGEGILTQGSGSGDAREVLVYFPGHGYKRLLVKYAGLSVVQGQAAGR
FT                   R"
FT   gene            complement(63356..64147)
FT                   /locus_tag="DR_0066"
FT   CDS_pept        complement(63356..64147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0066"
FT                   /product="aminoglycoside 3`-phosphotransferase"
FT                   /note="similar to PID:953191 percent identity: 59.61;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09655"
FT                   /db_xref="GOA:Q9RY84"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY84"
FT                   /protein_id="AAF09655.1"
FT                   /translation="MMSDASLPALTLPPALRRVLPAARWERVTEGESGAGVWRSTRFVV
FT                   KVQSRTLYPASTLLQERERLRWFAGRLPVPQVVAYEDDGEQEYLAMTRLPGIAMSHPDA
FT                   ALHPERMVNLLARALRELHALPVRDCPFNMSLGVRLKLARERVAAGVVDESDFDEERQG
FT                   QSAVQVFNQLARTRPAEEDLVVTHGDACLPNVIVQGEYVEGLIDLGRAGIADRHMDLAL
FT                   AWRSTRRNLGATYAGMLLDLYGRELVDEGKLAYYQLLDELF"
FT   gene            64184..65113
FT                   /locus_tag="DR_0067"
FT   CDS_pept        64184..65113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY83"
FT                   /protein_id="AAF09660.1"
FT                   /translation="MKVGLLNSPAAPLTPYWAAYLKELGVPTQTPALGDAEALALGAQS
FT                   LPGESPVVQLALGRILALDRVDAALLPEWPAVAGDAWGEALSELLPRRISGLPILLPVP
FT                   ERTGELDALEAQAAALGLRLSQNPGGVRLALERVRLLAQPARTDLPALSRASRTTVAVI
FT                   GPRPLLQEPVLAAGLRPALEALDFYPVFSYEVPHADALRRAERMEQAHKVPAGERELFG
FT                   AASLLAGKGAVTGLVFVAPARDGATQAALQRIADKLHKPALHLTLDTPGADGPQAAWPE
FT                   LDAFAERLASGGRVRPANSPASDGESGA"
FT   gene            65110..65484
FT                   /locus_tag="DR_0068"
FT   CDS_pept        65110..65484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09661"
FT                   /db_xref="GOA:Q9RY82"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY82"
FT                   /protein_id="AAF09661.1"
FT                   /translation="MNFWRWLTTPDPHPGFTRPKLLKLAVRLFLFVLLATVLSSLLNLT
FT                   PLRPYLNTFWGSLLFVLLLYIPAARFLNIDTFMPRRFQTPPPQPGARAGQPATNTLDKR
FT                   REKNRYAGVRKSPPRMGGRR"
FT   gene            65586..65948
FT                   /locus_tag="DR_0069"
FT   CDS_pept        65586..65948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0069"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09666"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY81"
FT                   /protein_id="AAF09666.1"
FT                   /translation="MKWHGASQRKGTFRRVEPDGKDVKPVTTYTHTFVLIEDGRADEQK
FT                   QPFYTAEAGTPEEAEARAYAAYCRASDCLHQMTSKGPTLIECVHCGLQRRVTMPSLPAP
FT                   APARKPERRLFGLLRI"
FT   gene            66004..66603
FT                   /locus_tag="DR_0070"
FT   CDS_pept        66004..66603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09667"
FT                   /db_xref="GOA:Q9RY80"
FT                   /db_xref="InterPro:IPR024305"
FT                   /db_xref="PDB:4HQB"
FT                   /db_xref="PDB:4NOE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY80"
FT                   /protein_id="AAF09667.1"
FT                   /translation="MCYVIYVRRRQMLQIEFITDLGARVTVNVEHESRLLDVQRHYGRL
FT                   GWTSGEIPSGGYQFPIENEADFDWSLIGARKWKSPEGEELVIHRGHAYRRRELEAVDSR
FT                   KLKLPAAIKYSRGAKVSDPQHVREKADGDIEYVSLAIFRGGKRQERYAVPGGAAGNGQG
FT                   RPAPQGQPAQARPQATAARPAARPPVQPGQEEETPF"
FT   gene            complement(66759..68792)
FT                   /locus_tag="DR_0071"
FT   CDS_pept        complement(66759..68792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0071"
FT                   /product="peptidyl-prolyl cis-trans isomerse, putative,
FT                   PpiC family"
FT                   /note="similar to GB:U00096 SP:P77241 PID:1580712
FT                   PID:1773125 PID:1786645 percent identity: 48.44; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09662"
FT                   /db_xref="GOA:Q9RY79"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY79"
FT                   /protein_id="AAF09662.1"
FT                   /translation="MQAGRPAGCGARNRARRQAKQGESVNKKTAVNGLLIGLSVLLVAG
FT                   MAYQFTPNVGSLFNRQEGTPVIKVNGDAVTAEQLESARRASPLLADEPGSVLADDAKVY
FT                   LVSQAIDRGAVLSGLKDVQVSRADVNAEVQKVRESNKLTDNKAWTDALQSNGLTDASFR
FT                   TQVRQQLAYQRKTDELRKAVPAPTDAELKAYYDLNKSKYQAEPQIVGRQIVVTDKAKAQ
FT                   SLLAQARGGADFAVLASANSTENKDRGGALAPLDGNQPRPVLQAALPTAVGEAAFRLKN
FT                   GGLTDVIESGGKFYIVKVEKFLPGQPKTFEQAKTDVVSAVRQQKQNAALEKWSDDLRKN
FT                   AQVEYVDPTWKVENPTVASVAGHNIPYSDVVAQVMNNQQIAGLIGQLPAEQLPTLLNKT
FT                   FKPQVVQQLIQGYAAPNIAQKLGLSLSGSRQEIAQQLAAYGARDVKVSDADVQKYYREN
FT                   VKQYEVPASATLDEASFKDKNQAAAFRADWNGQGDFVTAASKAGGTVSERGQVSPTADQ
FT                   TTGAVSPLTAAAFGQNLRSVGAGSLTPVVPVGDRFSVGYVRDLVRPTTRPLSEVGDEIR
FT                   QGLLSSKQAEAGQAFLDKQVSALSPKNNLDQVLEAQAKPSRRRLPKPKRPRRRRRERRP
FT                   PQMRREAALPRHRPSPPKRRRPTKPQQSRHPPTPELEHLPEK"
FT   gene            68827..68906
FT                   /locus_tag="DR_t05"
FT                   /note="tRNA-Arg-4"
FT   tRNA            68827..68906
FT                   /locus_tag="DR_t05"
FT                   /product="tRNA-Arg"
FT   gene            69032..69571
FT                   /locus_tag="DR_0072"
FT   CDS_pept        69032..69571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09668"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY78"
FT                   /protein_id="AAF09668.1"
FT                   /translation="MGASFSVLPFVARPEDYYARMKRVLSALVLGAGLLTACRSPSAGA
FT                   DDLTTRVLFTANGSYDAQADQRGKVPGTAGLRRVEWRTRPPLGAQAVTVEYDGEQRPQG
FT                   WQMTVQQPPFAPADLAGPNGQAVQTKQGAGTLVRSGPLAGVLLLPGSTTPPAQLRLLTR
FT                   GYAVQHEPELLPAFGQ"
FT   gene            complement(69707..71875)
FT                   /locus_tag="DR_0073"
FT   CDS_pept        complement(69707..71875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0073"
FT                   /product="phosphate acetyltransferase"
FT                   /note="similar to SP:P39184 GB:U00096 PID:1359438
FT                   PID:1788635 PID:1799670 percent identity: 71.74; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09663"
FT                   /db_xref="GOA:Q9RY77"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY77"
FT                   /protein_id="AAF09663.1"
FT                   /translation="MAGPIPFFLPLSPPVPKESRMKTLFLAPTRNGVGLSSTALGLARA
FT                   LERQSLKVAFLKPIAQTYEPRTDDSVHFARAVAHLTTPDPIPLTRAEELLSQGGEEDLM
FT                   EQVIALAREAAGEGSDVLIAEGLALNERNVYAGTLNARLARNLEADTVLVSSLAGVTPA
FT                   ELADELEIAAQGYRRSDGSGLAGFVLNFAPRELDFGSLMAELRSRSRVLASGELPLLGV
FT                   VSLDPALRQLRTLDVARALDAEIINAGEAESRRVSSTVVTARSVPQMTNLFTSGALIVT
FT                   PADREDVIMAAALSHLSGTPLAGLMYTSGSAPEATIQQLCEVALTSSLPVLRVPTNSFE
FT                   TASRLVHLDFRVPHDDPRRMDRMLDYIADRLDTVPLGARLRAPGVAGERRLPPSAFRYE
FT                   LIQRARAANKRIVLPEGDEPRTVKAAIRCTEKGIARCVLLAPPEKVRQVAQGQGLELPE
FT                   GLEIIDPETVRGKYVAPMVELRKSKGLTEPQAEAQLEDSVVLGTMMLALGEVDGLVSGA
FT                   VHTTASTVRPALQLIKTAPGSSLVSSVFFMLMPEQVLVYGDAAINPDPNAQELADIAIQ
FT                   SADSAHAFGIPVRVAMLSYSTGESGSGEDVEKVKEATKLVRERRPELLVDGPLQYDAAS
FT                   VPSVGRSKAPDSPVAGRATVFIFPDLNTGNTTYKAVQRSAGVVAVGPMLQGLRKPVNDL
FT                   SRGALVDDIVYTIALTAIQATQSAADCG"
FT   gene            complement(71920..72513)
FT                   /locus_tag="DR_0074"
FT   CDS_pept        complement(71920..72513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0074"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="similar to GB:AL123456 percent identity: 58.21;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09664"
FT                   /db_xref="GOA:Q9RY76"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY76"
FT                   /protein_id="AAF09664.1"
FT                   /translation="MTVLPRRLSAQERRQQILDMAAGLFVERGFESVTVADLAHELQTS
FT                   RPTIYSYFPSTEAILDALLQQRLAGLLQRLDPLLASLRPESLTEQQSHVIEVVFRFLLG
FT                   EADTLRLLHSGGAPTFQARRHAFLSELGERLTLSPELLIRRDPELLLLLTTLLDSLAFR
FT                   AVTDPSLDAEQLSQSLNTFVVGGAQALREGRSAG"
FT   gene            72681..77084
FT                   /locus_tag="DR_0075"
FT   CDS_pept        72681..77084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:M97208 SP:P32399 PID:143047
FT                   PID:2226234 GB:AL009126 percent identity: 52.40; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09665"
FT                   /db_xref="GOA:Q9RY75"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY75"
FT                   /protein_id="AAF09665.1"
FT                   /translation="MSFIRDFQTLTPPERSLWRHPMMWLASAAIAIVPTLYSTIYLGST
FT                   IDPYGNLDQLPVGIVNLDRGTTERGKDYDLGKETVKKLFDDPKFNYVRYASEAEAQEAV
FT                   RRGDIYFNLTIPRDFSRRALSGDSAQHGLLKFYVSEGSSYFATRVASSFADTLSSELNK
FT                   SLGENRWEVVQDSLADVQKGFADIRTATRKLRDGATDLQEGTVKLRDGASDLADGANRA
FT                   ADGSRKLADGAGTLSSGVGRLTDGTVKLSDGLRQLEAAAPGETQLAPLRSGAGQLRTGS
FT                   ESLASGLGQLADGTDQLAAGAKKANGGAQQVAAGNKQLAAQLPQLQSGLTQLSSGADKL
FT                   AAGAKSANGGAQQVAGGNKQLAEQLPKLQGGLTQLSEGADKLAAGAKSANGGAQQVAGG
FT                   NKQLADQLPQLQSGLTQLSEGADKLAAGAKSANGGAQQVAAGNKQLADQLPQLQSGLGQ
FT                   LSEGADRLASGAKDANAGAQQVAAGNKQLAAQLPQLQSGLGQLSEGADRLASGAKGANA
FT                   GAQQVAAGNKQLATQLPQLQSGLGQLSEGADRLASGAKDANAGAQQVAAGNKQLATQLP
FT                   QLQSGLGQLSEGADRLASGANDANSGAKQIAAGNKQLADQLPQLQSGLGQLSEGADRLA
FT                   SGANDANAGAKQIAAGNRQLATQLPQLQSGLQQASAGADRLNTGAAELATGTLQLNDAV
FT                   KNQALLPGQLKQGVAKVNSGAMEVHSGTNTLSNALPQLEAGAGRAVTGASQLAEGADKL
FT                   AAGTAQLSEGATTLSSKLKEAGQGSTAAVQGVQQLSEGATRLAAGTAQLSEGAVTLSSK
FT                   LKEAQQGTTAAVQGAQQLGEGADKLAAGTAQLSEGANTLSSKLKEAQQGTTAAVQGAQQ
FT                   LGEGADKLAAGTAQLSEGATTLSSKLKEAQQGTTAAVQGAQQLGEGADKLAAGTAQLSE
FT                   GATTLSTKLKEAGQGSAAAVQGVQKLAAGSAQLASGTAQLESGSATLSAGLKTAQQGST
FT                   AASQGAQKLAAGSAQLASGTAQLESGSATLSAGLKTAQQGSTAASQGAQKLAAGSAQLA
FT                   SGTAQLESGSATLSAGLKTAQQGSTAASQGAQKLASGAEQVAGGTAQLESGSATLASKT
FT                   REAAQGAQTLSKGAGSLQGGVNQLVEGNLKIKSALGQITEKLPAQSDLDQLSSGASTLA
FT                   EKSGELANGLGDLKDGSRKLADGTADVDDGAVKLRNGLRELYSKLPKSTEELGGDPEGL
FT                   SASVKPVTRKFAPVKNNGAAFAPYFMALSLWVGATLSTFIFPYQQLARSAHRTSQLARV
FT                   ARKGLQPAVLVIVQALLVVWGVHLLGVDYLNPLQVTATAVTSSMVFLTLVMGLIFLFGA
FT                   AGRLFALILLVLQLAASGGSYPVELSPAFFQHIHRWIPVTQSVNAFRHSISGAYEGQYL
FT                   NFMLVLLSIGVGGVILTLLGRRRWDFVRDRDFKPLINLPLSYHDLPPEDEEETPPPPAA
FT                   PRSPSV"
FT   gene            77159..78364
FT                   /locus_tag="DR_0076"
FT   CDS_pept        77159..78364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0076"
FT                   /product="molybdopterin biosynthesis MoeA"
FT                   /note="similar to GB:M21151 SP:P12281 PID:145539 GB:U00096
FT                   PID:1651376 percent identity: 60.05; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09669"
FT                   /db_xref="GOA:Q9RY74"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY74"
FT                   /protein_id="AAF09669.1"
FT                   /translation="MTAPTFPMHVSVAQARELFAALLPAPPVVTLPLRKALGCTLGADL
FT                   TALVSHPSATESALDGIACREADTLTASAGAPVALRVVGESRAGEPFAGEVGPGECVRI
FT                   YTGAPLPPGTDAICPVEQLREGEGTSAVERGTVELLRPARPGDVRPEGGDFHAGETVMS
FT                   AGLRLTPARLALAAALGHAQVPVRRWRVALLSTGDEVVAPGQPLAPGQVYDSNRVGLAA
FT                   LLTEAGYEVLDLGHAPDSPAALRERLGAAGGADLLLTSGGVSMGRYDFMRDLLLGEGEI
FT                   TFWKVKMRPGGPALCGRWGGLPVFGLPGNPVSSLVVFQVIVRPVLTGEPLPTRQVTAAT
FT                   PFASLADKTAFWRGVLSGDEVRDYPRQGSGVLRSLSDADALVVVPEGQNIAAGERVEVV
FT                   LL"
FT   gene            complement(78380..79201)
FT                   /locus_tag="DR_0077"
FT   CDS_pept        complement(78380..79201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0077"
FT                   /product="shikimate 5-dehydrogenase, putative"
FT                   /note="similar to GB:L42023 SP:P44774 PID:1005431
FT                   PID:1220684 PID:1204858 percent identity: 53.11; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09670"
FT                   /db_xref="GOA:Q9RY73"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY73"
FT                   /protein_id="AAF09670.1"
FT                   /translation="MLPAPRFDRDTRLCMSLAAGPGNFGTRFHNYLYELLGLNYMYKAF
FT                   TTQDLPAAIGGIRALGIRGCAVSMPFKEAVIPLLDELMPSAAAIESVNTIVNDDGVLRA
FT                   YNTDYEAVRLLIREKELDPSWRVGVRGSGGMGKAVASALRDAGFENGVLVARNEAAGRE
FT                   LAGRLGWRWTPEPEAADLLVNVTPIGMAGGPEEHDLSFAPELIAQARAVFDVVALPAET
FT                   PLIAEARRQGKPVVTGEEVAALQALEQFVLYTGVRPTPEQVQAAAAWARQG"
FT   gene            complement(79205..80125)
FT                   /locus_tag="DR_0078"
FT   CDS_pept        complement(79205..80125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0078"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /note="similar to GB:X65511 PID:39039 SP:P54894 percent
FT                   identity: 69.58; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09671"
FT                   /db_xref="GOA:Q9RY72"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY72"
FT                   /protein_id="AAF09671.1"
FT                   /translation="MNKPKIFIDGEAGTTGLQIRERLAGRSDLELLSIDPVRRKDSAAR
FT                   AELLNAADVSILCLHDDAAREAVSLTTNPASRLLDASTAHRIHPDWVFGFPELSAEQPE
FT                   KIRQARYVANPGCYSTGAIALLAPLTGRGLLPADFPVHIQGYSGYTGGGRALVDAHEQG
FT                   SAHPSKGAFISYGLTLEHKHLPETMVYGGLTRKPVFTPNVGGWAQGMTVTVPLHLAELG
FT                   VSAEALHAALKEHYAGQQYVKVFELADNPEILDPQTLNGTNNLELFVYPAADGERALLA
FT                   ARLDNLGKGASGAAVQNLELMLGLS"
FT   gene            complement(80122..80637)
FT                   /locus_tag="DR_0079"
FT   CDS_pept        complement(80122..80637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0079"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GB:U00096 PID:1788637 GB:U00096
FT                   PID:1788637 percent identity: 50.70; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09672"
FT                   /db_xref="GOA:Q9RY71"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="PDB:1Q27"
FT                   /db_xref="PDB:2O5F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY71"
FT                   /protein_id="AAF09672.1"
FT                   /translation="MGGVSDERLDLVNERDEVVGQILRTDPALRWERVRVVNAFLRNSQ
FT                   GQLWIPRRSPSKSLFPNALDVSVGGAVQSGETYEEAFRREAREELNVEIDALSWRPLAS
FT                   FSPFQTTLSSFMCVYELRSDATPIFNPNDISGGEWLTPEHLLARIAAGEAAKGDLAELV
FT                   RRCYREEE"
FT   gene            complement(80645..81706)
FT                   /locus_tag="DR_0080"
FT   CDS_pept        complement(80645..81706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0080"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="similar to PID:1781357 percent identity: 68.71;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09673"
FT                   /db_xref="GOA:Q9RY70"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY70"
FT                   /protein_id="AAF09673.1"
FT                   /translation="MTTLDRGGVYFFPMTKAARSSKKSAPSVPTPAQARLHTPDTLPRP
FT                   VLAGRDFLSNLDMTSAELRAVMDTAHSMKAGEWRAVKPLSGLSLALVFEKASLRTRTTF
FT                   DVGMYQLGGHAITLSNTEIGLGTRERVSDVARNLERWVDGVMGRVYLQQTLVELAQHAR
FT                   IPVINGLSDMLHPAQLLADYQTIEEEFGQDLRGKRVVYIGDGNNLANSHIHMGILTGTD
FT                   VTVVTPVGYEPNAGVLMDAVKAGVEVHLTNDLDAIQGADVLYTDVWISMGQEAEADIRR
FT                   RAFRGYQVTPEMLETISPDGIFLHCLPAHYGEETVPEATEHPKSRVFDQAENRLHAQKA
FT                   LLYHVLGDMKPRW"
FT   gene            complement(81769..82482)
FT                   /locus_tag="DR_0081"
FT   CDS_pept        complement(81769..82482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:2193944 GB:AL123456 percent identity:
FT                   48.15; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09674"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY69"
FT                   /protein_id="AAF09674.1"
FT                   /translation="MLPTMTSETGKGLKLLLIVPHPDDEVYGASGTLMEYLAAGESCGL
FT                   VTLTRGEAGRTLGLCDGPEELARMRAVELAACLEVIGLTTTPGSLHEQHQFPDKYLKDY
FT                   PFEELVETAREAMERLRPETVLTFPPNGSNGHPDHMTTHRAVKAAWDRLPAGSRPVLWY
FT                   YASETPPENEELRAAWLPPTVKRDVSALVTRKLQAIACHRSQALSTVDFIRKFPERVTS
FT                   ETFYEVPESLRGAQS"
FT   gene            complement(82517..82981)
FT                   /locus_tag="DR_0082"
FT   CDS_pept        complement(82517..82981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09677"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY68"
FT                   /protein_id="AAF09677.1"
FT                   /translation="MSLEGRLGGVTAGLDLRGEWDGQTFQGRIGGYTDGLDVTVTAGGA
FT                   GIVGRVGGYTQGFDLNAQVQGQELVVRLGTLTAGDDVRLTFTPEGAEGRYGSFTAGQDV
FT                   RLRHYEREVRGRIGGISQGVDFWLDLGGVPLPLGALLVVCAYRVWTLRWE"
FT   gene            complement(83069..84322)
FT                   /locus_tag="DR_0083"
FT   CDS_pept        complement(83069..84322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0083"
FT                   /product="2-oxoglutarate dehydrogenase, dihydrolipoamide
FT                   succinyltransferase E2 component"
FT                   /note="similar to GB:X52432 SP:P20708 PID:142324 PID:39233
FT                   PID:39283 percent identity: 78.73; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09675"
FT                   /db_xref="GOA:Q9RY67"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY67"
FT                   /protein_id="AAF09675.1"
FT                   /translation="MADIKVPVFSESVSEGTLLTWHKKPGEAVKRGELLAEIETDKVVL
FT                   EVTAQQDGVLQSIAKNEGDTVLSEEVLGTMGEGDAAAPAPAAQDQASGPVASETTAGGT
FT                   AQQPDSTGTQPAAQSGERREDLSPAVRKIVEEKGLDVSQVPATGPKNNITKADAMGASA
FT                   PAPAAQPAPQAAKSAVVLPSGPRPEERVPMTRIRARIAERLKEVQNTAALLTTFNEVNM
FT                   QPTMELRKKYQDQFVKKHGVKLGFMSLFVRAATEALKAFPMVNASVDGKDVIYHGYYDI
FT                   GIAVASERGLVVPILRDTDNMSLADIEKQIAEFATRARAGKLTMEDMSGGTFSITNGGT
FT                   FGSMMSTPIINAPQSAILGMHNIIERPIAQNGQVVIAPMMYLAVSYDHRLIDGKEAVQF
FT                   LVMIKNLLEDPARMLLDL"
FT   gene            84836..86337
FT                   /locus_tag="DR_r01"
FT                   /note="rrnaC16S"
FT   rRNA            84836..86337
FT                   /locus_tag="DR_r01"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(86474..87790)
FT                   /locus_tag="DR_0084"
FT   CDS_pept        complement(86474..87790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0084"
FT                   /product="GTP-binding protein Obg"
FT                   /note="similar to GB:AE000657 percent identity: 66.67;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09676"
FT                   /db_xref="GOA:Q9RY66"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY66"
FT                   /protein_id="AAF09676.1"
FT                   /translation="MAFRDVLNIEVAAGNGGDGSMSFHRAKYMEKGGPDGGHGGRGGSI
FT                   ILRAIEGVESLERLVGRRKFKAENGRYGEGRLRQGADGQDTYIDVPVGTTAFDEDSGKV
FT                   IADLVNVGQEKVIAKGGLGGRGNSTFTSSTRQAPRFAELGTPGQKRRVRLELRLIADVG
FT                   LVGYPNAGKSSLLAALSRANPAIADYPFTTLSPILGVVQREDEQGVSLDERFTMADIPG
FT                   IIEGASEGKGLGLEFLRHISRTRLLVYVLDVTRNPVEELQQLQAELRAYDPSLLDNVAL
FT                   VALNKVELVEPDLAQMVEDELAEQGLPVLQVSAKEGTGLNTLRETLFQLLPEFELWAQS
FT                   NALEVEPDTVVDEALQIVFREDAPAKGEGAPERVWEVHGGGFEERIVRFSRYLEDAAEY
FT                   LGNLFKRQGLYNALRRAGAREGDTVEIGTFRFEYFDDEE"
FT   gene            complement(87904..88179)
FT                   /locus_tag="DR_0085"
FT   CDS_pept        complement(87904..88179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0085"
FT                   /product="ribosomal protein L27"
FT                   /note="similar to GB:D13267 SP:P02427 PID:216637 PID:606123
FT                   GB:U00096 percent identity: 78.57; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09678"
FT                   /db_xref="GOA:Q9RY65"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:1Y69"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4V4T"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY65"
FT                   /protein_id="AAF09678.1"
FT                   /translation="MAHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKF
FT                   KAGQGVGMGRDHTLFALSDGKVVFINKGKGARFISIEAAQTEVAAD"
FT   gene            complement(88194..88703)
FT                   /locus_tag="DR_0086"
FT   CDS_pept        complement(88194..88703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0086"
FT                   /product="ribosomal protein L21"
FT                   /note="similar to GB:AL123456 percent identity: 63.64;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09679"
FT                   /db_xref="GOA:Q9RY64"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4V4T"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY64"
FT                   /protein_id="AAF09679.1"
FT                   /translation="MHAVHFLFAPTWGQDCLLLPVPVKLPVRACSRGQVGVVQFSLGGP
FT                   ATGKRQHNGPSLLAMKGAGGRRKEMFAIIQTGGKQYRVSEGDVIRVESLQGEAGDKVEL
FT                   KALFVGGEQTVFGEDAGKYTVQAEVVEHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIK
FT                   ILGIQG"
FT   gene            complement(88873..89346)
FT                   /locus_tag="DR_0087"
FT   CDS_pept        complement(88873..89346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:M15183 PID:468267 PID:2293279
FT                   GB:AL009126 percent identity: 66.00; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09680"
FT                   /db_xref="GOA:Q9RY63"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY63"
FT                   /protein_id="AAF09680.1"
FT                   /translation="MKCPYCSSPDSRVINSRPSDDGASIRRRRECLTCTRRFTTYERAQ
FT                   LEPLMVVKRSGVREAFNPDKLLRGLALASEKRPVEEAALRTFAYSFEDEVQGGEIPTEE
FT                   IGRRAMTFLRPLDDVAYIRFASVYRDFDSLERFIEEIRGLKGHEDEAPKSDPA"
FT   gene            complement(89343..90140)
FT                   /locus_tag="DR_0088"
FT   CDS_pept        complement(89343..90140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0088"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to GB:AL009126 percent identity: 49.61;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09681"
FT                   /db_xref="GOA:Q9RY62"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY62"
FT                   /protein_id="AAF09681.1"
FT                   /translation="MRGWPAMLAAMTSSAGGAFSPSPAQRGLLTNQVIAVTSADQGYGR
FT                   PIGTALAHAGASVILVGTAPENLAAIASGIEQQGGQVIPLAADVSVPLDCISALGRILD
FT                   IYGELHGVVHLADKRAYSTFQDLSENEWMDLFGANVKSTVALTQVLRRRHPQTWLTIVG
FT                   PHRDEAGLQVQPQRGAIRSLVEHAGQEDMRLNLLLPSRASSGDDRLDQPLTDAVLALAM
FT                   PSLGHLGGNVLEVPLPPLPRAGQARSDQVRAEQIRSGQVDRQP"
FT   gene            complement(90184..91260)
FT                   /locus_tag="DR_0089"
FT   CDS_pept        complement(90184..91260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653794 percent identity: 51.55;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09682"
FT                   /db_xref="GOA:Q9RY61"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY61"
FT                   /protein_id="AAF09682.1"
FT                   /translation="MKPLSLLYHVLTGAFLGYKALMLVNNAVAFPRLRPQPPLPDVRVS
FT                   LLVPARDEAANLRRNLPGLLAQGAAEVLVLDDGSVDDTAQVARSLGARVLTGEPLPPGW
FT                   VGKPWACQQLARAASGDVLVFTDADVSWHPGALGAVTAQWQRAGADLLSVWPRQRNVTP
FT                   GERLLTPLAELPLLLLFPLPLLLFPIPSASAANGQVMVFRRSFYWSLGGHAAVRGDVLE
FT                   DVQFAYRVREAGGRLSLALGQDCIGVRMYRSYPDSVAGFGKNLLAVHGGRRGRLALSFA
FT                   LVFAIYTAPWLWPLPGARWLRLASVAERPLTNFLAGRRRPADLAEGLLGPLTPLLMLPV
FT                   YRRALRRQVAWKGREYRQ"
FT   gene            complement(91257..91955)
FT                   /locus_tag="DR_0090"
FT   CDS_pept        complement(91257..91955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:577591 percent identity: 54.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09683"
FT                   /db_xref="GOA:Q9RY60"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY60"
FT                   /protein_id="AAF09683.1"
FT                   /translation="MPVEGDWTGPLVRLSIRRSLRAELAGVYVTGPLPPGGAVLAPNHQ
FT                   SWWDGYLLGELAWQCGADLRVMMTERQLGRFPFLRRVGAIGTGEVRAAVRHARRGGWTV
FT                   LFPEGALQPPGPLGALHPGAAWVARQAGVPLIPVGLRVLVRGAQKPEAFVRFAPPMPPA
FT                   DLAGALRAAVARLDADLHAADPDLPPAGYLRWVRGASSVHDRPGLPTRLLARLTTLQGA
FT                   SLPAPKGPLR"
FT   gene            complement(91945..92883)
FT                   /locus_tag="DR_0091"
FT   CDS_pept        complement(91945..92883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653202 percent identity: 46.27;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09684"
FT                   /db_xref="GOA:Q9RY59"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY59"
FT                   /protein_id="AAF09684.1"
FT                   /translation="MISPPLLRWGLAAAGLGLAFLGALLALAEQSAGWALIALGLPLSG
FT                   VFALAGDALGSAFGATLRRRWQRLLAETPPWLGWLALSVALKIPVPLWPQGFALLGLLS
FT                   TGALFVAGLSYAAQRAGWGQAAQLAALACLAGLGVELLGSRTGVPFGQYSYATAPAPTV
FT                   LTVPLIVPLGWFAFTLAGLQLAGGRPWLAGLLITCWDVGLEPLMTAQNYWRWSDPHPLW
FT                   AGAPVQNFLGWWAVGTAIAWGMKRLAPGLFDAKEKQKAEGLSPSFSLAYFTEAFFLPGG
FT                   LVLVGRLAEAGVTLAVMGLGALLARGVRRAS"
FT   gene            complement(92880..93155)
FT                   /locus_tag="DR_0092"
FT   CDS_pept        complement(92880..93155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0092"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to SP:P54570 PID:1303984 GB:AL009126 percent
FT                   identity: 47.27; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09685"
FT                   /db_xref="GOA:Q9RY58"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY58"
FT                   /protein_id="AAF09685.1"
FT                   /translation="MKRTGAGIAVRRGAAVLLVRRRDDGQWDVPGGGSEGAEAIEETTP
FT                   RELREETELTVGEMRILGMWPPSALPGDVSETTAQYFAALHSQEPG"
FT   gene            complement(93152..94687)
FT                   /locus_tag="DR_0093"
FT   CDS_pept        complement(93152..94687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0093"
FT                   /product="phytoene dehydrogenase, putative"
FT                   /note="similar to PID:1001734 PID:1001724 percent identity:
FT                   54.72; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09686"
FT                   /db_xref="GOA:Q9RY57"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY57"
FT                   /protein_id="AAF09686.1"
FT                   /translation="MPDYDLIVMGAGHNALVTAAYAARAGLKVGVFERRHLVGGAVSTE
FT                   EVVPGYRFDYGGSAHILIRMTPIVRELELTRHGLHYLEVDPMFHASDGETPWFIHRDAG
FT                   RTIRELDEKFPGQGDAYGRFLDDWTPFARAVADLFNSAPGPLDLGKMVMRSGQGKDWNE
FT                   QLPRILRPYGDVAREYFSEERVRAPLTWMAAQSGPPPSDPLSAPFLLWHPLYHEGGVAR
FT                   PKGGSGGLTKALRRATEAEGGEVFTDAPVKEILVKDGKAQGIRLESGETYTARAVVSGV
FT                   HILTTANALPAEYVPSAARNVRVGNGFGMILRLALSEKVKYRHHTEPDSRIGLGLLIKN
FT                   ERQIMQGYGEYLAGQPTTDPPLVAMSFSAVDDSLAPPNGDVLWLWAQYYPFELATGSWE
FT                   TRTAEARENILRAFEHYAPGTRDTIVGELVQTPQWLETNLGLHRGNVMHLEMSFDQMFS
FT                   FRPWLKASQYRWPGVQGLYLTGASTHPGGGIMGASGRNAARVIVKDLTRRRWK"
FT   gene            94950..95495
FT                   /locus_tag="DR_0094"
FT   CDS_pept        94950..95495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09690"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY56"
FT                   /protein_id="AAF09690.1"
FT                   /translation="MTEKVRNITVGHAQGVPGRPGESKGGPMKRSAALGLTVLFGVPAS
FT                   AQSAQSLVTGTSTTELVGIARGFGSASLGTSSATGSPKITGRIGGQEYSVYFYGCDSNK
FT                   KNCTSIQFATYWIGKRLTAAEVNQWNADKRFGKLFIDSDGDLNLQMDVNLDFGVTYKNM
FT                   EDTFDLWKLVLEDVLDAI"
FT   gene            complement(95577..97403)
FT                   /locus_tag="DR_0095"
FT   CDS_pept        complement(95577..97403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0095"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to PID:1651685 percent identity: 60.18;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09687"
FT                   /db_xref="GOA:Q9RY55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY55"
FT                   /protein_id="AAF09687.1"
FT                   /translation="MTTPASPLPSASPPPTTPRAVSPSPARTFALARRLFAYTPGLFAF
FT                   NLLMWGMVHASPALLTVAISGLFGHLEEAERGVSTGIAAAWVSLGWFAFVRASRFGIFY
FT                   GAFRAWVELWYTLDALVRRNLLGYLLTAPGSRRLPDTPAEAVSRFRDDVEDVAGYTEVW
FT                   VDGAGFLVYTLVAVTLMARVDPLITVLVCAPLLLMIVFVQRLSPTIRTYRRRMREATAR
FT                   VTDFIGETFGAVSAVKLAGREEQMVAHLRRLGETRQQAALRDVLLTELIRGVNTNMVNL
FT                   AVGLVLLLGANRVRGEALSVQDFVLFIGLLPRLTGSMGFFGDAIARHRRTGVSFERMNR
FT                   LLVDAPGDETVRHQPVYLRAEPPALPAREAAEPLRELRVEHLSAHHPDGGGVHDVSFTL
FT                   RRGEFVVVTGRIGSGKSTLLRAVLGLLPTDGGRIVWNGEEVTDPASFLVPPRSAYTAQL
FT                   PNLFSDSLRDNVLSGADADRLPLAVRLARLDADLAQLPQGDGTPVGARGVKLSGGQVQR
FT                   TAVARMLAQQADLLVFDDVSSALDARTEAELWDGLFSELGATCLVVSHRRAALTRAHRI
FT                   LVMEGGRVTAEGTLAELLETSAEMRALWAEEE"
FT   gene            complement(97501..99252)
FT                   /locus_tag="DR_0096"
FT   CDS_pept        complement(97501..99252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0096"
FT                   /product="ABC transporter, ATP-binding protein, MsbA
FT                   family"
FT                   /note="similar to PID:1651679 percent identity: 61.83;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09688"
FT                   /db_xref="GOA:Q9RY54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY54"
FT                   /protein_id="AAF09688.1"
FT                   /translation="MAAPSPTLTVLRTYLGPLRGAVAALAALLLVGTGLNLLLPQLLSR
FT                   FVDAAKLGAQADVALLVRLAVTYLVLAVGVQLLSAGATYLGARVGWQATNRLRADLTAH
FT                   LLSLDMQEHKERTPGEMIERIDGDVTALSNFFSQFAVRVFGAALLLTGAVVMFWRTDWR
FT                   VGAGVTVFVALTLWAMNRVRKGGVEPTQQEREASAKLFGYVEERLAGLDDVRSLGAGEY
FT                   HLRGFLKVQREFFSRSIFSWRRRAVVWQLSMALFAVGYVALLASAVGLYAAGAITLGTA
FT                   FALYQYMTMVEEPIDQLTNQLQDLQKAGASVMRVGELLALRSHLPEGTRELPPGPLDLR
FT                   FDHVGFSYGGAEGTPVLRDVDLTLEAGQTLGLLGRTGSGKTTLTRLVSRLYDPTSGSVR
FT                   LGGVDTRDVTLASLRSRVAVVTQDVQLFQASVRDNLSFFDEGVSDAQVEAALAEVGLGD
FT                   WLSRLPEGVRTPLPAGSLSAGQAQLLAFARVMLRDPAVIILDEPSSRLDPATEAQLTAA
FT                   MTRLLAGRTAIVIAHRLDTVARADRIVVLGAGEVLEDGARTDLARDPRSHYAGLLRAGR
FT                   EAEAVLA"
FT   gene            complement(99317..99886)
FT                   /locus_tag="DR_0097"
FT   CDS_pept        complement(99317..99886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 49.14;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09689"
FT                   /db_xref="InterPro:IPR008307"
FT                   /db_xref="InterPro:IPR014923"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY53"
FT                   /protein_id="AAF09689.1"
FT                   /translation="MVYCQVMNELVGLKEWDVQCGLLTRGETSLLIRKGGIHERHGEFE
FT                   VEHRRFVLYPTYVHQNPEELRAEFAPLLRTDPAPGRVRPPALAEVVAVHRVTDLAAAQR
FT                   LEPLQALTAQAMARKFAYKNRPWVHALVLRIWPLREPPTLTETAQMLGCVSWVPLGELK
FT                   VDVGAPAVSDADLTARAAEVQRLLEG"
FT   gene            100030..100338
FT                   /locus_tag="DR_0098"
FT   CDS_pept        100030..100338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0098"
FT                   /product="ribosomal protein S6"
FT                   /note="similar to SP:P23370 percent identity: 69.15;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09691"
FT                   /db_xref="GOA:Q9RY52"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY52"
FT                   /protein_id="AAF09691.1"
FT                   /translation="MNQYDLNLILNPNISAEQVQTEKDYIENAVRNAGAEISNLDDLGN
FT                   RRLAYQVGKDREGYYLMYTIKASGNPETAIASSLRLRDNVRRVLVVKDRPEWKTKKA"
FT   gene            100371..100802
FT                   /locus_tag="DR_0099"
FT   CDS_pept        100371..100802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0099"
FT                   /product="single-stranded DNA-binding protein"
FT                   /note="similar to GB:Z32859 SP:P40947 PID:483597 percent
FT                   identity: 68.54; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09692"
FT                   /db_xref="GOA:Q9RY51"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:1SE8"
FT                   /db_xref="PDB:3UDG"
FT                   /db_xref="PDB:3UFM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY51"
FT                   /protein_id="AAF09692.1"
FT                   /translation="MLLSSEPARAVRQQHRTLVILPATQGEFVMARGMNHVYLIGALAR
FT                   DPELRYTGNGMAVFEATVAGEDRVIGNDGRERNLPWYHRVSILGKPAEWQAERNLKGGD
FT                   AVVVEGTLEYRQWEAPEAANAAQSTSKPSAWNSSAPSPN"
FT   gene            100718..101361
FT                   /locus_tag="DR_0100"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   GB:L42023 SP:P44409 PID:1003398 PID:1222173 PID:1204507
FT                   percent identity: 55.66; identified by sequence similarity;
FT                   putative"
FT   gene            101418..101696
FT                   /locus_tag="DR_0101"
FT   CDS_pept        101418..101696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0101"
FT                   /product="ribosomal protein S18"
FT                   /note="similar to SP:P10806 percent identity: 69.86;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09693"
FT                   /db_xref="GOA:Q9RY50"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY50"
FT                   /protein_id="AAF09693.1"
FT                   /translation="MTQQGNSGERKPRGKGPKRPRKPKVDPFSIGELEITDYKDVKMLR
FT                   RFVSDTGKILPRRRTGLSAKHQRRIAQTIKVARQLALLPYTEKLVRK"
FT   gene            101709..102149
FT                   /locus_tag="DR_0102"
FT   CDS_pept        101709..102149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0102"
FT                   /product="ribosomal protein L9"
FT                   /note="similar to GB:M57623 SP:P02417 GB:X62002 PID:143421
FT                   PID:39817 percent identity: 65.97; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09694"
FT                   /db_xref="GOA:Q9RY49"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY49"
FT                   /protein_id="AAF09694.1"
FT                   /translation="MQVILLEPSRLGKTGEVVSVKDGYARNWLIPQGLAVSATRTNMKT
FT                   LEAQLRSIEKRQAQEKAVAEDLASRLNGVAVELSVRAGEGKIYGAVTHQDVANSLDQLG
FT                   FDVDRRKIDMPKTVKEVGEYDIAYRAHPEVTIPMKLVVHAAK"
FT   gene            complement(102198..103001)
FT                   /locus_tag="DR_0103"
FT   CDS_pept        complement(102198..103001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09699"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY48"
FT                   /protein_id="AAF09699.1"
FT                   /translation="MPDLLDLTPKFRTFFALAEHADPETRWQLWQQHYAFAAVPPTPGG
FT                   QGIARRLLDEAWEKYSDLPTDLRPEVVRLQRQAREAEQALEALFQTPAPSYRLVTYVGG
FT                   FEGNAFVAGTSLCMPVEMPADWAGWVLTHELTHLFHHELCGSDGGWQRSVAALIVQEGL
FT                   ATRTTAALHPTSPLRDHLGTVDWLRQCEDVRSGLWGDALSRLDASDDAALLRFLLPHPE
FT                   FGPERTAYALGWWLVGDWLAQGRTLAELARVPEADLPALVAQRTQ"
FT   gene            103047..103745
FT                   /locus_tag="DR_0104"
FT   CDS_pept        103047..103745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09700"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY47"
FT                   /protein_id="AAF09700.1"
FT                   /translation="MRSVLTVTHPAAVRLLTRGRARWVLGAFLRGENSVAGAARELNLD
FT                   LRLVHRDVGALLSAGLLQVVREQKRAGRAVKVYTATAPAFFVPFSATDAADFAELGGKR
FT                   EQLYDELLGRASLRKFEQLHHEQSGGREWGVRLYLGPEGQVQVDTSYEGAELVEAAVRY
FT                   QGPVGLLLSARTALRLTEAEAEEVQIELIRLLMRLRPISVQHEQNGTGQPFLLRLGLVG
FT                   VSEEEAQSLQ"
FT   gene            103929..104420
FT                   /locus_tag="DR_0105"
FT   CDS_pept        103929..104420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09701"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY46"
FT                   /protein_id="AAF09701.1"
FT                   /translation="MGDEAGNAQDRAEAAAARARAESHGADYRREMDSANDDLLSGLGQ
FT                   AKHKTDQAAEKVRADTQEAAQNAREKAQDVRANVHESAQDFRAGAQEQAQTLRADARDA
FT                   AAQARDHAQNLRTDVHEKAQDLREGAHETAQNVKADVHNAAEDVRADVREIDRRSKNQD
FT                   "
FT   gene            104505..105206
FT                   /locus_tag="DR_0106"
FT   CDS_pept        104505..105206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09702"
FT                   /db_xref="GOA:Q9RY45"
FT                   /db_xref="InterPro:IPR014470"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY45"
FT                   /protein_id="AAF09702.1"
FT                   /translation="MSHDAGAGLMPGTGGGEGAVREGKLTEVSYSGNQANALIHLYRAE
FT                   VGKMTAYRQRLDMTTNWSVVTTAGLASFALGDVNNSHATFLFAMFMNYFFLRLEARRFR
FT                   TFEIAHHRVRIMERFFYPAMLGDKVDAGWHQLLLAELAKPRSPMTRNDALGWRLNRNYL
FT                   WIYAAVLLAWFAKLDLSVPKGFLLEFPETFSLADIGSFPGWLVFLGVGVFYAYLIWLAL
FT                   RAARTYPLEEG"
FT   gene            105241..106596
FT                   /locus_tag="DR_0107"
FT   CDS_pept        105241..106596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1001216 PID:1001206 percent identity:
FT                   55.43; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09695"
FT                   /db_xref="GOA:Q9RY44"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY44"
FT                   /protein_id="AAF09695.1"
FT                   /translation="MTTLPAPTISTTAELRALLRLAGPVVVSQFAANALALIATAVIGR
FT                   LGERELAAAAYANAAYYLVFIMVVGVMLSVAPRVAQAHGAGDARGVARALGGGLRLALL
FT                   LSAVMLPLMWALSFVLPNFAPAGVSRDLVAAYLRVYSLGMLPNLAFIALRGTLEGTGKP
FT                   GAVTGVALTGVVWALLVAPALAFGWGPLPRLGLAGAAGASASAAWIMAALLWPLARRRV
FT                   AYAGPLGPLGDEVRALFRLGWPIGLTLGAEGGMFSVTTLLMARFGPEVLAAHNVTMQTI
FT                   TAFFMVPLGIASATGVRVGTEAGAGRLAQARRAGLVGLGLSSAVMLTFAVIELAAPRTV
FT                   FSVFVNVNDPANAGLIAAATGFLSIAALFQLMDGLQVTANGALRGLQDTRVPLLVSLVA
FT                   YWVVGLGLGSVLSSVAGLGARGLWFGLTAGLTLAGLSLVGRFLYRTRAGRAA"
FT   gene            complement(106603..108852)
FT                   /locus_tag="DR_0108"
FT   CDS_pept        complement(106603..108852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:3334797 percent identity: 56.76;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09696"
FT                   /db_xref="GOA:Q9RY43"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY43"
FT                   /protein_id="AAF09696.1"
FT                   /translation="MPARRRVLLLGVRRLALFVSRHPWAVLLVWALLVALSLPFAARAP
FT                   SALSANPGTLTNAESARVSDLLRDKFGETDTNTALLVTRSTPGLDTAPGQATYQRFVSG
FT                   LRDVKGVTRVLPAQRGGLGSRDAAGTLALTVAQIPLQEDGKEAVARIRAYVRRVASPAL
FT                   DIRVTGGQAIADDFTELAEADTKRSEFVALPLIALLLLLVFGALVATGLPLVIGMLSIS
FT                   VAMAGLYFLTTVMEVSTFAQSVVTMLGLGAGIDYALLMVNRFREELARRGNAAEAAART
FT                   VETAGRSVLFSGSTVAIAMAGLLLPPLSFVRSIGIGGVLAVVLTVLASLTALPALLTLL
FT                   GDRVNAPRLLRSTWAQSAGASAAWTAFARRVTARPLAVVVLSTAFLLLLAVPASRMKTG
FT                   YAGAWGLVPGVESRDALQDVRDMGAGGLLSQYEVLLDLEGKRYTPDQSARFQAVVNDLR
FT                   ALPGVRAVLSPFLTPADLQAAGGGTSDGLAALSLLTQRSFSRDRTFLRVTVVPDDTLRA
FT                   DLAPAFEKRVRAVLEGSGSRFLVGGAPVGGREFSEAITDTLPTVMLAVFGGTFVLLLLA
FT                   FRSLLIPLKSIVMNALTVGAAAGVVTWAVQEGHFAGLLGLPASAGVLDSSLPLLLFAVM
FT                   FGLSMDYEIFLLSRVQEEHLAGASNDEAVVRAVGHTARIITSAAVIMFIVFTAFMFGRV
FT                   VATKSVGLGLAVAVVLDATLVRLVLVPAFLKLAGRWNWWLPAWLDKRLPYLKLEH"
FT   gene            108936..109322
FT                   /locus_tag="DR_0109"
FT   CDS_pept        108936..109322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09703"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY42"
FT                   /protein_id="AAF09703.1"
FT                   /translation="MPLLNGLDHVQLEAPAGCEVAAREFFAGVLGLPELQKPEALRKNG
FT                   GCWFGLPDGRQVHVGVVADYVPRRKGHFALRCDDVGAVARHLAAHGVACTPDKEAGVPR
FT                   LFLQDPWGGRLEIVQGAHPSRPLS"
FT   gene            109372..110190
FT                   /locus_tag="DR_0110"
FT   CDS_pept        109372..110190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000782 percent identity: 65.84;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09697"
FT                   /db_xref="GOA:Q9RY41"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY41"
FT                   /protein_id="AAF09697.1"
FT                   /translation="MGLASTMPLMTVSPSSQTGRGEIGRDELVRWLGEYLRIGAYPDPS
FT                   LNGLQIQGTDKIRRIAASVDTSLQTLQAAAESGADLLLVHHGLFWGRPLAITGPHYERV
FT                   RTAIQADLNLYAAHIPLDAHPEVGNNAMIARALSLTDLQPFGDWQGHKIGVAGTLPREL
FT                   GLQDFADRIQKLTGEICLVHGGGSPNIHRVGVTSGSGAGAIAEAAAMGLDTLLTGEPEH
FT                   KYFHDSFEYGVNVIFAGHYETEVFGVRALAARIEDEFGIPWQFLNFPTGL"
FT   gene            110187..110807
FT                   /locus_tag="DR_0111"
FT   CDS_pept        110187..110807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0111"
FT                   /product="thymidylate kinase"
FT                   /note="similar to GB:D26185 SP:P37537 PID:467418
FT                   GB:AL009126 percent identity: 62.07; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09698"
FT                   /db_xref="GOA:Q9RY40"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY40"
FT                   /protein_id="AAF09698.1"
FT                   /translation="MSQGLFITLEGPEGAGKTTQLARLEARLRAAGHAVTVTREPGGTP
FT                   LGTRVREVVLDPAVEIEPLGEFLLYSASRAQLVREVLRPALERGETVLCDRYADSSLAY
FT                   QGAGRGLSLPLLRQITAEVTGGLTPGLTVLLDLDPALGLQRAARRGQPDRLEQADLTFH
FT                   RRVRQGFLDLAHAEPQRFLVLDATRPEDELEAEIWAAVSERGH"
FT   gene            complement(111006..111890)
FT                   /locus_tag="DR_0112"
FT   CDS_pept        complement(111006..111890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0112"
FT                   /product="glutamine cyclotransferase"
FT                   /note="similar to GP:3342798 percent identity: 55.95;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09704"
FT                   /db_xref="GOA:Q9RY39"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY39"
FT                   /protein_id="AAF09704.1"
FT                   /translation="MRRSPALSLSTFALLALAALPLALSSAPTPTRAPAAKVSSARTPV
FT                   LRPVVAARYPHDRAAFTQGLQYLGGGHYLESTGQVGESDLRVSELRGAKVLWSTPLAQA
FT                   LPQAFGEGSTQLGSTVYQLTWQDGVALTYDARTFKETGRHRYQGEGWGLTSDGKSLIMS
FT                   NGTSTLVWRDPKTFAAQRSVQVTDQGQPVRNLNELEYVQGSVYANVWLTDRIARIHPQT
FT                   GKVLTWIDVSDLTREVSAAATKQGQALTFDDVPNGIAFIPERGTLLLTGKRWPTLFEVK
FT                   VPGLGLKVEGAKN"
FT   gene            complement(111973..112995)
FT                   /locus_tag="DR_0113"
FT   CDS_pept        complement(111973..112995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0113"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to SP:P32573 PID:1302205 PID:553143
FT                   PID:600063 percent identity: 62.84; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09705"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY38"
FT                   /protein_id="AAF09705.1"
FT                   /translation="MDGVYKGKPFLCWKRLFCLGRHSVYLRRLFGIGRCSTLSGRFHSR
FT                   PFHVPTPRRFSMTQSSPNRPADPATTFRPDLLAGKHALITGGGSGINLGIAQSFAAHGC
FT                   AVTILGRNLEKAQNAAQGIVDAGGRAMGVSADVRDFAALEAAVAAATAEFGDFDIVLAG
FT                   AAGNFPAPVDGISPNGFKTVVDIDLLGTYNTIKAAAPRLKVPGGNILSISAYGVPVPMQ
FT                   AHVVAAKAGVDALTQTLAVEWGLRGVRVNAIIPGPIDGTEGMARLAPDEKSRSAFTRTV
FT                   PLGRFGVPQDIANAALFLVSDAASYVTGVILPVDGGQNMLGGAPQYQMYLQMQAAQQKD
FT                   "
FT   gene            complement(113219..113992)
FT                   /locus_tag="DR_0114"
FT   CDS_pept        complement(113219..113992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0114"
FT                   /product="enoyl-CoA hydratase, putative"
FT                   /note="similar to PID:1502424 GB:AL123456 percent identity:
FT                   55.46; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09706"
FT                   /db_xref="GOA:Q9RY37"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:4JOT"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY37"
FT                   /protein_id="AAF09706.1"
FT                   /translation="MTYQSIRLTQRPLSQDGTTQGGTVATLTLAAKMGSMGPAFWQEFP
FT                   QALSELGDARVLIVRGEQVFSAGLDVKSNGAAIVPALGKPDAFKAVVDEMHAVTEGLAA
FT                   LPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKLGITADLGGLQRLPHLIG
FT                   RGRTAHLALTGEAIDAATAERWGLVTEVLPDQDALFARAEALAEHLAALPAKALEGTKR
FT                   ALSDGLPHAESLAAAVRWNAEHMTVEALQAGMKKG"
FT   gene            114105..114995
FT                   /locus_tag="DR_0115"
FT   CDS_pept        114105..114995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09711"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY36"
FT                   /protein_id="AAF09711.1"
FT                   /translation="MGLVTCRLRALRFRNAPAHEGGMLRLSSGAAPGGSMKYLRALPAV
FT                   SVVALSSALALGGGAQPPIQTTPVPVQTAPAPKPAPVACTQGAWAKAAIDLVTQKGLFI
FT                   GYPDGSFDWCSAITRQEVAQVLARLLAQMPENTFNPAELDTLRQGVAEALAGLEELRAQ
FT                   LAQQNQSIEDLRAQIDELRTALNNMPAAGQGEAGALAPRVPRAKPAPSVPRVLRALRVR
FT                   LAPRVLRVKLVPSVPRAPRVSAARRVTPTFRPPSPSATATTWARPTTASSSRTWARWSA
FT                   SPPATTRSTAASACA"
FT   gene            114893..115282
FT                   /locus_tag="DR_0116"
FT   CDS_pept        114893..115282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09712"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY35"
FT                   /protein_id="AAF09712.1"
FT                   /translation="MGAAYYSILQQNVGQMVRITAGNDQIYGGFGVRVTGDVALRGETP
FT                   GNSLSGAVTYRGTTGRFDGILGVGAGYNFKNASTFGELSIGVDYRVVDRVAIFAEARQH
FT                   YYFNGNINPNSRNLSSIAAGFKVRF"
FT   gene            complement(115396..116733)
FT                   /locus_tag="DR_0117"
FT   CDS_pept        complement(115396..116733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0117"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /note="similar to GB:L14862 SP:Q06862 PID:289133 percent
FT                   identity: 75.28; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09707"
FT                   /db_xref="GOA:Q9RY34"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY34"
FT                   /protein_id="AAF09707.1"
FT                   /translation="MFKKILIANRGEIALRVIRTAREMGIQTVVVYSTADEKSLPVLLA
FT                   DESVCVGPPASNQSYLNIPNILSAALMTGAEAIHPGYGFMAENPDFAEMCREHGIVFIG
FT                   PTPESMRALGSKAGGREIAAQSNVPTVPGTGVLESVDAALLAAKQIGYPVLLKASAGGG
FT                   GRGQKVIRTQEELQKGFNQAQEEARLYFGDPAIIMEKFLEEFRHIEVQVMGDGQGHVIH
FT                   IGERDCSIQRRNQKLIEEAPSTLPESLRQEILAAGVRLAQFVNYAGAGTLEFIMDRDGN
FT                   YYFMEMNTRIQVEHCVSEMISSLDLVRLQIEIAAGLGLNIQQDDVKLHGHAIECRINAE
FT                   DPDKDFRPAAGKIDDAHFAGGAGVRVDTHVYSGYSIPPHYDSLIGKLIVWHEDRDKAVS
FT                   RMKRALEETVIQGPKTTIPLYIKIMDNPFYKRGAVMTNFLKTRMEM"
FT   gene            complement(116822..117385)
FT                   /locus_tag="DR_0118"
FT   CDS_pept        complement(116822..117385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0118"
FT                   /product="acetyl-CoA carboxylase, bitoin carboxyl carrier
FT                   protein"
FT                   /note="similar to GB:L14612 SP:P37799 PID:405540 percent
FT                   identity: 65.81; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09708"
FT                   /db_xref="GOA:Q9RY33"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY33"
FT                   /protein_id="AAF09708.1"
FT                   /translation="MNPDDLKKILDALTHADVREFALKTGSFDLALKRARRRSPQCLPR
FT                   SAPQLSYPQMPPLPQPMMGGFAPMPAPQAPAAPSAPAAPAPEAAPAPAAPAEAAPAAAS
FT                   APVASAGTPVKAPIVGTFYSASSPDAAPYVKVGDRVESGQVLCIIEAMKLMNEIEAEQS
FT                   GVIREILVKNAEPVEYGQTLFMIE"
FT   gene            complement(117584..118141)
FT                   /locus_tag="DR_0119"
FT   CDS_pept        complement(117584..118141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0119"
FT                   /product="elongation factor P"
FT                   /note="similar to PID:1001103 PID:1001112 percent identity:
FT                   70.11; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09709"
FT                   /db_xref="GOA:Q9RY32"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY32"
FT                   /protein_id="AAF09709.1"
FT                   /translation="MISVTELRNGTKVQMDGGLWECLDYSHLKMGRGGAKVVTKFRNME
FT                   SGSIVDRTFNSTEKLQDIYVEGKKMQYLYPDGDDYVFMDMETFDQVHLGKNIVSDAAKF
FT                   MKENTEVEVAMYGDKALSISLPNQVILKITQTDPGVRGDTVSGGTKPATLETGAVVQVP
FT                   LFVEQGTDVKVDTRTGQYLSRA"
FT   gene            complement(118232..119344)
FT                   /locus_tag="DR_0120"
FT   CDS_pept        complement(118232..119344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0120"
FT                   /product="smf protein"
FT                   /note="similar to PID:1652454 percent identity: 52.21;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09710"
FT                   /db_xref="GOA:Q9RY31"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY31"
FT                   /protein_id="AAF09710.1"
FT                   /translation="MTLPSPAAAHAELLALLTLRFTPGLGPRRIENLRRHFGSAEAALA
FT                   APLTELRRVEGLDSRSVAAIGGAKAAEEARAELNKAAERGVTLLGRGLPGYPAALEALG
FT                   DPPAVLWVRGAGGAELLAGLGTVPHSVGIVGTRAASPHALALTRTIAGELAAAGVLIVS
FT                   GLARGVDTAAHTAALEAASGEASSPTIGVLGSAVDVIYPRENHDLAGRMVVVSEYPLGT
FT                   GPAQHHFPSRNRVIAALSAGVLVVEGERKSGSLITATHALDCGRTVFAVPGRAGDPRAS
FT                   GPHALIRDGAVLTESAQDVLTELNWGLAPAPAVPDLPPEQARVLRALQTPATLDDLAAT
FT                   TGLSIPELQTALVMLQLQGLAYEVGGRWSR"
FT   gene            complement(119580..120929)
FT                   /locus_tag="DR_0121"
FT   CDS_pept        complement(119580..120929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0121"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09713"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY30"
FT                   /protein_id="AAF09713.1"
FT                   /translation="MPHAVQGQPENAVHPPQGTAWPGLEPPEGFLMANPRLSRRHVRRM
FT                   RSERPPPTTRPPDWRFPMKSTLNLLLTVSLALSGAGLAQTAPNVPTQAAPTTAAPANAA
FT                   QLAAEARDLTNRARTTYPAGSASIDQPLWKQAADRAEAAVSAAPNNPDVLRLRAQIYTE
FT                   VGFWKQAESSWRAYFAVAPVAAGQNEARAAGNVQYNLGYAAYTRGQSAQAAAYFKACLT
FT                   LDPQSVPCATWAARTALESGDYALAQNLYTQALSLAPTDKTLNYFAQVARNASTYGPAA
FT                   TQAFSRAYASLDAGRRAEALAGFQEAARSAPNFPEAQREAGRLALEAGDTGAALSAYQA
FT                   LAALPGATDSDRYNLGLAQEGQQYGLRAVQTFRTAYGKYSAGDKAGAEAGFLQATTASA
FT                   NYGKAWAWLGRVRYEAKNYAGAAEAYGRAVALDPGDKTSAYFLKLAQQGK"
FT   gene            120921..121730
FT                   /locus_tag="DR_0122"
FT   CDS_pept        120921..121730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09714"
FT                   /db_xref="GOA:Q9RY29"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY29"
FT                   /protein_id="AAF09714.1"
FT                   /translation="MGHPADAPPGSVWEQDLPTLRAVVDAGPALDATLGVPGLPQSGTG
FT                   QSCWLTGTDAVRLMGEHFGPVPGPTLQALLREHGLPGRLTAAGGRAALVNAYSPAYLAG
FT                   GGRRNRLGCFPYAFRAAGLPLNSPDVPALGAGLGLAYASPWAETAPEEDLTRLGEELAG
FT                   ALGQYDLLVADLWLGDLLGHQGREGVPPEVLTAGQAYLRRVDRLLTGAVQAGARVIVSS
FT                   DHGNLEDLSVKSHTLARVPFGAAGLPLPPVADIVQGGGQIGHWLGLP"
FT   gene            complement(121944..122570)
FT                   /locus_tag="DR_0123"
FT   CDS_pept        complement(121944..122570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0123"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /note="similar to PID:1054860 SP:Q56320 GB:AE000512 percent
FT                   identity: 57.92; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09715"
FT                   /db_xref="GOA:Q9RY28"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY28"
FT                   /protein_id="AAF09715.1"
FT                   /translation="MSEGKVRVKVCGTTTLPDALHAAAAGADALGFIFAPGSKRRVTAS
FT                   QARGISLNVGPSVARIGVFMGQSLDEVLRTAEAARVSAVQLHGPLPGVYVAAVAGYYPV
FT                   LRVLGPEELQAGNVQAATVQATPGVTLMLDAPQPGSGQPLDWAALVPHFPPGSWLAGGL
FT                   GPDNVAQAIATLRPAGVDAVSRLEASPGLKNPQAVEAFIDAVKRS"
FT   gene            complement(122563..122847)
FT                   /locus_tag="DR_0124"
FT   CDS_pept        complement(122563..122847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09721"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY27"
FT                   /protein_id="AAF09721.1"
FT                   /translation="MFRRHVPAEEPSRELDPDRELNFARTILQDRTFREVPDDEVLREA
FT                   ERLLFGWMTNETKLERPKLYDHYALVFLALIRKNRELEERIAALEAARE"
FT   gene            complement(122858..123373)
FT                   /locus_tag="DR_0125"
FT   CDS_pept        complement(122858..123373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0125"
FT                   /product="acetyltransferase, putative"
FT                   /note="similar to GB:AL009126 percent identity: 54.88;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09716"
FT                   /db_xref="GOA:Q9RY26"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY26"
FT                   /protein_id="AAF09716.1"
FT                   /translation="MAPFTIRRAVEGDAPAIAHIHVQSWRETYTGLISPEFLDRATNEA
FT                   ARQRREESWRATIAKNLEDVFVAEQGGGIVAFASVGPARDHPGYGSELMTLYSLKRVQG
FT                   QGIGKALLHAVIGQVQADGGDNLALWVLAANPTRQWYAAQGAREAGEKVDGELTEVRLV
FT                   WDRLTATA"
FT   gene            complement(123593..124531)
FT                   /locus_tag="DR_0126"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   PID:2351851 percent identity: 86.45; identified by sequence
FT                   similarity; putative;dnaJ protein, authentic frameshift"
FT   gene            complement(124556..125341)
FT                   /locus_tag="DR_0127"
FT   CDS_pept        complement(124556..125341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0127"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09722"
FT                   /db_xref="GOA:Q9RY25"
FT                   /db_xref="InterPro:IPR018668"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY25"
FT                   /protein_id="AAF09722.1"
FT                   /translation="MARHSALAQAERLEPLLTTNPLHGATLERIVTHLHDEYGWEELAR
FT                   RVPVKCFQNEPSVGSSLKFLRKTPWAREQVEAEYVKLARREDANPLIDALKRGQALDFT
FT                   GVSQTKLHAALGWMLRHVEQNAQNLQLYFLPTLAHIQDVNFWPDAEPLPLLNLAIDRSA
FT                   LGAGDYEPGVVAELLRRGADANDPRFWPPLLHTVDVEGQAYQSKTRAPRTDLFDLLLAH
FT                   GADPALEDSRGNTARSMAEAYGLRAVINKLNTLPAVSGS"
FT   gene            complement(125525..126190)
FT                   /locus_tag="DR_0128"
FT   CDS_pept        complement(125525..126190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0128"
FT                   /product="grpE protein"
FT                   /note="similar to SP:Q56236 PID:1449141 PID:1542949 percent
FT                   identity: 61.18; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09717"
FT                   /db_xref="GOA:Q9RY24"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY24"
FT                   /protein_id="AAF09717.1"
FT                   /translation="MFTNPFGRKKDMSDDQKKNNQPDTEADNAENIKFAADDTELRAGD
FT                   ETDADFEMPEGFPEMDENMFGQVQEMMAKLERVDELEKENADLKNRLGRLASDFEGYRN
FT                   RTTIESAEAHDKGVSKAAEALMPVYDDIDRALSLSVDDAAKLVPGMQAVQNKVLTIFGT
FT                   LGLEATGREGEQFDPQWHEAIQVVAGDEDEKIVQTYQLGFKMGDRLVRPARVVVSRKG"
FT   gene            complement(126272..128158)
FT                   /locus_tag="DR_0129"
FT   CDS_pept        complement(126272..128158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0129"
FT                   /product="dnaK protein"
FT                   /note="similar to PID:1813672 percent identity: 90.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09718"
FT                   /db_xref="GOA:Q9RY23"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY23"
FT                   /protein_id="AAF09718.1"
FT                   /translation="MAKAVGIDLGTTNSVIAVMEGGRPEVIVNAEGGRTTPSVVAYKGD
FT                   EILVGQIARRQAALNPAATLFEVKRFIGRRWDEVKEEAARSPFTVKEGPSGSVRIEVNG
FT                   KDLAPEQVSAEVLRKLVSDASAKLGNKITDAVITVPAYFDNSQREATRQAGEIAGLNVL
FT                   RVINEPTAAALAYGLERKGNETVLVFDLGGGTFDVTILELGDGVFEVKSTAGDTHLGGA
FT                   DFDYRIVDWLAGEFQKEHNFDLRKDKQALQRLIEAAEKAKIDLSNASETSISLPFITFD
FT                   PETRTPMHLERSLSRAKFEELTADLLRRVRQPVEQALSDAKLSAGDINEVILVGGSTRI
FT                   PAVKRIVQDLVGKTPNESVNPDEAVALGAAVQAGIIQGDSSLGDIVLVDVTPLTLGVEV
FT                   KGGMIAPMITRNTTVPAKKTEIYTTAENNQPGVEINVLQGERPMAADNKSLGRFKLEGI
FT                   PPMPAGRAQIEVTFDIDANGILHVTAKEKTSGKESSITIENTTTLDKTDVERMVQEAEQ
FT                   NAAADKQRKEKVEKRNNLDSLRVQAVQQLEEQEGAAQDAKDRLKAAADEAEEAVRSEDD
FT                   SKIADAQKKLEEELRSFMTANQASTQGQPEGTQAQANKADDDVIDADFKPAE"
FT   gene            complement(128314..129480)
FT                   /locus_tag="DR_0130"
FT   CDS_pept        complement(128314..129480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0130"
FT                   /product="coproporphyrinogen III oxidase, putative"
FT                   /note="similar to SP:P54304 PID:1303805 GB:AL009126 percent
FT                   identity: 52.45; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09719"
FT                   /db_xref="GOA:Q9RY22"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY22"
FT                   /protein_id="AAF09719.1"
FT                   /translation="MTFSAPAPTQLDPVVRHLYVHVPFCPSICPYCDFHVLTRQAGLVE
FT                   RYLERLEQEAAELAAAYAVDLDTVYLGGGTPSFLRDHELRALVESVQRHLGWGRAENTL
FT                   EINPGTVSTERAALWRSLGFDRASVGVQSLDDATLKFLGRRHDARQARDAVSRLIAQDF
FT                   RVSGDLITAVPGQPLDSDIHGLVELGVGHVSAYTLTIEPGTEFARRGVQVDEDAEREGF
FT                   ERTEELLAGHGFSRYEVSNYARAGQESRHNLSYWQGKTYLGLGPGAAGHYPVPTPGADA
FT                   LTLRRTNPHLHDWLVGQQGETLLVDPHEYVTDALFMGLRLRRGLDLADLTRRSGVDVAG
FT                   RYGLVIERQVRLGLLEHSGTNLRATAQGWWVLNRIVREFMEVDAAETA"
FT   gene            complement(129577..131229)
FT                   /locus_tag="DR_0131"
FT   CDS_pept        complement(129577..131229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0131"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09723"
FT                   /db_xref="GOA:Q9RY21"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY21"
FT                   /protein_id="AAF09723.1"
FT                   /translation="MERIAPLAKILAEANGIEWQQLNGTGAGGMIVEQDILDYLSRVMS
FT                   GEAEPPSTPVDAPPPDWTGEDLPGGGMFDAQMLSQAGVESDIADFVQQSRPAAPTLSQD
FT                   DFELDDDQDDQLLAPPAAPASSSPFDIPPVTPAAPTFASGPVPTDPVPVSPGPVNRIQE
FT                   THLPEPHLPEIPAVPTPAAAAPAAPASGGLGSLLSRLYQKDSDRPATPATPEPQPSSPT
FT                   PSSFGSQPSSAGLGGFNSEPVTPPAPTSPFNVPPVELRDEAPQAPLASSREPVLPAPTA
FT                   LMTAQVDVDELTPEQATPAPTPAPQFSVPAVPEASRFDAPATQEQPEEVVADAVPSKAV
FT                   SSESVSSEPAPVQETTAPTAPAPTEQTPEVQPAPIAAPQTETAPAAAPATPRDAVWFGT
FT                   YLRREAQVAQLHDLRQQLSEALEREVPLALLVARAAQRHAAGLGLGSVAMRDMDRGLTR
FT                   QMGGEVGSSVSLRDALLVTDQDFGGTPDLLVVDAGALDMDDLHYPDTLTLSVGRVQDGR
FT                   AALSLQGDVDPEKAARFLANVAQTLEKPVILLV"
FT   gene            complement(131392..132192)
FT                   /locus_tag="DR_0132"
FT   CDS_pept        complement(131392..132192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 56.31;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09720"
FT                   /db_xref="GOA:Q9RY20"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:6AQE"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY20"
FT                   /protein_id="AAF09720.1"
FT                   /translation="MDIDNYRVKPGKRVKLSDWATNDDAGLSKEEGQAQTAKLAGELAE
FT                   WQERLYAEGKQSLLLILQARDAAGKDGAVKKVIGAFNPAGVQITSFKQPSAEELSHDFL
FT                   WRIHQKAPAKGYVGVFNRSQYEDVLVTRVYDMIDDKTAKRRLEHIRHFEELLTDNATRI
FT                   VKVYLHISPEEQKERLQARLDNPGKHWKFNPGDLKDRSNWDKFNDVYEDALTTSTDDAP
FT                   WYVVPADRKWYRDLVLSHILLGALKDMNPQFPAIDYDPSKVVIH"
FT   gene            132288..133178
FT                   /locus_tag="DR_0133"
FT   CDS_pept        132288..133178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0133"
FT                   /product="lipase/esterase, putative"
FT                   /note="similar to GB:AL123456 percent identity: 52.61;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09724"
FT                   /db_xref="GOA:Q9RY19"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY19"
FT                   /protein_id="AAF09724.1"
FT                   /translation="MADAPQWKGGYARRVLPAASEHSHWPPPDLELLTDVPFSTHGLAL
FT                   DVLRPRARATEPVPAILHFHGGGWVKFGKWPVANTFLARAGFVTVSADYRLAPGATFPA
FT                   QLHDVKTAVRFVRAHAAELGIDPQRIGAWGVSAGAHLAALLGTVSGEEGPDGGWSSGGW
FT                   PGESSAVQAVGSVCGPLDFFDPAWNFGPEPFELLGGPFHERLALARAASPLEHVTPDAP
FT                   PFCLLHGIADDEVPVSQSRRMHAALQLMEGRAAGVLSELTELDGGHYINDTHQAEVEAR
FT                   LLAFFQRTLSFSPCC"
FT   gene            133386..133730
FT                   /locus_tag="DR_0134"
FT   CDS_pept        133386..133730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09730"
FT                   /db_xref="GOA:Q9RY18"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY18"
FT                   /protein_id="AAF09730.1"
FT                   /translation="MLDECRAEGFEVQPGDLGENVLTRGVDLLALPRGTRLHLGPQAVV
FT                   EVTGLRNPCAQIDAFMPGLLRVMVQPRPGGPPALRCGVMGIVLAGGEVRVGDDIRAEWP
FT                   AAPYHHLERV"
FT   gene            133766..134743
FT                   /locus_tag="DR_0135"
FT   CDS_pept        133766..134743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:P31125 GB:U00096 PID:1787813 percent
FT                   identity: 63.12; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09725"
FT                   /db_xref="GOA:Q9RY17"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY17"
FT                   /protein_id="AAF09725.1"
FT                   /translation="MSASAPASPLNARSLGLALLITLIWGVNFVVIKWSVAGASPLLVA
FT                   ALRFLLAAFPAVLFVPRPTIAPRLLWGYGLAVGVMQFGLLYLAIQLGMSAGMGSLLMQT
FT                   QAFFTALLAARFFGEKVMPWQAAGITLAFGGMALIGLTAGHDVPFFPLLLTLTAALGWA
FT                   ISNLVVKASPQANGFGLVVWSALIPPIPLALLAGLTAGWGPVMQTLTHSDWKFWAAVLF
FT                   MGLGNTVLGFGIWSGLIQRHGASRVAPLSLLVPVFGTLASALAFHEGFPPGKVLGAALI
FT                   AAGLVLHVFGGRWWRGAASQGLGRAQAEGRETYPPDNADGLEDR"
FT   gene            complement(134747..135130)
FT                   /locus_tag="DR_0136"
FT   CDS_pept        complement(134747..135130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 55.24;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09726"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY16"
FT                   /protein_id="AAF09726.1"
FT                   /translation="MGRFFCQHAGMTGPQIQIFGTKKSTATRAAERFFKERGVKVHFVD
FT                   VSAKPMSKGELTRFVQKFGVNALLDTEGKAYERANLAYLRTTEDSVVAKMLDDPALLRL
FT                   PLVRGGKVLSVGEDQEAWGKMLE"
FT   gene            complement(135167..136204)
FT                   /locus_tag="DR_0137"
FT   CDS_pept        complement(135167..136204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09731"
FT                   /db_xref="InterPro:IPR025579"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY15"
FT                   /protein_id="AAF09731.1"
FT                   /translation="MPTESVQSAVQAIQGWLDDPPGEAVVRQCIVLRLLLAAGFDIWNP
FT                   DEVHPEETNVTGSRADFLVRRGAGVFALELKGMGATLQARDYQQALNYAVSVGTRWAIV
FT                   TNGRVWVVLDERRGGDWEARVALKTEMGQEGHTFGEDLATLLDPQIWEKDRFEAALKTV
FT                   AQRQERRRDEERIRREKRPLVEAEQARYKHKISFEEAADIASRVGLITEAERDVLLAPT
FT                   ESLPVPRADSDEIVFYFNSGPAQATATYHRITGLWILKAGSTARREIAPYAKATAKRRE
FT                   QYLLDGTLKDDGTILTFEKDVSHKAPSSAASDISGGSEPGWDVWKDAQGRSAQFYRPPR
FT                   ETSAE"
FT   gene            136259..136738
FT                   /locus_tag="DR_0138"
FT   CDS_pept        136259..136738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1652047 percent identity: 64.04;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09727"
FT                   /db_xref="GOA:Q9RY14"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY14"
FT                   /protein_id="AAF09727.1"
FT                   /translation="MMNGQTPTQLRPLASGLSPDERSGAYLLHLSPLLGLLLPSIGHLL
FT                   GPVAAWWMLKSSPALDAQGKEVVNFQLTATVISLLLSVLAFVLIGAGMLGGLAGIVAPL
FT                   AGMLSMFGAVGALFAILLPLSLLLSVYPLVCMVLGLMRASEGQLYRYPLTIRFLS"
FT   gene            137279..138856
FT                   /locus_tag="DR_0139"
FT   CDS_pept        137279..138856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0139"
FT                   /product="GTP-binding protein HflX"
FT                   /note="similar to PID:1653117 percent identity: 60.78;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09728"
FT                   /db_xref="GOA:Q9RY13"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY13"
FT                   /protein_id="AAF09728.1"
FT                   /translation="MRREVGVLIDRRGRVISVSVADARGTEFPDLRLGENRLAGFHLLH
FT                   AHPRGGALSKGDLSTLFLKRLDAVSAIEVGNDGRPGLVHTAHLTPPGTVGEEEDWRILP
FT                   PAQPFEIDEFDLGAQVSALEEEIARAARTREAKKDHERALLVQIDGGEFDAEERLEELG
FT                   ELARTAGAEVVYKELIYRRNLKPGTLVGAGKLEELTSKAYHLDADLLIFGQELGPAQAR
FT                   EIEAATGLKVVDRTQLILDIFALHAQGVESRLQVELAQLRYMKPRLLGAGAQLSRIGGG
FT                   GGSAGGGAIGTRGPGETKLELDRRRINDRLSFLEKQLEGVSQRREERRKSRERNDVPVV
FT                   SIVGYTNAGKSTLLNSFTHAAEEPRRVLAENKLFATLRPTSRQGYIEGIGQVIFTDTVG
FT                   FIRDLPKDLSRAFRSTLEEIGDADVLLHVVDAASPGAEQRLDAVNRILDDLGFRDMPTV
FT                   VALNKADRAEPEVLAREQERTGGIPVSALKNIGLTELKEALGDAVASVQRAELARQEEA
FT                   RAARVEWR"
FT   gene            139302..139778
FT                   /locus_tag="DR_0140"
FT   CDS_pept        139302..139778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0140"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09733"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY12"
FT                   /protein_id="AAF09733.1"
FT                   /translation="MRPPRWRAAASGLTLALLGFSSAQAQTGSASYCTGTFATISGGTA
FT                   TGSGRVVWHNPFTGYSKTLTNGDTSDFSSYGFNGSALNNAAVDPDTGNIYWIDRGNDNA
FT                   STSTRQNRYGIVWRYNPFTGSKTNLGYLNAGSVGDNFSSMLSQTAKTNSCPHQA"
FT   gene            139792..140624
FT                   /locus_tag="DR_0141"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   PID:1162996 percent identity: 50.66; identified by sequence
FT                   similarity; putative;transposase, putative, authentic
FT                   frameshift"
FT   gene            141046..142839
FT                   /locus_tag="DR_0143"
FT   CDS_pept        141046..142839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09732"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY11"
FT                   /protein_id="AAF09732.1"
FT                   /translation="MIYRDIVDSLPAAPGGGQMVVSTSPNYQAVCVNSSGGIISNNSGY
FT                   NSLSYESSDGSGATVPPAPTAGATQWSVPGNTIIPAGTCRFSFDVTLPRAGTYKNVIPA
FT                   NIRTSGGNDADGAQASITAFAGPTVTKAYSPKSILGDGKATSTLTITLNNSSPAAVSLT
FT                   APLTDNIGNGLEITGVTTSCPGTATFSGTTITYPSGATLNPGTCTITATVRSATAGSYP
FT                   NTISAGALQTTVGNNAAAASDTLTVTSFTRLTITKTHASQNFTAGQTGTYTVTVSNASG
FT                   AAATSGALSLSDLLPSGMSFNSVTTTAGGSFGTRPASGATGRVDWTFTPSTPLAAGQSL
FT                   TFTVTVNVANTVANGATLTNYASVGGGGDPDVLPTPGATCTGEQCASDPTTVNRITQLT
FT                   LRKEFPQGAAGPKGFGNYDYATITISQGSSTLTTATTSSIANPGPVATDTINITPGANY
FT                   TLREVLKNDAVFSGPDSYDSRYTCTNATTGSTTVMPTNSSGMSFTLTPQAGDIITCSVG
FT                   DNFTFSRSWRAKSLDEHLQDRHELLGFPPEGIHEMLSTVPHQTDRSPTMLQNGDGPGLA
FT                   QPDPQAQTEHPSQCHQSEESL"
FT   gene            complement(142588..143571)
FT                   /locus_tag="DR_0144"
FT   CDS_pept        complement(142588..143571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0144"
FT                   /product="transposase, putative"
FT                   /note="similar to PID:1162996 percent identity: 51.27;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09729"
FT                   /db_xref="GOA:Q9RY10"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY10"
FT                   /protein_id="AAF09729.1"
FT                   /translation="MIAARSVNHHDLSAHMPGMSTPQGKKRRADRTFRDEQLDRGFFIA
FT                   LLVVHLPPGKVLLSLDRTNWEHGETPINFLVLGAVVHGFTLPLIWVPLDQSGNSHTYAR
FT                   MWLVLKLLRAWPAKRWLGLVADREFIGAEWFRFLRRQGIKRAIRIRQTDMLDDMKGKEW
FT                   FEHVQHGHFHEIGEKVFVFGELMRVVATRSPTGDLVIIATDFSARKTWRLYKQRWSIEC
FT                   TFSSFKKRGFDLERTGMTERSRLQRLFGLVTLAWMFCLRLGVWLSQTWPIPVLKHGRRA
FT                   VSLVRHGAQHLVDALRWKPQQFMAILEVFIQAFCPPGAAESEVVTY"
FT   gene            143750..145225
FT                   /locus_tag="DR_0145"
FT   CDS_pept        143750..145225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09739"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY09"
FT                   /protein_id="AAF09739.1"
FT                   /translation="MPSGTTSNRSCHLLSSSTSGRLANVNLATYSASTVTSSAANTSDL
FT                   ASCYYPNLAPNITATKSVRKVSGSAGSAILPGDTLEYTIVTRNSGTLSSSTTTLQDTVP
FT                   AGTTYVVGSTQLNFSSVTDRTGVTSNDQMPYSVATPISSPTAASGIVRVDNTPNTITSS
FT                   ATDPDNREAVVTFRVTVNSGVTEIRNRATAVHVDGSVSTNETATSAGAPALSVVKSVDS
FT                   SYVKVTLPDPANSTALALTPQQVVYTITVTNTGTATANNVKVTDTLPTGMNLVSATLAR
FT                   STSTDAKGVTTYGTASALSSSTAAPNLTFDVGSLSATEPGHSAQLRVTVTPSVTPNSNQ
FT                   AAYLNTARSSATSVAEVTSAQVRTDVIYTRLFKQVHNVGSNPPAEVPQQSPAWSDKSQG
FT                   LPGEALEYCIDFYNYGSVALNNYVVKDVVPANTTYVVGSATVKTGTMGTTPLQTFAGAS
FT                   VGEAKRSGDGDHRRSRSPGPGQLVLPRPDSVVA"
FT   gene            145257..146045
FT                   /locus_tag="DR_0146"
FT   CDS_pept        145257..146045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:2052145 GB:AL123456 percent identity:
FT                   57.20; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09734"
FT                   /db_xref="GOA:Q9RY08"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY08"
FT                   /protein_id="AAF09734.1"
FT                   /translation="MGAFLRRTLSPMFDSHTHLDYLDDPASARGELGLTGMVCIGASAE
FT                   HARNAVALAEQFGDVWATVGLHPGDVEEDSPDTRAAIEALLDHPRVVGIGESGLDDYWN
FT                   DTQRPAQLAAFEWQLELARRSGKPLVIHTRDKPGQDSAHRGVIETLRDWPDVQVILHCF
FT                   TGHAGLLACGLERGAYFGFAGNVTYKNAVEIQAAAQQVPLDRLLVETDAPFLAPVPKRG
FT                   KPNRPGYVRYTLDFVAGLRGLNPAELERVTDENARRVYGI"
FT   gene            146086..146159
FT                   /locus_tag="DR_t06"
FT                   /note="tRNA-Arg-1"
FT   tRNA            146086..146159
FT                   /locus_tag="DR_t06"
FT                   /product="tRNA-Arg"
FT   gene            complement(146367..146879)
FT                   /locus_tag="DR_0147"
FT   CDS_pept        complement(146367..146879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09741"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY07"
FT                   /protein_id="AAF09741.1"
FT                   /translation="MRHREHVLFDRNNVRAVAPIPLFLYSRPWVRELPYTSMVLASFSS
FT                   ELYLKGILLMHGIQPKHTHNPKDLFSRLPDSAQTEIAKHNHTTFSIDEILETSVGNFQK
FT                   IRYMRLTPVGFVSFSTLLVEILHRYVTDNFEDHGQRYAWEDFILPTDNNGSCSFVVVTE
FT                   GDQDLAV"
FT   gene            complement(147105..149846)
FT                   /locus_tag="DR_0148"
FT   CDS_pept        complement(147105..149846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0148"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="similar to SP:P96142 PID:1814011 percent identity:
FT                   72.91; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09735"
FT                   /db_xref="GOA:Q9RY06"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY06"
FT                   /protein_id="AAF09735.1"
FT                   /translation="MTDPHTTTLPTQFDPTGIEPKWAARWRSEPFRADATSGKDPFTIV
FT                   IPPPNVTGNLHLGHALDNTLIDTLIRYKRMAGFEALYLPGMDHAGISTQVVVERQLKDA
FT                   GTSRHDLGREAFLEKVWEWKGKSGGMILDQLTRLGVSADWTRERFTMDEGLSRAVRTQF
FT                   VKLYHDGLAYRGERIVNWDPASQTTLSELEIDREVRKGKMYTLSYKLENSAERGSNGET
FT                   GEIRIATVRPETIFADQAIAVHPEDERFRHLVGQKARIPLTDRWVPIIADEAVEMEFGV
FT                   GALKITPAHDPTDFEVGERHGLERPSVIDLDGNLTRDELVPAEFQGLERFAARKAVVKA
FT                   LEESGDLLEQKDHDTAIGLSERTKVPVEPIISEQWFVKMKPFADQVLEGLDKGEIKLVP
FT                   ERYTKVNRDWLENIRDWNISRQLWWGHQIPAWYDKEGNIYVPDPENPELDCDQDPRYAH
FT                   LNLRRDPDVFDTWFSSNLWPFSTLGWPDTDSEDFRKFYPTQVLVTGYDILFFWVARMQM
FT                   AGYGLTGQAPFSTVMLHGLYLDAKGQKMSKSKGNGIDPLELFGQYGVDACRFAFTFLST
FT                   GGQDIKHDARRFEQGRNFANKLWNATRFALMRLGEARIEGSDDLSAYVRAAVTLPDGVL
FT                   LRSKDVLAQLKERDDLTLADRWIISRLNDVTAEASAQLDAFDIGAAIRTLYSFTWDEFC
FT                   DWYIEAAKPELASGNLGTMATLKVVLEHVLKLLHPFMPFITSELYAALGHRRQIAVHSW
FT                   PQPDAALHDAEATKAFDALRSAVDSARSLKSELGLSPQDRLNVAVDGDLADVVRQNARV
FT                   VEGIARVNLVPALEGRTLSQVAPGVTILAPLEGTVDIADWVKKQQKRLAELDKQIKQAQ
FT                   GKLNNEGFVARAPAEVIEEEKRRVADFGAQKERLEGVLAQLG"
FT   gene            complement(149932..150543)
FT                   /locus_tag="DR_0149"
FT   CDS_pept        complement(149932..150543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0149"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to SP:P37677 PID:466718 GB:U00096
FT                   PID:1790005 percent identity: 50.34; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09736"
FT                   /db_xref="GOA:Q9RY05"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY05"
FT                   /protein_id="AAF09736.1"
FT                   /translation="MRPIQRKRVPGLNAWEARWYHGTKWVRVSSANGKSRRARRFSLMV
FT                   LGGWVMERAQHNLRFTELARARAYAQAHGLRQKAVCHIVRRGTELLVFDHVPDGGAGVQ
FT                   VVAGGLEAGETPEQAALREAGEETGQDGFQVVGFLGSAVWLNTEHAKRELRHFVHLTAP
FT                   DDLPDTWQHCADGHLFSFRWEPLHSARVDWEMDAFLPELG"
FT   gene            complement(150752..151273)
FT                   /locus_tag="DR_0150"
FT   CDS_pept        complement(150752..151273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09740"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY04"
FT                   /protein_id="AAF09740.1"
FT                   /translation="MISGDLSVFPLLPVLQMLLVSGRGGVFTVDHPRGGELWFEHGEVL
FT                   HARSGGLSGEAALQLLASVNGGTFTFEPGATPPERTLSLKQDAALHWLLGETDAWAPLL
FT                   QVLPDWDRPLHFTARWTDQQPVTRDQYRLLSRVSPGTSLRTLVEQSGLLPRTAAGLYAP
FT                   FVSGGLLDFG"
FT   gene            complement(151342..152547)
FT                   /locus_tag="DR_0151"
FT   CDS_pept        complement(151342..152547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0151"
FT                   /product="NifS-related protein"
FT                   /note="similar to GB:U00096 PID:1742766 PID:1742773
FT                   PID:1787970 percent identity: 50.13; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09737"
FT                   /db_xref="GOA:Q9RY03"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY03"
FT                   /protein_id="AAF09737.1"
FT                   /translation="MQTAGPITREALRTQFPSLAGGRAYLDNAAGGLLPTRSIQAVTEH
FT                   LTRFGATNAMPGHAPGQQIGQLKARAREGTALFLNAEAPDVALGPSATALAFRLAAAFA
FT                   RLWGPGDEVIVSGLEHEANASPWRELERVGVTVKVWHARAPEMRLHPDDLAALLSPRTR
FT                   LVAVTAASNVLGVAPDIAAITAQVRAAGGWTVVDAVHAAPHLLPDVQAWGADFVTFSPY
FT                   KVFGPHLGGLWIRPELRPQLPWPRLSFVEDGDITGIEHGTPQYELLAGWLGTLDYLREL
FT                   GGGDTLTRAALVAAFEQIAALERPVTEALLTGLLARPYVTVYGPQTLEGRVGTVAFQVQ
FT                   GEAPLDTALRLSAQGVDVAAGHFYAVQPLRDLGLYPDGVARASLAHYTSEEDVARLLAA
FT                   LG"
FT   gene            complement(152616..153449)
FT                   /locus_tag="DR_0152"
FT   CDS_pept        complement(152616..153449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 41.95;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09738"
FT                   /db_xref="GOA:Q9RY02"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY02"
FT                   /protein_id="AAF09738.1"
FT                   /translation="MAKQDTQLLGSANPTELKTPFFQVPTHHRAFSLGVMALPTRYTDA
FT                   GCVMATFEVDWDAANALIEAPDLDLVRLPNSKALMNVVVYEYRRLTNGTPYNEAGIALL
FT                   VNPQGYPLPADPQAALDLPADRRQLGDYIVDLPVTTAPACKAGIDLWGYPKFVTNIDFA
FT                   LQGKSFAGTVHDPEREDEFILKLEGEAGAEKRLDDWQDLVLYSKFEDQLFRATSVTRSD
FT                   EGRSAEPGTFVLTVSPTSLHPMATRLRQLIGDTATPTAVSYTPHFQLRLNEGVGI"
FT   gene            153816..154889
FT                   /locus_tag="DR_0153"
FT   CDS_pept        153816..154889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0153"
FT                   /product="riboflavin-specific deaminase"
FT                   /note="similar to GB:AE000657 percent identity: 64.83;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09742"
FT                   /db_xref="GOA:Q9RY01"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY01"
FT                   /protein_id="AAF09742.1"
FT                   /translation="MNTEHPPDAEYMQLALNEAAKGLGRTSPNPPVGCVIVRDGEIASE
FT                   IVGRGFHPKAGEPHAEVFALREAGERARGATAYVTLEPCSHDGRTPPCADALIAAGVAR
FT                   VVVAAGDPNPQVNGRGLEKLRAAGIEVATGVLEAAAVRQQAGFRSLVTRGRPHVIYKYA
FT                   MTLDGKVAALNEGNGPVSGPEARARVMAWRNEVDAVAVGARTALLDNPQLNVRGLDGGR
FT                   DPRAVLFDPEGHLPASARAVREGTVLVLREGRSTPLERDPRVTVLHAHSLQGALEQLAG
FT                   LGVATLLLEGGPTLASAFFEAGLIDELRVFVAPKLLGAGLSPLLAPVRSMHAATELAVE
FT                   RVEVVGNDVLVIGGLSV"
FT   gene            154966..155610
FT                   /locus_tag="DR_0154"
FT   CDS_pept        154966..155610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0154"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="similar to GB:L11391 PID:496180 SP:P51961 percent
FT                   identity: 66.50; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09743"
FT                   /db_xref="GOA:Q9RY00"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY00"
FT                   /protein_id="AAF09743.1"
FT                   /translation="MFTGIIEQIGRVTHAAEQNGNLAVTIAPTQMWADLVLGESIACGG
FT                   TCLTVTGWDEQSFCVDLSRETLAKTAPHWEAGQEVNLERAMTAQARFGGHIVSGHVDGV
FT                   GEVLEVREEPGAYTMRVRAPRSLAKYLTPKGSVTVDGVSLTLVDVGGPAGSRPEWPLDE
FT                   FTLWLVPHTLEVTTLKHWRAGTRVNLEADQVAKYVERLLAVGAASPAEVQQ"
FT   gene            155607..156821
FT                   /locus_tag="DR_0155"
FT   CDS_pept        155607..156821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0155"
FT                   /product="GTP cyclohydrolase
FT                   II/3,4-dihydroxy-2-butanone-4-phosphate synthase"
FT                   /note="similar to GB:AE000657 percent identity: 75.56;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09744"
FT                   /db_xref="GOA:Q9RXZ9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ9"
FT                   /protein_id="AAF09744.1"
FT                   /translation="MSDSITLSTIPDLLAELRAGRPVILVDDENRENEGDLLMPAATAT
FT                   PQWVNFMAREGRGLICVTLTPERARRLDLTPMVGAGAYGQGTDPNGTAFTVSVDHSSNS
FT                   TGISAYDRAATIAALLEDTSQPTDFRRPGHIFPLVARPGGVLRRAGHTEAGCDLARLAG
FT                   FAPVGVICEIMGDDGEMSRLPDLLAFGEKHGLKVGSIEALIAYRMEHDPFMEPVAEAEL
FT                   PTRFGDFRLIGFQDTLSGAEHVALVMGEVTPEPLLVRVHSECLTGDAFHSLRCDCGPQL
FT                   DAALQAIAEEGRGAVIYLRQEGRGIGLLNKIRAYALQDGGADTVDANLQLGLPADARDF
FT                   GIGAQILHLLGARKLRIMTNNPRKLHSLSGFGLEVVERVPLHVGEDPHNAGYLRTKREK
FT                   LGHLR"
FT   gene            156916..157383
FT                   /locus_tag="DR_0156"
FT   CDS_pept        156916..157383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0156"
FT                   /product="riboflavin synthase, beta subunit"
FT                   /note="similar to PID:1173519 SP:P50856 percent identity:
FT                   70.59; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09745"
FT                   /db_xref="GOA:Q9RXZ8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXZ8"
FT                   /protein_id="AAF09745.1"
FT                   /translation="MQRIEATLLAHDLKFALVSTRWNHLIVDRLVEGAELAFVQHGGKT
FT                   ENLDHFLVPGSYEVPLVARRLAETGRYDAVVCLGAVIKGDTDHYDFVAGGAANGILNTS
FT                   LHTGVPVAFGVLTTDTVEQALNRAGIKAGNKGGEAVLAMIETANLLKQIER"
FT   gene            157421..158962
FT                   /locus_tag="DR_0157"
FT   CDS_pept        157421..158962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0157"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ7"
FT                   /protein_id="AAF09750.1"
FT                   /translation="MLRKALSHEGRGSKTQGILMSNALRFGFFQSIEQARCAEGGARHR
FT                   TFAQERPARRAGAVQAQFAAQWAVKRQRLLEAGVGPGGRGKYLLRDGLGGAEVGFGLFH
FT                   LRFFGVVHVEAHLAPGPGKDIHLAQQPRHVGGHVAGVHPVHGVGEHHLTGAHGAEFFHV
FT                   ALALQQELAVGGDNQRGALRAFPGHQRHAQQARQCPAQHLRIALGDRPDDGRHLPHVLQ
FT                   ELAQLVQNQRHFVGAAALVHVAPAGHLQRASAHALVHVVQNRRAVLHKMPLADGPLGQR
FT                   AGQAGPGRGLEAGEHVAQPLGTGGVVFPFGDRHLRGLSRQLAGPVRLAQHQLGAGEFHL
FT                   SPVGKRVGAAQHLGGGLNLEIPPLGFRQGQRGDRVPAEFEGPLEKGLRQRLIGLREVHP
FT                   EVEQRLQRLALGGRLKQRGFFLGAHCGQQFGGERVGGAVFGLLGQGLLQGAQGALGVAR
FT                   PELLTGAAQRFAFTGRGIRFSPEHACTLAGTRCPALGHMAQPALSTTLTEPENRP"
FT   gene            159143..160204
FT                   /locus_tag="DR_0158"
FT   CDS_pept        159143..160204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0158"
FT                   /product="branched-chain amino acid dehydrogenase"
FT                   /note="similar to GB:X79068 PID:483472 percent identity:
FT                   60.65; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09746"
FT                   /db_xref="GOA:Q9RXZ6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ6"
FT                   /protein_id="AAF09746.1"
FT                   /translation="MPSAAPGGTRMLILDEMQARGHESLKLLHHAPSGLRGVLAVHSRV
FT                   LGPAIAGVRLREEDEELAVRGALALSESLTLKAALAGLNYGGGACVLLMPEAGVEDPHA
FT                   REALFRALGRQVQHMNTRVVLTEDIGVTPADIAFVAQETPATLGMNTDTSSVTGYGVYR
FT                   GMKAAAKHALGAESLRGVRVAILGVGAVGRTLAQHLSREGAKLTVADFRPDRAQALAEE
FT                   LGHVTVVPVGEIFDVPCDVFAPCGFGHSVQSADVPRLQCRLIAGGEHHPLTRRGEEAVK
FT                   EAGIMYVPDFAINSAGLIAAATGVNMDQAGERVYQTVSRIMSVATQYGKPPHVVARKMA
FT                   ERRIDLIGSLVHV"
FT   gene            160201..160833
FT                   /locus_tag="DR_0159"
FT   CDS_pept        160201..160833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0159"
FT                   /product="uridine kinase"
FT                   /note="similar to GB:AL009126 percent identity: 70.73;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09747"
FT                   /db_xref="GOA:Q9RXZ5"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXZ5"
FT                   /protein_id="AAF09747.1"
FT                   /translation="MSGPGTPFVIGVAGGSGSGKTTVTRRVIETVGREGVAVLNQDNYY
FT                   RDQSDIPFESRLHTNYDHPAAFDWALLREQLDALLAGVPIEMPEYDFTQHTRAAHTTRV
FT                   LPGRVVVLEGFFALYDEELRSRMGLKVFVDADADVRFIRRLLRDTQERGRTPESVIEQY
FT                   LGFVRPMHLSFVEPTKRYADVIIPHGGMNEPALDMLAARIRVMAQRD"
FT   gene            160878..162800
FT                   /locus_tag="DR_0160"
FT   CDS_pept        160878..162800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09751"
FT                   /db_xref="GOA:Q9RXZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ4"
FT                   /protein_id="AAF09751.1"
FT                   /translation="MMWISFNRLRISGVTDPLRSPAPVVPTGPARPSLVPPPNWHPRTP
FT                   LLLGLVFLSLIPALILTFQRVQFEQSRKVTALVMDYPALVIQARRYGQDPQALLNRYKA
FT                   LGVNGVALYEDTVASLQQRGEILLKNGYDLADKFPGAPVKPNAVYMRSVVPGVAESLPA
FT                   RYTIPTHTVTVGGQSWLEWPSDPSYLPAGPNRAQVAEFQRQGMVLVYRPYNDEARPVSQ
FT                   VGTDWPAVPYVAFTDDAVIGARTPELLEQVDRAMGQRIPAVIEGNIQDGLEDLVLTHGG
FT                   VRLFALAPSWQNQLTPEEIASKYNLAARERSQQLLYLRPFPTINETTDMLARLQELMKN
FT                   SGIKVGMPVTTAFEPSPVLRWLSIIGPLAALLLAGLSLPLRRLGLLGAAGTLLLCLGLN
FT                   YATPLAGFALVAAVTFPALGLLLRRSRITDWFIATGLSLVGVVFVSALGATPDSMLGLH
FT                   PFRGVGLTLLLPLAMVAASFLPKQDIRKTVSDVYNAPIKLGDIAVMGLGLALLGLVYSR
FT                   RGNATGGSVTEFESSLRQNVQDSMVRPRFKEVAAHPLAILGLSGKLPGYFSGLMLLGGT
FT                   MGQASILNTFSHFHTPFLISATRCFLGLGLGLLIGLLLVKLFDVLAGFWRSYRPDAAVG
FT                   PRARA"
FT   gene            162811..163788
FT                   /locus_tag="DR_0161"
FT   CDS_pept        162811..163788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1652052 percent identity: 50.67;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09748"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR019896"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ3"
FT                   /protein_id="AAF09748.1"
FT                   /translation="MKAVVSGYYGFGNTGDEAIALAITRELKKQGIDPVLLSNDPAESA
FT                   RLYGCEAVARMQPLDVGRALLRADLLLSGGGGLLQDKTSSRTLTYYLGVIRMARLLRKP
FT                   VFVFNQSVGPLSEAGRRQVQRGLRGVQAVVRDRGSQELLGQLGVPARLGGDPALLLRPS
FT                   AGLERDMSTVVIAPRGDVTETLAPLREVTALLRSRGRRVIALSFMPEQDDEAARSLGAA
FT                   EVLSTRDPQLALDTIARSGFVIGVRLHALILAAAAEVPFAGVAYDPKVQGFCDDAGAPV
FT                   FPVPPDAADLTAHAYERATPDWSAVEDMKFRAMESFAWLRQRGN"
FT   gene            163821..164342
FT                   /locus_tag="DR_0162"
FT   CDS_pept        163821..164342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09752"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ2"
FT                   /protein_id="AAF09752.1"
FT                   /translation="MAGLSCRRRRMLAGAPGYTRAMRKTLAWMLLLGSASLASACPVKA
FT                   GTFANGTIKSIPAGLKPECGILYRLMKTGVASEMGAGGWFELYSSPTPVNLSALESSVA
FT                   KQGYTSVSTLKEAKDSIAGMQNEFRSMIGKDARTDGRFLISNKSNQAMMLLQIGVPGDN
FT                   LIIVLAMPTK"
FT   gene            164359..166179
FT                   /locus_tag="DR_0163"
FT   CDS_pept        164359..166179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0163"
FT                   /product="ABC transporter, ATP-binding protein, MsbA
FT                   family"
FT                   /note="similar to GB:AL009126 percent identity: 57.83;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09749"
FT                   /db_xref="GOA:Q9RXZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ1"
FT                   /protein_id="AAF09749.1"
FT                   /translation="MSQPAQPSVTRRLYGLLTPYRTAVGAGLLLLLGSVAAELYPPLVW
FT                   IRVVDQGIPARDWGLIGGQLAVLVGVFALQQVLSAWRGVLLERAGQQFTLDLRTAVYRK
FT                   LQSQSADYFETQRTGDLLVRVTGDVDALQDVLVRGTDSVIANALRLVGVIGIFIALQPL
FT                   LGVLTTLPMLAVGLLLWNYGKTVRPAYRAARARLGELSALIADRLAGIRVVQGFAREEA
FT                   EAARVEALGRELYREQARAVALRNRAFPVARFVGNLGNVIMLGGGAWLILAGQFTLGGL
FT                   LAYRGYGRYFYGPIDDLVNISDLLQRAEAAGRRVFAVLDAPVTVADPAHPKPLPTPVRG
FT                   ELHFDNVTFGYDSASYDSASSDPTQPILRGVTLHIPAGQRVALLGASGAGKSTLLGLVT
FT                   RQHDPQSGRVLLDGVDVRDVALAELRTAAAVMPQDTFLFHDTVLENVRYARPDAALAEV
FT                   EEALRAAYALDFVRALPQGLETLVGERGVRLSGGQRQRLAIARTLLARPALLLLDEPTS
FT                   AVDAESEAQVVAALNDLMQGRTSLTVTHRLSLARAADRVLVLDGGVVVEDGPPALLRTR
FT                   GGPYARLEQVAERLERGEVAVISEVVNSSL"
FT   gene            166315..167232
FT                   /locus_tag="DR_0164"
FT   CDS_pept        166315..167232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0164"
FT                   /product="endo alpha-1,4 polygalactosaminidase, putative"
FT                   /note="similar to GB:D14846 PID:286165 percent identity:
FT                   49.11; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09753"
FT                   /db_xref="GOA:Q9RXZ0"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ0"
FT                   /protein_id="AAF09753.1"
FT                   /translation="MRLPLTVLLPLSAVLLASCGGTPSPVAATVFPATPAAQPTRTLAA
FT                   QATPPLRLPPAGKLAWDWQIGAATEAKVALPAGVSLLDLDGFETSAAKVADLKAQGVYT
FT                   VCYLNVGSYESYRPDAAQYPDSLKIQTDPNWPDESFVDIRDVFREGGVLAGILDRRLAL
FT                   CAAKGFDAVEPDNLQNDQNVTSGVISRQDQLDFNGWLADRAHAHGLAILQKNGPDYVLQ
FT                   ADRQGRLMVDLFDGVLNESCQRYKECGPLTEYVRRGKLALNVEYRQADLNCATMNSLGV
FT                   NALFKDLSLVGKLQKAYKRVSCTG"
FT   gene            complement(167294..169261)
FT                   /locus_tag="DR_0165"
FT   CDS_pept        complement(167294..169261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0165"
FT                   /product="acyl-peptide hydrolase, putative"
FT                   /note="similar to GB:AL009126 percent identity: 56.01;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09754"
FT                   /db_xref="GOA:Q9RXY9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:5YZM"
FT                   /db_xref="PDB:5YZN"
FT                   /db_xref="PDB:5YZO"
FT                   /db_xref="PDB:6IGP"
FT                   /db_xref="PDB:6IGQ"
FT                   /db_xref="PDB:6IGR"
FT                   /db_xref="PDB:6IKG"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY9"
FT                   /protein_id="AAF09754.1"
FT                   /translation="MNNSETPAPGPDSLLALAFPSDPQVSPDGKQVAFVLAQISEEDPA
FT                   KPDKDFARPRYRSGLWLSEGGAARPLTHAETGRGDSAPRWSPDGQNLAFVRSAGEVKAA
FT                   LMLLPLKGGEARRVTHFKNGVSGPQWSPDGRFIAFTTTADTEDKRDERGEARVLTRPVY
FT                   RANGADWLPERPAALWLYDVEADKLREWYAPEIGIGALSWWPDSRGVLIVQSEDEWQAS
FT                   QWRQDVYDLPLPTADAPAAPQKLLDWNSAAHGLAPHPDGQRFALIGRPAGKGNTEHAHL
FT                   YLIENGQHRRLDTGHDHPVGDAVGGDCHVGAFPEGPRWLDGDTLLFSSTVRGSVGLFTA
FT                   HIGGGVKAYDHDPQGVISAFTANEHGVALIRESATRFPEVELNGQRVTDLHARFPFPVR
FT                   EPQRVTFETELGEGEGWVLLPEGEQKVPALLNIHGGPHTDYGHGFTHEFQLMAARGYGV
FT                   CYSNPRGSVGYGQAWVDAIYGRWGTVDADDLLNFFDRCLEAVPRLDAAKTAVMGGSYGG
FT                   FMTNWITGHTTRFQAAITDRCISNLISFGGTSDIGLRFWDDELGLDFSRRADALKLWDL
FT                   SPLQYVENVKTPTLIVHSVLDHRCPVEQAEQWYAALHKHQVPVRFVRFPEENHELSRSG
FT                   RPDRRLTRLNEYFAWLERWL"
FT   gene            169313..169567
FT                   /locus_tag="DR_0166"
FT   CDS_pept        169313..169567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0166"
FT                   /product="acyl-CoA-binding protein"
FT                   /note="similar to SP:P31787 PID:1323021 PID:1620454
FT                   PID:170970 percent identity: 66.09; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09755"
FT                   /db_xref="GOA:Q9RXY8"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR022408"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY8"
FT                   /protein_id="AAF09755.1"
FT                   /translation="MNFEQAQQEVNTLSKKPGNDVLLKLYALYKQGSAGDVDGKRPGGF
FT                   DFVGGAKYDAWAGLKGKTQEQAQQEYVALVEELKAKDGQ"
FT   gene            169878..170864
FT                   /locus_tag="DR_0167"
FT   CDS_pept        169878..170864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09762"
FT                   /db_xref="GOA:Q9RXY7"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXY7"
FT                   /protein_id="AAF09762.1"
FT                   /translation="MPSANVSPPCPSGVRGGGMGPKAKAEASKPHPQIPVKLPFVTAPD
FT                   ALAAAKARMRDLAAAYVAALPGRDTHSLMAGVPGVDLKFMPLGWRDGAFDPEHNVILIN
FT                   SAARPERQRFTLAHEIGHAILLGDDDLLSDIHDAYEGERLEQVIETLCNVAAAAILMPE
FT                   PVIAEMLERFGPTGRALAELAKRAEVSASSALYALTEQTPVPVIYAVCAPGKPPREQAA
FT                   SDEDAGPSTEKVLTVRASSSTRGVKYTLASGTPVPADHPAALALATGMEVREESYVPFR
FT                   SGRKMKAEVDAYPSRGIVAVSFEFDPARLGRKDSEQADRDEPQDAAQ"
FT   gene            170861..171730
FT                   /locus_tag="DR_0168"
FT   CDS_pept        170861..171730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0168"
FT                   /product="dihydropteroate synthase"
FT                   /note="similar to GB:L06494 SP:P26282 GB:U01376 GB:X68776
FT                   GB:X68777 percent identity: 62.16; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09756"
FT                   /db_xref="GOA:Q9RXY6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY6"
FT                   /protein_id="AAF09756.1"
FT                   /translation="MNWTGRIHELTFGFPVPSAEKGPNGWTVRWPGCRVMGILNATPDS
FT                   FSDGGQHLQLDAALATARRMRDTGVFILDIGGESTRPGAEPVDAATELDRVLPLIRALR
FT                   GEHVLLSVDTMKPEVAAEALRAGAHLVNDVTGLRDPAMIRVCADAGAAACVMHMQGEPR
FT                   TMQHQPVYSDVVAEVHGFLRERAAEVKSAGVPSVLLDPGIGFGKTLDHNLSLLRAVDDL
FT                   ASGPDPVLIAASRKKTIDLIAGVPEAADRDPGSLALHLHAARCGAALVRLHAAGEMVQA
FT                   LRVEAALA"
FT   gene            171755..172111
FT                   /locus_tag="DR_0169"
FT   CDS_pept        171755..172111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0169"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="similar to GB:D26185 SP:P28823 GB:M34053 PID:143411
FT                   PID:467467 percent identity: 62.18; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09757"
FT                   /db_xref="GOA:Q9RXY5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY5"
FT                   /protein_id="AAF09757.1"
FT                   /translation="MSRVVLEGLEFHAHHGVFAAEGVLGARFVVDAELHSPFAGIADDL
FT                   GQAVNYAAAYAAIREEVTEKTHQLIEVLADRIADRLLSDFSRLERVKVRVHKPFAPLPG
FT                   IFRDVYAEIEKERT"
FT   gene            172108..172623
FT                   /locus_tag="DR_0170"
FT   CDS_pept        172108..172623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0170"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="similar to GB:D26562 SP:P26281 GB:L06495 PID:146013
FT                   PID:473801 percent identity: 56.86; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09758"
FT                   /db_xref="GOA:Q9RXY4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY4"
FT                   /protein_id="AAF09758.1"
FT                   /translation="MTRAFIALGANLGDPQATLRRALTELGALGEVRGVSALYRTAPVG
FT                   GPPGQPDYLNAVAELETALSAPALLAALHALEADAGRTRDVRWEARVLDLDLIVYGEDV
FT                   SDDPALTLPHPRAWERGFVLAPLSDLAPSLAHPRTGEMVAQALRRVDLAGVEVSELSLC
FT                   WPELGSGE"
FT   gene            complement(172577..173269)
FT                   /locus_tag="DR_0171"
FT   CDS_pept        complement(172577..173269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09763"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY3"
FT                   /protein_id="AAF09763.1"
FT                   /translation="MNLEGVHPLRLGLCWCEMEQTSRSSSQQVTDTEVASALLDTRSRL
FT                   VLSAFLTPTSLSAAARDLGRPLNTVKYQWQKLRRLGLLKMVCDGRPPLYQAEGESFFIP
FT                   YELTPAHWPQDMLQLLHTEWNRRMDTALLSTAEDEARRHGVWGMQVRRQENALTLEHAA
FT                   WSAGWNFTRPQAPAVLDLLGELSLDFEQAKALQRDLLQLLAQYRRKPGSQPHLIRLTLT
FT                   PASTEKAH"
FT   gene            173249..174064
FT                   /locus_tag="DR_0172"
FT   CDS_pept        173249..174064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:Q50665 PID:1449319 GB:AL123456 percent
FT                   identity: 49.77; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09759"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY2"
FT                   /protein_id="AAF09759.1"
FT                   /translation="MDTLKIHGFSTGQIQVKSKFLRPEPQNLLGSLRSFLDRQYSAPLP
FT                   VWCWLIEHPSGLIVVDTGLTCTARSNWFSRTQTRLHYTEHDRLSRQMQRAGFDPAQVRV
FT                   LILTHLHIDHDRGMGDFPEAHLLVSARELRDYRSPLARLMGYSAPTWKSVPHAAPFLPL
FT                   AHGPFRESADVMGDGRVLLLPTPGHTPGHLSVLVRQPGHDILLAGDLTYSEQDLRTGRL
FT                   GGIVPSPHIHRKSMRQVRQLAQLRPLIYLPSHDPDSLRRLQRNQPFSLT"
FT   gene            complement(174119..175214)
FT                   /locus_tag="DR_0173"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   SP:P28367 PID:216335 PID:2331287 GB:AL009126 percent
FT                   identity: 66.01; identified by sequence similarity;
FT                   putative"
FT   gene            175469..175993
FT                   /locus_tag="DR_0174"
FT   CDS_pept        175469..175993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0174"
FT                   /product="ribosomal protein L13"
FT                   /note="similar to SP:P02410 PID:42855 PID:606170 GB:U00096
FT                   PID:1789626 percent identity: 76.98; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09760"
FT                   /db_xref="GOA:Q9RXY1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="PDB:1GS2"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXY1"
FT                   /protein_id="AAF09760.1"
FT                   /translation="MAFPDTDVSPPRGGPSSPAKSPLLRSFKVKTYIPKNDEQNWVVVD
FT                   ASGVPLGRLATLIASRIRGKHRPDFTPNMIQGDFVVVINAAQVALTGKKLDDKVYTRYT
FT                   GYQGGLKTETAREALSKHPERVIEHAVFGMLPKGRQGRAMHTRLKVYAGETHPHSAQKP
FT                   QVLKTQPLEVK"
FT   gene            175996..176397
FT                   /locus_tag="DR_0175"
FT   CDS_pept        175996..176397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0175"
FT                   /product="ribosomal protein S9"
FT                   /note="similar to GB:AL009126 percent identity: 71.43;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09761"
FT                   /db_xref="GOA:Q9RXY0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXY0"
FT                   /protein_id="AAF09761.1"
FT                   /translation="MAIQQPEQYYGTGRRKAAVARVFLRPGEGKIVVNGKEFQTYFRGL
FT                   LRAVNALQGFRETGTAGRFDAVITVTGGGPSGQADAIKLGIARALLKVNPDFRAQMKPK
FT                   GLLTRDPREVERKKYGLKKARRAPQFSKR"
FT   gene            176486..177910
FT                   /locus_tag="DR_0176"
FT   CDS_pept        176486..177910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0176"
FT                   /product="D-alanyl-D-alanine carboxypeptidase, putative"
FT                   /note="similar to GB:X64790 SP:P39045 PID:38767 percent
FT                   identity: 50.29; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09764"
FT                   /db_xref="GOA:Q9RXX9"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX9"
FT                   /protein_id="AAF09764.1"
FT                   /translation="MRRFLLLSFLLLPVAAQSSTPAPPAQATQPQPAPAPSVTLEREPL
FT                   PTGALAHTLAEVPRPVRTGLLVRDLNTGKVLVALDPDRPLVPASTMKLVTAAAVLYDRG
FT                   GAGGWWSTELTVPAPDTGKGHVSALTLRGSGDPTLSVSGTPNSLRALAEQAHTRGIRAV
FT                   DAVRIDTLPLDATSFEATELGLAMPAVRLREWENRPPTSAAEARRRLGATLIAELRRVG
FT                   ITVAHEEVTSAPAYRPYVPPPRQDEKGRPLPPDLLIPLSQRPEQGVASVRSGSPFPFLA
FT                   STLRPSDNLRAEALLATVAVRPGETGTLKSALKREQAILQRLGLDLSDVVLEDGSGLGR
FT                   GNRLTPRLLTGLLRELYTLPYPTAAQYGRELPPALYHARHNAFAELLPQAGTGEDVPDH
FT                   DGRGGTLARRLVGTGLDVRAKTGTLPGVSALAGYLTAKSGRPLAFAVLMNGPEDSPILT
FT                   LRALQDQAVRDIAAAF"
FT   gene            178048..178443
FT                   /locus_tag="DR_0177"
FT   CDS_pept        178048..178443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0177"
FT                   /product="transposase, putative"
FT                   /note="similar to GP:3426012 percent identity: 90.65;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09765"
FT                   /db_xref="GOA:Q9RXX8"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="PDB:2FYX"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX8"
FT                   /protein_id="AAF09765.1"
FT                   /translation="MKKGRGYVYKLEYHLIWATKYRHQVLVDEVADGLKDILRDIATQN
FT                   GLELVALEVMPDYVHLLLGATPQHVIPDFVKALKGASARRMFSAFPHLKQPHWGGNLWN
FT                   PSYCVLTVSEHTRAQIQQYIENQHAAE"
FT   gene            178430..179659
FT                   /locus_tag="DR_0178"
FT   CDS_pept        178430..179659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0178"
FT                   /product="transposase, putative"
FT                   /note="similar to GP:3426013 percent identity: 91.44;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09766"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX7"
FT                   /protein_id="AAF09766.1"
FT                   /translation="MLRNKAFVVRLYPNAAQAERINRTLGCARFVYNHFLARRIESYRQ
FT                   DGKGMIYAATDKALTLLKREEGTAWLAEVDKFALQQSLRDLERAYQNFFRTAKKSGKKV
FT                   GFPKFKKKRTGEAYRTQFTNNNIEIGEGKLKLPKLGWVKTRGQRDMQGKILNVTVRRIH
FT                   EGHYEASVLCEVEIPYLPAAPKFAAGVDVGIKDFAIVTDGKGEFEHHANPKYYRSSLRR
FT                   LRKAQKTLSRRKKGSARYGRAKTTLARIHKRVANKRQDFIHKLTTSLVREYEITCTEHL
FT                   KPDNMRKNRRLALSVSDAGWGEFIRQLEYKATWYGRLVSKISPYFPSSQICHDCGFKNP
FT                   AVKNLAVREWTCPNCGETHDRDENAALNIRREGLVAAGMSDTQNAHGDCIRPTSVGSGL
FT                   RSENHATSVV"
FT   gene            179684..180286
FT                   /locus_tag="DR_0179"
FT   CDS_pept        179684..180286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653620 percent identity: 62.98;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09767"
FT                   /db_xref="GOA:Q9RXX6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXX6"
FT                   /protein_id="AAF09767.1"
FT                   /translation="MQQQTGGRRRQIRRVVVATSNAGKVRELQGALAPLGWQCEGLGAV
FT                   TLPEETGSTYEENAALKACAAAMATGLPALADDSGIEVLALGGQPGVYSARFGNVNSDV
FT                   ERNVLLLEKMRRHTDRRAKFVSVLVLAYPDGKLEEYRGEVTGQLLEGPRGESGFGYDPL
FT                   FLPDGSELSMGEMTLEQKQAISHRGQALAALLAAHGA"
FT   gene            180279..180968
FT                   /locus_tag="DR_0180"
FT   CDS_pept        180279..180968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0180"
FT                   /product="RNA polymerase sigma-E factor"
FT                   /note="similar to PID:2062637 percent identity: 56.98;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09768"
FT                   /db_xref="GOA:Q9RXX5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX5"
FT                   /protein_id="AAF09768.1"
FT                   /translation="MREGHCAGRAVSYHGPTVTLPPDPPVPDPAAPDPSPADLPAPADL
FT                   LTEDAHAQLLTGDEAAWHRFISEYEGRIYGYLYRLEGNSEDALDLTQEVFYRAWRSIRT
FT                   FRPGERVLPWLYQVARNTQIESHRRKQHARFSLEEAHEDIGFEVTSEARSPVQAAESEQ
FT                   AQDRVQRALMRLAPEYREAVVLRFVEDLTYDEIARLQGVATGTAKSRVFRAKEQLAELL
FT                   ADVSDVH"
FT   gene            complement(181126..181494)
FT                   /locus_tag="DR_0181"
FT   CDS_pept        complement(181126..181494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09771"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX4"
FT                   /protein_id="AAF09771.1"
FT                   /translation="MLSALSLYQNPKWSRTPTVSNTGKGETQLQRASPKVTPFISSVGS
FT                   SKSQVRQYKSFSLSGFRRGHSQRPAAVSHSSAKAQFSSSGRTKMCGVVLLMSESVSAGQ
FT                   GKPFACCTSSPRGRPETR"
FT   gene            complement(181526..182992)
FT                   /locus_tag="DR_0182"
FT   CDS_pept        complement(181526..182992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0182"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="similar to GB:AL123456 percent identity: 72.27;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09769"
FT                   /db_xref="GOA:Q9RXX3"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX3"
FT                   /protein_id="AAF09769.1"
FT                   /translation="MSKITGFLEQPRVKEQYAPIDARLKHYHEFMLPLDSASARLQATR
FT                   CMDCGIPFCNNGCPVNNIIPDFNNLVFEDDWKAALDVLHATNNFPEFTGRICPAPCEAA
FT                   CTLNISEDPVGIKSIELAIIERGWQEGWVRPTPAEVKTGKKVAVVGSGPAGLAAAQQLA
FT                   RAGHDVTVFEKNDRVGGLVRYGIPDFKLDKSHIDRRIEQMQAEGVTFRTGVLVGDWDEN
FT                   SKITNLSKERVTPAELREQFDAVVLAGGSETPRDLPAPGRELNGIHYAMEFLPQQNRVN
FT                   AGDKFKGQIRADGKHVVVIGGGDTGSDCVGTSNRHGAAGVTQFEVMPQPPEQENKPLTW
FT                   PYWPMKLRTSTSHEEGAVREFAIATKEFIGKGGKVTGVRTVRVEMKDGKLEEIPGSEET
FT                   HKADLVLLAMGFTNPMQSVLDAFGVDKDPRGNVLAGTEEHGGYLTSVPGVFAAGDMRRG
FT                   QSLVVWAIREGRQAARAVDQFLMGESVLPR"
FT   gene            complement(183080..187927)
FT                   /locus_tag="DR_0183"
FT   CDS_pept        complement(183080..187927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0183"
FT                   /product="glutamate synthase, large subunit"
FT                   /note="similar to PID:1339950 percent identity: 71.96;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09770"
FT                   /db_xref="GOA:Q9RXX2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX2"
FT                   /protein_id="AAF09770.1"
FT                   /translation="MTSSARGADMEKHDQRETPAAGPQTGPQQPATAQEVRRATERGLY
FT                   ANAEHDACGVGMVAHIGGQKSHHIIAQGLKILENLDHRGAVGADPLMGDGAGILLQIPD
FT                   AFYRAEMSLQGVTLPPPGDYGVGMIFLPKEIASRRACEQELERAVIAEGQVVLGWRDVP
FT                   INHAMPMSPAVKEKEPVIRQIFIGAGPDTLVPDALERKLYVIRRRASNAILGLNFTHGQ
FT                   EYYVPSMSCRTIIYKGLLLADQVGEYYRDLQQPEVVSALAVVHQRFSTNTFPEWRLAHP
FT                   YRMVAHNGEINTVKGNFNWMRAREGILSSPVFGDDLGKLYPISYEGESDTATFDNAIEL
FT                   LTLAGYPMAQAAMMMIPEAWEQNALLDDRRRAFYEYHASMMEPWDGPAAMVFTDGRQVG
FT                   AMLDRNGLRPARYLQTRDGLVVLASESGVLPIPESQIVKKWRLQPGKMFMIDLEQGRIV
FT                   EDDELKLQFAQAKPYRQWVENTRLRLDDSEETGTVDEFAEPLLKRQQAFGYTQEDLKFL
FT                   MGPMAKNGEEGIGSMGNDSPLAVLSHRSKPLYNYFRQLFAQVTNPPIDPIRESVVMSLR
FT                   SFVGPRPNLLDINAVNPAMRLEVEQPILDFDDMARVRNIEAHTRGKFKAFDLDITYPAE
FT                   WGARGIEAKLATINAWAVDAIESGHNIIILTDKRVDRSRAAIPALLALSSVHHHLVKKG
FT                   LRMRTGLVVETGDAREVHHFAALAGYGAEAIHPYLALETITDLHTPIPGMPDLTEVTPE
FT                   KAIYNYVKAIGKGLSKIMSKMGVSTYLSYCGAQLFEAVGLQADFVQKYFYGTASQVGGI
FT                   GIFEVAEEAIRTHHAAFSGDPLMEKNLNAGGEYAWRAQGEEHMWTPDAVAKLQHSVRSG
FT                   HAGTYAEYARIINDQSRRHMTLRGLFDFKTEGRNAVPLEEVEPASEIVKRFATGAMSLG
FT                   SISTEAHATLAVAMNRIGGKSNTGEGGEDPARYERELRGEQFNEGETLASVLGGSRVEV
FT                   DYPLQPGDSLRSKIKQVASGRFGVTAGYLSSADQIQIKMAQGAKPGEGGQLPGGKVSEY
FT                   IGFLRHSVPGVGLISPPPHHDIYSIEDLKQLIHDLKNVNPRADISVKLVSEVGVGTIAA
FT                   GVAKAKADHIVIAGHDGGTGASPWSSIKHAGTPWELGLAETQQTLVLNRLRDRVRVQTD
FT                   GQLKTGRDVVIAALLGADEFGFATAPLVAEGCIMMRKCHLNTCPVGVATQDPVLRARFQ
FT                   GKPEHVINYFFFVAEEVRQLMASLGVRSFDDLIGRSDLLDMRAGIDHWKAQGLDFSRVF
FT                   YKPEMPAEVGTRHLTGQDHELDKALDLKLIEKCRPAIEHGERVHFLQDARNVNRSVGAM
FT                   LSGELVRARPGGLPDQTVFIQMEGTGGQSFGAFLAQGLTLYLIGDANDYTGKGLSGGRV
FT                   VVRPSIEFRGKAENNIIIGNTALYGATSGEAYFRGVAGERFAVRLSGASAVVEGTGDHG
FT                   CEYMTGGTVVVLGQTGRNFAAGMSGGVAYVYDVDGQFEKRCNLSMVGLERVQPEDEQLQ
FT                   SAVPHQLHNGKSDEAQLRELIENHHRWTGSSRASELLDDWDSALKKFVKVMPHEYARAL
FT                   RERTQADEGTVQAADTTRMQTGQPDNKFGGKGTLTK"
FT   gene            188132..188953
FT                   /locus_tag="DR_0184"
FT   CDS_pept        188132..188953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0184"
FT                   /product="enoyl-CoA hydratase, putative"
FT                   /note="similar to GB:AL123456 percent identity: 72.69;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09772"
FT                   /db_xref="GOA:Q9RXX1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX1"
FT                   /protein_id="AAF09772.1"
FT                   /translation="MDTTQLTAPGAYPGLAVTLHDGGILEIVIRNEKTLNSVDRRGHAA
FT                   LTHIWRDIDAASGVRCVLIRGEGRGFSSGGDFELIEEMASDFTALARVWKEARDLVYNV
FT                   VNCGKPVVSAIHGPCVGAGLAVALLADVSVAAKSARILDGHVQLGVAAGDHAAIIWPLL
FT                   CGLNKAKYHLLTGESVSGEEAERIGLVSLCVPDEELLDRAWAVARKLAAGSPTAVRWTK
FT                   YALNNWLRAMGPTFDASLALEFLGFTGPDIHEGLAAKRERREPRFMEDAPI"
FT   gene            189092..189472
FT                   /locus_tag="DR_0185"
FT   CDS_pept        189092..189472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09781"
FT                   /db_xref="GOA:Q9RXX0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXX0"
FT                   /protein_id="AAF09781.1"
FT                   /translation="MSFPLWLWLALGGAVGAVCRQAAVLLLAPLVARTGFPAAVLLINV
FT                   LGSFLLGLTLALTGRGVWPEAVRMTFGTGVLGAFTTFSTFSTELDGLLLRGQGGLALAY
FT                   AALSVGLGLTAAVAGRVLGARL"
FT   gene            189531..190781
FT                   /locus_tag="DR_0186"
FT   CDS_pept        189531..190781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0186"
FT                   /product="exodeoxyribonuclease VII large subunit, putative"
FT                   /note="similar to GB:J02599 SP:P04994 PID:148275 GB:U00096
FT                   PID:1788856 percent identity: 50.32; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09773"
FT                   /db_xref="GOA:Q9RXW9"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXW9"
FT                   /protein_id="AAF09773.1"
FT                   /translation="MTEPDSKPKKGRAGRKKAEPVRPPEQFLELAELLDYVGQVIARGV
FT                   PGGVWVRAEIASLTDRRHLYLDLVQAGEGGAGGVGEVAKCRATVWARERFALEAKFRGA
FT                   TSGATLSAGLKVLLFGTAEFHPQYGFSFNVLDISPEYTLGDAALRLEAMRAELVAEGSY
FT                   GLNRLLPVPTDFARVAVIAPREAAGLGDFRREADPLEAAGLVEFHYLEATFQGREAGAS
FT                   LLRAVAAARELHQEKALDALFVIRGGGAVTDLAWLNDLELARALATFPAPVVTGLGHAR
FT                   DDTLPDEVACLRTDTPSKAAAYLVRTVVNAAAQAQEAARTIRAEAARVLVEAEAAAAWA
FT                   RDRALSSAVRRVDAAAAEVDALMRQALGLTPQRTLARGYALVRDAAGQPVTRAAGARAG
FT                   EPLTLEWSDGSVPVRVE"
FT   gene            complement(191072..191740)
FT                   /locus_tag="DR_0187"
FT   CDS_pept        complement(191072..191740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0187"
FT                   /product="sanA protein"
FT                   /note="similar to SP:P33017 PID:405877 PID:1161522
FT                   GB:U00096 PID:1788466 percent identity: 67.89; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09774"
FT                   /db_xref="GOA:Q9RXW8"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW8"
FT                   /protein_id="AAF09774.1"
FT                   /translation="MGSASLTPVKTRIRWRRWAAGGVGALLAGVLLPQIVVPLAAWGRT
FT                   FDRPEDLPARHVGLVLGTSKYLASGRVNRYYLYRIDAAEAAYKAGKVRVLLLSGDNSSV
FT                   SYDEPTTMKEDLLERGIPAEQLVLDYAGFRTLDSVVRAAEVFGTRQFTLISQPFHNERA
FT                   IFLARTRGLDAAALNARDVTGRSGLKVQGREVLARVKAVLDVLRGKGPKFLGEPVDVPE
FT                   "
FT   gene            complement(191727..192254)
FT                   /locus_tag="DR_0188"
FT   CDS_pept        complement(191727..192254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:M95287 GB:M80188 GB:X15371 SP:P26837
FT                   GB:U04278 percent identity: 43.88; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09775"
FT                   /db_xref="GOA:Q9RXW7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW7"
FT                   /protein_id="AAF09775.1"
FT                   /translation="MDLELTYTLGDLDAASALLVRVAQDRVERGEELWPPRSLTPERLE
FT                   RYYPRPGWRVAWHGGEAVGTYVLLDADPLFWPDDPPGEAAYLHKLSVHPGWQGRGLSHT
FT                   LLEHAAAEACALGRSFLRLDTAAERPRLRALYAAAGFREVDVVQAGSWRVARFERRLTA
FT                   GPLPGASAHGER"
FT   gene            complement(192257..192814)
FT                   /locus_tag="DR_0189"
FT   CDS_pept        complement(192257..192814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0189"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="similar to GB:AL009126 percent identity: 48.47;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09776"
FT                   /db_xref="GOA:Q9RXW6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW6"
FT                   /protein_id="AAF09776.1"
FT                   /translation="MTEPAPASPARPAWTRALPPLLAAALVGGLGWALLKPAGNAANGP
FT                   LVGKPAPQFNLTGLDGQPVALADYRGRPVVLNFWASWCGPCREEAPLFAKLAAHPGAPA
FT                   VLGILFNETKPQNARDFARQYGLTYPNLQDPGVATAIAYQVTGIPRTVFIDAQGVVRHI
FT                   DQGGLDTARLNAGLSKIGVPGL"
FT   gene            complement(192846..194054)
FT                   /locus_tag="DR_0190"
FT   CDS_pept        complement(192846..194054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 51.03;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09777"
FT                   /db_xref="GOA:Q9RXW5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW5"
FT                   /protein_id="AAF09777.1"
FT                   /translation="MTTPTPTPTPTSQSLAAPFAQGVEGVYFDGRSSRDRAATLRVLGS
FT                   GDLSSGAPLAVLRVAPTDGEPGSEQQWPLRQVQFDPPLAGVRRVVKLPDGGRFETNDDR
FT                   AITALEAAVGRNRGLRGVRRLESDWGLTLGAVVTLGLFVWGFLTYGLPAMARSAAAATP
FT                   RSVLTSFDTSAIEVLDNGTFMGPTHLSAARQAQLQREFKDVAQWAGGGYPYRLLLRDGT
FT                   PQANGDKDSPAPSGSIGTNAFALPGGTVVMTEQLVKLAHSDRELMGVLAHETGHVTHRH
FT                   SLSSIYQGLGLTLLTTAVTGDLIGASTFAAAVPTWLLKNGYSRQSETQSDEVAGRFLME
FT                   RYGTTKPLRDVLARLETEDENADENSVKRDDPGAFLQTHPGTAERIRHLREIEQNWPQR
FT                   RGK"
FT   gene            194117..196531
FT                   /locus_tag="DR_0191"
FT   CDS_pept        194117..196531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0191"
FT                   /product="glycogen debranching enzyme-related protein"
FT                   /note="similar to GP:1857620 percent identity: 48.14;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09778"
FT                   /db_xref="GOA:Q9RXW4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024742"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW4"
FT                   /protein_id="AAF09778.1"
FT                   /translation="MPRIRTSSQLNVEPGQSEICHAGSRMTSAPVPSASAYTYGPQAAR
FT                   NPDLEVLLTDGQGGFALSSLAGVPTRCHAGLVVSQQPPVSRFCHLVSPFERLEVGGESV
FT                   DLHALEVAPGVFEGRGLGLLTGATVWDLLPEREQLWRGVWVRRHACMPQDSGALVLLYE
FT                   VRSRQSVTLTLGGFFVDRGMHAVHTAPPRLQFTPLGSEVRVQGERATRVTLQLRPELAT
FT                   GAVPAQPLIQALTPQPFAQRVYYRADATRGETPHDVTLGCPLWSVTLPPGGGEVALVVQ
FT                   GVTPTTAPVPDPWTAFEAERVRRRGLAERAWQTTGVRDELVATLAVAADAYLVRRGQET
FT                   KRGSGKGGASKGTPRGLSVIAGYPWFADWGRDAMIALSGLTLVTGRFEDARELLLTFLG
FT                   QRRRGLIPNHFDESGQGAGYNTVARPLWLAVALERYARTTGDALFVRQALPMLRELLGS
FT                   LVQGTDYGIGMDPADALLRAGEPGVQLTWMDVKIHDWVVTPRHGKPVEIQALWLAALGA
FT                   ELRLSQALGEPPRYAAVLERAHHSFKAQFWNHAADLTAAPTATLLGLGQLGSSLGGALS
FT                   DALDGDFVLDDEPRRDTSSDALLTVGGRPGSGPVQSTTGASELGVGHRPGAAPAQPAVL
FT                   ADVIQPSGEQDLSVRPNAVIALALADTPVVDEQLDAVLAQTERELLTPVGLHTLSPHDP
FT                   RYLGNYGGPQLLRDAAYHQGTVWPWPLASYVELLLSRGELNRARAALAGLTGHVWEAGI
FT                   GHVSEVFSGDALTPGGCPFQAWSVAELLRAHVLVSLSEAQAHEQARQTHTR"
FT   gene            196635..197312
FT                   /locus_tag="DR_0192"
FT   CDS_pept        196635..197312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0192"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GP:3036882 percent identity: 57.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09779"
FT                   /db_xref="GOA:Q9RXW3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW3"
FT                   /protein_id="AAF09779.1"
FT                   /translation="MSLLTLPPQATEVGLAVDVAAFAMHAGELRVLLVQRGELPHAQTW
FT                   ALPGGFVQPGEELHEAALRELRTETSVSLEPRHLEQFFTFGEVGRDPRGRVVSVAHLAV
FT                   LPHGTVEARAGGHTVGAEWLAAHTPPALAFDHQAILDRAIKRLQLRLDYANLALEFLPD
FT                   TFTLPELQGVYEAIGHRELDKRNFRKRILAAGILTPCGERRSGVGRPAQLYRRAKGTRT
FT                   AAL"
FT   gene            197340..197690
FT                   /locus_tag="DR_0193"
FT   CDS_pept        197340..197690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09782"
FT                   /db_xref="GOA:Q9RXW2"
FT                   /db_xref="InterPro:IPR007014"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW2"
FT                   /protein_id="AAF09782.1"
FT                   /translation="MSAAPPADPAAQITASFQSMLPDLGLGGLLGLAAGYAVRVVGRVA
FT                   LLVVGLAFIVVQLLAHYGVVTVDWLQLQTLTEPWLREGRENFGGWFSRVFLANLPFAGA
FT                   FAAGFVLGLRLR"
FT   gene            complement(197751..198434)
FT                   /locus_tag="DR_0194"
FT   CDS_pept        complement(197751..198434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 64.93;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09780"
FT                   /db_xref="GOA:Q9RXW1"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW1"
FT                   /protein_id="AAF09780.1"
FT                   /translation="MFFGPYTPLILLIFVASLVIQAYLSNTYKKWGNIRNPRNLTGAEV
FT                   ARMMLDENGLHNVPVEAVPGDLTDHYDPQQKVVRLSESTYGVPSIGAMAVAAHEVGHAV
FT                   QDKVRMPALVLRGQMAVPLSLGMNFAPLLLMIGIFVHSTGLLWLGAILFGGALLFHLVT
FT                   LPVEFDASRRALQYLNGRGISGGGEAQAGAQKVLTAAALTYVAGFAMALAQFMNVLGIA
FT                   RSSDD"
FT   gene            complement(198513..199211)
FT                   /locus_tag="DR_0195"
FT   CDS_pept        complement(198513..199211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0195"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09791"
FT                   /db_xref="GOA:Q9RXW0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW0"
FT                   /protein_id="AAF09791.1"
FT                   /translation="MMEKDLRPSLNQHPATIHGFSAFTTVRLQEGAALLWPEHWARLAG
FT                   TCAVLGLPAPDEHLPALPAGTHLLRVTVTDEGTFHQFRPLNTGPRPLGGVAVVLTDWQT
FT                   HPQLAAHKTGNYLPYRLAGAQATAAEAFEGWLTDAAGHVVDGSRTSPVLDFGGRLVVPT
FT                   GGLPGTTRALWLAGHPHEERPVHVSELPQVTRAWICGAGVGVVPVARLGKRELPVRWPA
FT                   VTHPALAWPK"
FT   gene            complement(199208..201124)
FT                   /locus_tag="DR_0196"
FT   CDS_pept        complement(199208..201124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0196"
FT                   /product="anthranilate synthase component I"
FT                   /note="similar to GB:AE000666 percent identity: 50.00;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09783"
FT                   /db_xref="GOA:Q9RXV9"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV9"
FT                   /protein_id="AAF09783.1"
FT                   /translation="MLSPADALLRLRAAGLPGIALLESLGPVLPYARFTFLSAAPTCVQ
FT                   HTLPELPAPDAFFPAWLGGLKYEAAREFGLAAHPASGPAQWWGFYPSGLVWDREAGTLS
FT                   VVGEPHLDWAALLASDPAPLPSLTVGDFGADDVDYPAGVRAVQELIRAGEVYQVNLSRG
FT                   VSAPAQGDPLAAYLRLREVNPSPFMAFLDMGNEVVVSCSPERLVDWAVSEGGGISARPI
FT                   AGTRRRGDTPEEDAAFEAELRASPKEVAEHTMLVDLVRHDLGAVAAPGTVSVPDLMLVE
FT                   RYSHVMHLVSEVTATARAGLTLPDLLAATFPGGTITGAPKARVMDAIAALEPGPRGWYT
FT                   GGAGLVSGRRVDVNILIRTAEFVLDTAAGSPATPPRWTVTVRAGGGTVIDADPAREARE
FT                   TVHKAQALLSVLAGVPGRPAQAGQPPVPGRPWTPPPVPKQAQTPLRVLVLDNRDSFTWN
FT                   LAHDLLALGAMVDVRSQDEDAETLLASRPDAVLVGPGPGTPQTSGCTLALTRRCLERGV
FT                   PLLGVCLGHQALGEVLGGRVERAEPVHGRPERVQHGGAGLFAGIENGAAFGRYHSLVVR
FT                   GLPDELVTARSEGGEIMALAVPGKPAWGVQFHPESVLSPAGRVLLGNWLRAVAGSAALR
FT                   GEG"
FT   gene            complement(201504..202115)
FT                   /locus_tag="DR_0197"
FT   CDS_pept        complement(201504..202115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:Z47047 SP:P40586 PID:600459 PID:763387
FT                   percent identity: 48.74; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09784"
FT                   /db_xref="GOA:Q9RXV8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV8"
FT                   /protein_id="AAF09784.1"
FT                   /translation="MLPSHPAPAEDWTRPVEMRGRFVALVPLSAVHAAGMCAGADAQTV
FT                   EFLARGGPQTNTPEEWAAHIERLNSLPHRVNWAVLGPDETVLGRISYSEARPDDRWLEI
FT                   GTMLLPAGRGTFANPESKLLLLARAFEVLGAGRVQFKVDSRNARSLRALDKLGAVREGT
FT                   LRQYQVRPDGYARDSVIFSVLADEWEGVKAGLERRLGSGV"
FT   gene            complement(202133..202795)
FT                   /locus_tag="DR_0198"
FT   CDS_pept        complement(202133..202795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0198"
FT                   /product="recR protein"
FT                   /note="similar to GB:D26185 SP:P24277 GB:X17014 PID:453239
FT                   PID:467411 percent identity: 74.36; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09785"
FT                   /db_xref="GOA:Q9ZNA2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="PDB:1VDD"
FT                   /db_xref="PDB:2V1C"
FT                   /db_xref="PDB:4JCV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZNA2"
FT                   /protein_id="AAF09785.1"
FT                   /translation="MKYPPSLVSLIRELSRLPGIGPKSAQRLAFHLFEQPREDIERLAS
FT                   ALLEAKRDLHVCPICFNITDAEKCDVCADPSRDQRTICVVEEPGDVIALERSGEYRGLY
FT                   HVLHGVLSPMNGVGPDKLHIKPLLPRVGQGMEVILATGTTVEGDATALYLQRLLEPLGA
FT                   AISRIAYGVPVGGSLEYTDEVTLGRALTGRQTVSKPQPPQRPGDEDGADGAAVPASR"
FT   gene            complement(202908..203198)
FT                   /locus_tag="DR_0199"
FT   CDS_pept        complement(202908..203198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:D26185 SP:P24281 GB:X17014 PID:40073
FT                   PID:467410 percent identity: 70.10; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09786"
FT                   /db_xref="GOA:Q9RXV7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXV7"
FT                   /protein_id="AAF09786.1"
FT                   /translation="MDMKKLMKQMQQAQVAAGKIQDELAAQSVEGTASGLVTVQMNGHG
FT                   KVTSLKIKPEAVDGDDVEALEDLILAAINDAAEKAEGLQREATAGLGLPGF"
FT   gene            203333..203845
FT                   /locus_tag="DR_0200"
FT   CDS_pept        203333..203845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0200"
FT                   /product="transcriptional regulator, Lrp/AsnC family"
FT                   /note="similar to PID:1816639 percent identity: 55.28;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09787"
FT                   /db_xref="GOA:Q9RXV6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV6"
FT                   /protein_id="AAF09787.1"
FT                   /translation="MPFAHFDLSNVRLRTMKSPAYRLDALDERILQELQQDSRLSMREL
FT                   GRRIGLSAPAVTERVRRLEEAGVVLGYGVRVAAKPLGRAISAFIGVKDSGRNDPALVRW
FT                   ARERDGVLECHSVTGDNSCMLKVAVADVAELEVLLGELIDLGFTCDTSIVLSTPLEGKL
FT                   LLPPQED"
FT   gene            complement(203907..204725)
FT                   /locus_tag="DR_0201"
FT   CDS_pept        complement(203907..204725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09792"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV5"
FT                   /protein_id="AAF09792.1"
FT                   /translation="MMDIFNMLGGMGQAQQTVGNQLGTTPQQTEAALEAAVPLLLGAMT
FT                   RNATQPGGLDALASAVGQHDDSAMLGFQQGQTPDMNEGQKILGHVFGGQQQAAANAIGQ
FT                   RAGIDPQMAMQILMMVAPLILSYLSNRSRAQGGQMGGNMGGQSGGGMSLPGGMGGGLGG
FT                   GLGSILGGLLGGGAAGGLGSVLGGMLGGGQAQAQMPQSQNQNTGMGGGQMFPGFPAGNA
FT                   AQQPQMGQAQMGQAQMGGQGDLLGTLNRTLDRDGDGNALNDLIGMFGGRR"
FT   gene            complement(204813..205349)
FT                   /locus_tag="DR_0202"
FT   CDS_pept        complement(204813..205349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09793"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV4"
FT                   /protein_id="AAF09793.1"
FT                   /translation="MLRIIVIGTTGSGKTTFARALAQRLGLPHGEQDAWNHEANWQMAP
FT                   LGRFRARVDTFTSQPAWVMDGNYGKARDLGWARADTLIWLDFPAWLVYSRLVRRTLWRV
FT                   LTQQELWNGNRETWRGALLDPEGPLRWFWKTHWRRRQETPALAAEFPHLRLVRLRSPGE
FT                   ARRFLAAVGRGHPTA"
FT   gene            205457..206284
FT                   /locus_tag="DR_0203"
FT   CDS_pept        205457..206284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653436 percent identity: 45.14;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09788"
FT                   /db_xref="GOA:Q9RXV3"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV3"
FT                   /protein_id="AAF09788.1"
FT                   /translation="MEVALNDFLSIPAVNAGLYLALARLGFRRQFAYLQAALWGLVTNL
FT                   FFGLLRISILLALFDGRPQVAGLTGGDAVTYVALTQTFIASFSLFGWSEFMRTIHRGEV
FT                   ATDLLRPLDLLASWAAQDAGRAAGQFVLRGLPMLVLFALLWGARMPALPPETLLSVVPA
FT                   WACGFAYRFLVNCAAFWSPDAVGIGRFAWVLLGLGCGFLMPLRLFPDWLRAALAWTPFP
FT                   SMLNTTVELWLGLKTGAAAWGALGVQMGWTVALLGLCAWVLRRGLGRLEVAGG"
FT   gene            206335..207168
FT                   /locus_tag="DR_0204"
FT   CDS_pept        206335..207168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653967 percent identity: 49.48;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09789"
FT                   /db_xref="GOA:Q9RXV2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV2"
FT                   /protein_id="AAF09789.1"
FT                   /translation="MRDPHHPSPLYHLRLYFLLLRAQARSQQVYRLSFALDALAAALIT
FT                   FTEFMAFVLVLPRFGGLGGWTLPEVSLLYGLAELSFVVMDMLFGGFDAPNMSQQVRSGS
FT                   FSTFLLRPLPLPLQVFGSDFALRRVTRVLLAVGIVAYAVSGLDISWTPADIALLVGSVL
FT                   GMTAFFGGLFVIGGTLTFWTVESVEAMNVLTYGGRSLISYPMDIYGTFLRKTFTYVIPA
FT                   AFLSYFPVLHVLGRPLPDGLPEWAAFLPLPAGVLVLTLAFAFWRVGVRRYVGTGS"
FT   gene            207113..208177
FT                   /locus_tag="DR_0205"
FT   CDS_pept        207113..208177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0205"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to PID:1652437 percent identity: 61.95;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09790"
FT                   /db_xref="GOA:Q9RXV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV1"
FT                   /protein_id="AAF09790.1"
FT                   /translation="MPSPSGGWGCGGTWARGVDGARLFSIHHQAVRPNLSTISPPKEPP
FT                   MIEVRHLCKSFARKPAVQDISFSIPAGEIVGYLGPNGAGKSTTIKVLTGLLVPDSGEVR
FT                   VGGLVPWKQRRQHVARLGAVFGQRTTLWWDLPVRESLELLRHVYRVPAARFAENLAGFT
FT                   ELLELGPFLNTPARALSLGQRMRADLAAALLHDPELLFLDEPTVGLDVVAKERIREFVK
FT                   AVNAERGVTVLLTTHDLGDVERLARRVMMIDTGRLLFDGPLAELQARYGGERELWVEFE
FT                   KAPAQPALPGLTLLGQDGPRVRYGFSGAAAAPIAQVTALAPVRDLAVKEPEVEATIRRI
FT                   YEGNLLGSRSVREG"
FT   gene            208174..208572
FT                   /locus_tag="DR_0206"
FT   CDS_pept        208174..208572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09794"
FT                   /db_xref="GOA:Q9RXV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV0"
FT                   /protein_id="AAF09794.1"
FT                   /translation="MTAPEDSRSRLAPQPFTLPLWLSVPLLLGLLMYGADTALHAVAWP
FT                   GQLGGVLGAVLALCGVVFTWRRRAPSAPGAFFGAYVLMKAWARLDPAAANGTLAGRSLI
FT                   WPVLLSLLVGCWLVFSDKVFSDGKSHPA"
FT   gene            208776..209147
FT                   /locus_tag="DR_0207"
FT   CDS_pept        208776..209147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0207"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09801"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU9"
FT                   /protein_id="AAF09801.1"
FT                   /translation="MTKTLLSALAALLLSTAAFAQTAPTPVHAAPTQTASSQTAPTTST
FT                   HTPKARTATPRTTAPLPTAPVNVNTATAAQLMTLPGVSNKIAAEIIKDRPYKNAAELVK
FT                   KVKGIGKNNVKPMTPYLAF"
FT   gene            209239..209631
FT                   /locus_tag="DR_0208"
FT   CDS_pept        209239..209631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0208"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09802"
FT                   /db_xref="GOA:Q9RXU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU8"
FT                   /protein_id="AAF09802.1"
FT                   /translation="MTRPDRFGLEGAPEIRKARRRPFGRGPFATVLLALLALSGVAGLL
FT                   AAKSWYGDLGGVVALLCAVLGLVQQRRGGLSDNGALWWYVTGFFTLTLWQRLDRLPQPP
FT                   LTGTLVWTVLMSIGLPALLLWWLRRR"
FT   gene            complement(209636..211084)
FT                   /locus_tag="DR_0209"
FT   CDS_pept        complement(209636..211084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0209"
FT                   /product="gid protein"
FT                   /note="similar to PID:1401048 GB:AL009126 percent identity:
FT                   70.69; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09795"
FT                   /db_xref="GOA:Q9RXU7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXU7"
FT                   /protein_id="AAF09795.1"
FT                   /translation="MALASLSISHQPFTINLMSSPTITVVGAGLAGSEAALAAAKLGVR
FT                   VRLFEMRPQKMTPAHRTANFAELVCSTSLGGEGEMQSKGLLQAEMRSVGAAIVTSADAS
FT                   RVPAGNALAVDRDAFSAHVTEQVKNHPLIEVVEGEVETVPDGICVIASGPLTADALASD
FT                   LRRLTGSERLSFYDAAAPVIDVDSIDMDIAWRAGRYDQSADYINCPFTKEEYLAFFEAL
FT                   ETARSHTPHDWEKLEFFEGCMPIEEIARRGVDTPRFGPMSPKGLDDPKTGRWPYAVAQL
FT                   RQEDAEGRMWSLVGFQTGLKWGDQKAVVQLIPGLHNADIVRYGVMHRNTYLNAPEVLDS
FT                   TLQLRADPQKLVAGVLAGTEGYLESSATGWLAGTNAARLALGLEPLTPPAESMLGGLVR
FT                   YLASANPKGFQPMNVNWALVPELPTEINEKTGKPKKLGKREKRPPLFRRGLGAFMAWAG
FT                   QDAGVPVTPPAVPEHPQDELPAIR"
FT   gene            complement(211120..211956)
FT                   /locus_tag="DR_0210"
FT   CDS_pept        complement(211120..211956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 52.38;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09796"
FT                   /db_xref="GOA:Q9RXU6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU6"
FT                   /protein_id="AAF09796.1"
FT                   /translation="MTNTEVPSTVNRALNPWARWRGVAGGLAVGAGLGLLVAFVGDVRA
FT                   TPALLLGLLALGTLAGAFRPSRWLLFGGAGAAALLCLLCLLTPVLRGPLSALTLTQPPV
FT                   KADAIVVLGGGVNCGAAQLESSSVARLLGGLRLWQAGYAPVITVSEQSGLIGPHNCPKM
FT                   SVLERELVRELYGAGGPEVLTLPHVTTTRDEAQRVSVLARERGWRRVLLVTSPSHSRRA
FT                   AALFAGYGVPVVSVPTFESRYDQSLQTPSDRLFALRTLLYEGLSRVKSALGGTPER"
FT   gene            complement(211953..213059)
FT                   /locus_tag="DR_0211"
FT   CDS_pept        complement(211953..213059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:L77117 SP:Q57634 PID:1590923 percent
FT                   identity: 54.34; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09797"
FT                   /db_xref="GOA:Q9RXU5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU5"
FT                   /protein_id="AAF09797.1"
FT                   /translation="MSLTKSHLFGLDALLDLGRTVWADVQRFLTEYGPAILLSAVLAAA
FT                   YALLFWGLIRLALWLLSRFGPPDAHPVLRTTLRRVLRLTGLLLAAISVAGLFPLLTPYI
FT                   PALFRGYLLLLLLYAGWALIHHLLHRQANAWGLDASLSLLLSNVVRGVWLLSGIYLIFR
FT                   QFGIDLLPILGGLGVVGLAVGFAAQDILANLISGVTLLLDRPFRIGDWVRIRDYEGQVH
FT                   GLTLRTTRIMTRDNEWVSIPNKDVAGATVVNLTAGGTLRLNVPLPLAYAERVPEARAVL
FT                   LRVMAQHPKVETDPAPVVLVREVNESNLELIMRFYVSDENVKAYPVLTMQLREAAKEAL
FT                   QDAGLAAPYPRQWIYRVDGAPTAPEPRG"
FT   gene            complement(213426..213731)
FT                   /locus_tag="DR_0212"
FT   CDS_pept        complement(213426..213731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09803"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU4"
FT                   /protein_id="AAF09803.1"
FT                   /translation="MGKKDRLTTRPAFVTLRDLPGTRVMFWVVGECPYCGERHLHPAGN
FT                   LRTADPGERLGEVPAPCNPERLYDLQLPPKPQRKKGKEARKKERRKGRVGDGWDVE"
FT   gene            complement(213798..214715)
FT                   /locus_tag="DR_0213"
FT   CDS_pept        complement(213798..214715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0213"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09804"
FT                   /db_xref="GOA:Q9RXU3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU3"
FT                   /protein_id="AAF09804.1"
FT                   /translation="MRVSLEVPAMIRPLHATDLPDLLALLHWMDAAPEREVLAPDARTL
FT                   NELRLECEDPAALVDEGEEGVRAYCALSPFRDGLALEGPLAEHGTDLRGLLSRAAQQAE
FT                   GAPVYAFCARDNLPVRSALEAAGFAPMHTTDFYAAPLERWRTGSEKSSGKKAQLPPGYT
FT                   LTRELPLTEYRALYRAAEDTWAARLDWSPEQYDAHFAREDVRLLALRDSEGRPVAFAEL
FT                   ELCAPDSRAELTHLAVHPAQRGQGLGRALLALAAAEAAQSPEIRTLRARAHDHMSAARQ
FT                   LYARAGLSHCRAVVTSLREGDEEA"
FT   gene            214873..215652
FT                   /locus_tag="DR_0214"
FT   CDS_pept        214873..215652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0214"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09805"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU2"
FT                   /protein_id="AAF09805.1"
FT                   /translation="MPAFPQMRLSCAFEGVFRLGRPNVRLTGAKSERCGRATSGRCFAV
FT                   TTKSSNSTRTQALERRQAAELRAGTDLLTLRAQLHRAEKEARRAPAPPPARPKSQTPKA
FT                   QQAVKPQRAQELAGVDTDDFLLSRALRQLRDAVYDSRYHVCPHAVQHARAEGFMESDIM
FT                   DVLLTGRVRAVYPEDHRWLVCGYFEAHGIRLPLHVAVQHYRDGHIDIVTAFVPKNPHHI
FT                   ISRARLALLVRYDDEQVRSKEAVKGNKVGYKGKGGWK"
FT   gene            complement(215708..216844)
FT                   /locus_tag="DR_0215"
FT   CDS_pept        complement(215708..216844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0215"
FT                   /product="aminotransferase, class V"
FT                   /note="similar to GP:3402253 percent identity: 55.47;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09798"
FT                   /db_xref="GOA:Q9RXU1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU1"
FT                   /protein_id="AAF09798.1"
FT                   /translation="MMIYLDYAATHPLTPAALAAYAEAAALPGNPASVHAAGQAAREKL
FT                   EEGRARMAAAFDVDPRTLTLNSGGTEGDNHVLLGAAQAWQERHGSPGHLVTTPTEHSAV
FT                   LAPARHLAAHGWDVTWLEPDSAGHYSPEQLGAALRDDTALVSIHHANNEIGTVQPTAAL
FT                   AAVAAARGVPYHTDAVQAPGVLPVNLAEWGVTYATFSAHKWGGPRGVGALYVQRGAELP
FT                   PVTLGGGQEGGLRPGTQNTAGAYAAGVALTEAAEAQPATFAHLRDLQTAFMDAVREIPG
FT                   LTFNHPADGSPKVVSLTIPGADGEALLMNLDMLGVSASAGSACSAGTMQASHVLTAIGL
FT                   TEADARASLRFSFGAATTRGEVQQAAAALRQAAEWSRG"
FT   gene            complement(216981..217424)
FT                   /locus_tag="DR_0216"
FT   CDS_pept        complement(216981..217424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 63.45;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09799"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU0"
FT                   /protein_id="AAF09799.1"
FT                   /translation="MTAPAAPLPEKLQNIVGMFKTVPKAMRLQALLEYSRKLPPLPEKY
FT                   AEHPEFLKPVPECTSPFFLVTEQDDAGRVNLHFKVPEDAPTVRGYAGILHEALSGETPE
FT                   TILNVPDNFYMDMGLTELITPMRLRGMGAILMRLKRDVAGAEG"
FT   gene            217519..218379
FT                   /locus_tag="DR_0217"
FT   CDS_pept        217519..218379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0217"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /note="similar to GB:M29612 SP:P16385 PID:152687 percent
FT                   identity: 73.72; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09800"
FT                   /db_xref="GOA:Q9RXT9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXT9"
FT                   /protein_id="AAF09800.1"
FT                   /translation="MDYAKDVLVSTEWAAQNLQTPGVRFIEVDEDILLYETGHLPGAVK
FT                   LDWQTDLWHPVERDFIEPQQVSELLGKLGIKADDTIVLYGDKSNWWASYAYWFLTYSGV
FT                   SNLKIMNGGRQKWVAEGREMTTEAPTVTATTYPALQRDESLRAYRDEVRAHLESVNNGQ
FT                   GAMVDVRSPDEFSGKVTHMPNYPQEGVLRGGHIPGARNIPWAKATNEDGTFKSADELKA
FT                   LYEGEGVTADKDVIAYCRIAERSSHSWFVLRELLGYPKVRNYDGSWTEWGNGVGLPIEK
FT                   TYSEE"
FT   gene            218671..219111
FT                   /locus_tag="DR_0218"
FT   CDS_pept        218671..219111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0218"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09813"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXT8"
FT                   /protein_id="AAF09813.1"
FT                   /translation="MKLLLLAVVVIVGVLVVLSLLRKGTGAGPVGSRPPGTRHLDEETA
FT                   VRPDIDPQALAAARAQVAPTVPDAVLSDALLDATPKQVAHLFSAVPADVMANAMGQNTG
FT                   RGGTVQVQGQATAQDMAQLRNLSSAVDELDIWNFGDDTSHKA"
FT   gene            219326..220660
FT                   /locus_tag="DR_0219"
FT   CDS_pept        219326..220660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09816"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXT7"
FT                   /protein_id="AAF09816.1"
FT                   /translation="MGATTDFRRAIEENRLLYLSTLEAYRASTRENNAEENDLVKIITQ
FT                   PRKDLDIAFVNHNYYITKERHLRLMGSNQIFLKKSIVINLMSALEQYLKATLRKAFASA
FT                   PKIFSNVKSRQELELGYIIRLGSYSNITSGFIEKEVRRIGERSLHENGDFFKKNLDMDF
FT                   QRLGARWDRILQASKYRNSIIHHNSTFVDELGRDHKIDISHWFIIQLMDDLYALSVEVG
FT                   RSLREKIEKYNESAKSIEESAIVLIVIESSLYDDFVEFRPNYTFYDSSNKLRQFSELNK
FT                   VTYSRDQGKVYVMIRDNYKIVSSYIVNLKKRHKDLDRSEFRYYKIYNEDPNNLIPDWPT
FT                   LEKVSIALGYGLEVEDIITGVSTSSHDTKIVERAIHIIENSLPENAVRTISTLLGDDEI
FT                   FDNRKEILDMLSDEYLFDRSALSATLQIVAAQKIHLLLSNLHLSY"
FT   gene            complement(220657..222090)
FT                   /locus_tag="DR_0220"
FT   CDS_pept        complement(220657..222090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0220"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="similar to SP:P00497 GB:J02732 PID:143370
FT                   GB:AL009126 percent identity: 69.80; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09806"
FT                   /db_xref="GOA:Q9RXT6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXT6"
FT                   /protein_id="AAF09806.1"
FT                   /translation="MSEHFHEHDLNFDKPREECGVFGIYSAQPNDLAWLTYLGLFALQH
FT                   RGQEAAGMCVSDGDRFHVEKDLGLVTQVFDERRLDSVRLAGAQVSIGHVRYSTTGSNLR
FT                   FNAQPLTTRTNKGILGMAHNGNFVNALEVRREMLEEGALFATTNDSEVMLNLIARESRM
FT                   DLVEATAAAMQRLRGGYACVLMSRSQLLGFRDPHGVRPLVIGQREDGAWVLASEPCALY
FT                   AIGARLIRDVAPGELVWIDREGLHSLMVEARQPTPCSFEWIYFARSDSQLDGIDTHESR
FT                   IRMGQQLAREKPVEADIVVPVPDSGIGAAIGYARESGIPFDYGLYKNPYAGRTFIAPTQ
FT                   EARELKVKMKLSPTSAVRGKRVVLVDDSIVRGTTSRQIVNLLRDAGATEVHFRVSSPPI
FT                   THPCFYGIDTAARKELVASTHSVDEIRDLIGADTLAFISEQGLRKAIGGPGLCSACFTG
FT                   DYPAGTPLLNDVDKLALEV"
FT   gene            222050..222553
FT                   /locus_tag="DR_0221"
FT   CDS_pept        222050..222553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:L42023 SP:P44116 PID:1006515
FT                   PID:1221286 PID:1205407 percent identity: 59.02; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09807"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXT5"
FT                   /protein_id="AAF09807.1"
FT                   /translation="MSKFRSCSWKCSDMGKSLCGAGGLVWTPPHPLLRKALSHRGRGVK
FT                   DTNFVGMTTRAVRKGTLRARALRRTQTVEEKTLWLALRNRFLNVKFRRQWPMGGYVVDF
FT                   VCFEAKLIVELDGSQHAEEAARDYDAVRTEFLEAGGFTVLRFWNNEVRKNLEGVLLEIQ
FT                   KRLP"
FT   gene            complement(222739..224982)
FT                   /locus_tag="DR_0222"
FT   CDS_pept        complement(222739..224982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0222"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /note="similar to PID:1651718 percent identity: 66.80;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09808"
FT                   /db_xref="GOA:Q9RXT4"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXT4"
FT                   /protein_id="AAF09808.1"
FT                   /translation="MTSQSLRDQAATFGLTTEEYDLFVSQLGREPNALEAAIVGAMWSE
FT                   HCGYKNSRPLFRAFPTTGPQVLQGPGENAGVVDIGDGWGVAFKMESHNHPSAVEPVQGA
FT                   ATGVGGILRDIFAMGARPFAVLDSLRFGNPDSPRTRFLVNGVVDGIAHYGNAIGVPTVG
FT                   GEVTFHPSYQENPLVNVMALGLLRHEDLATGTMGEVGNQIVYVGSKTGRDGLGGAVFSS
FT                   ADLSAASQADRPAVQVGDPFMEKLLLEATLEAIQAGLVAGVQDMGAAGLVSSTCEMAYR
FT                   ASLGITMDLDKVPTREEGMVPMELCLSESQERMILVPVPGKEQALHDLLAKWELDVVTI
FT                   GEVEAHDRYRLTWKGEVVCDLPVALLNEAPKYTREGVESADIRAARERDLSGVPLPGDL
FT                   GAVLLELLSHPTIASKRPIFERYDHQVMTNTVVVPGAADAAVLRVKGSPMGVAATSDCN
FT                   PRFVQLDPYAGAAAAVAEAARNLACVGATPLAITDNLNFGNPHRPEVYYQLQQAVQGIA
FT                   DACRALNTPVTGGNVSLYNQYTEGDHKVAIHPTPTIGMVGVLPDVTVRASLNLKAAGQT
FT                   LLLLGHRAEKGWSDSIGASQYLETVHGLEAGQVPPVDLDLAQKVVDGTLALIRAGLTDT
FT                   AHDCAEGGLAVALAEMAIAGGLGLNVSLDAPASVRADALLFGEAHSRVIVAVEDAAAAG
FT                   AKLDELGLPYAVLGETVEAPKVTIAAPAQHVHLSVNLESLKTAWEEPLKGILG"
FT   gene            complement(224979..225779)
FT                   /locus_tag="DR_0223"
FT   CDS_pept        complement(224979..225779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0223"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /note="similar to GB:J02732 SP:P12041 PID:143368
FT                   GB:AL009126 percent identity: 74.54; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09809"
FT                   /db_xref="GOA:Q9RXT3"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXT3"
FT                   /protein_id="AAF09809.1"
FT                   /translation="MRLRPTPFPLWRNCTPKASTARPKPLLLLAPLRFRPLARTQRGGV
FT                   MKTAVIQFPGSNCDADALHAARLLLDDGAQFVWHTETALPEGTELVFLPGGFSYGDHLR
FT                   SGAIAARSPIMNAVKAHAEAGGYVLGVCNGFQVLTEAGLLPGALSRNKELHFMCKPVHL
FT                   RVENNATDFSRAYGPGQIIEIPIAHGEGNYYADAATIAELEEGGRVVFRYADNPNGSLN
FT                   DIAGIVNERGNVLGMMPHPERAVELLLGSEDGKGVFESLKTVKK"
FT   gene            complement(225776..226030)
FT                   /locus_tag="DR_0224"
FT   CDS_pept        complement(225776..226030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:P12049 GB:AL009126 percent identity:
FT                   71.25; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09810"
FT                   /db_xref="GOA:Q9RXT2"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXT2"
FT                   /protein_id="AAF09810.1"
FT                   /translation="MPHYQAKIYVTLRPSILDPQGRTVERALSHLNHDNVGSVRIGKYI
FT                   ELNLSGEKADVEAQLKDIVENVLSNPIMEDARWELEEVQ"
FT   gene            complement(226089..226559)
FT                   /locus_tag="DR_0225"
FT   CDS_pept        complement(226089..226559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0225"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09814"
FT                   /db_xref="GOA:Q9RXT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXT1"
FT                   /protein_id="AAF09814.1"
FT                   /translation="MIRQEENVKVLQPSPGTKAFLIFWIILVTLYVGQSLINALPNLTK
FT                   MPLSNNLITLGLLLFYGLVIFHFLQGMTRTVSYFPAGKLLTFKTLFSRKEFVLDETCSY
FT                   NIRSEIGSRGGTTHRTELFRRQSKIFSESLNGLNLKEATSFFNQVFGSQRNN"
FT   gene            complement(226567..227451)
FT                   /locus_tag="DR_0226"
FT   CDS_pept        complement(226567..227451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0226"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="similar to GB:J02732 SP:P12046 PID:143367
FT                   GB:AL009126 percent identity: 71.37; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09811"
FT                   /db_xref="GOA:Q9RXT0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXT0"
FT                   /protein_id="AAF09811.1"
FT                   /translation="MAAVTFQSRPVRRPSRSRLVSPPERWHRRFKHVQQYDSAASSRHV
FT                   PGGAFSTFWEQTMTRGEMKYEGKAKRVYATENPHEYVVEYKDDATAFNAQKRGEWAGKG
FT                   ATNNAITAHLYPQLEAAGIPTHFLEKLSDREQRVKAVTIVPVEVIVRNVAAGSFSKRLG
FT                   VEEGTPLPRPVVEYCYKSDALGDPLINTDTAVALGWASEDDLKRIRELALQIRDFLVPY
FT                   FEKRGVRLIDFKLEFGKLPSGEIVLADEISPDTCRFWDAETNEKMDKDRFRRDLGGEAE
FT                   AYAEMLKRVTREV"
FT   gene            complement(227545..228273)
FT                   /locus_tag="DR_0227"
FT   CDS_pept        complement(227545..228273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0227"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09815"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXS9"
FT                   /protein_id="AAF09815.1"
FT                   /translation="MMRVSVLSGVVFLTTSLGGALGSAASATDCSSIKAALQGPRSVTY
FT                   QQKLLPVAPVGGQASAPMTFVVSSTVRPIPNGYQVQNVTDGKTHVLKQTCVGGKLVTEL
FT                   DGKRLDMGASAQSGGGSINVRLGNFADASYLKHKVGEVWTGTLSSVKTQDFTMTTTYRN
FT                   KLVRTEKITTPAGTFNTYRVEAQTISTTTFQDPKMAAAMGQRNKPTVTTTTTWYAKDIP
FT                   GLIVKMESKGMSSLLLKYQK"
FT   gene            complement(228384..228770)
FT                   /locus_tag="DR_0228"
FT   CDS_pept        complement(228384..228770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0228"
FT                   /product="apaG protein"
FT                   /note="similar to GB:D10483 SP:P05636 GB:X04711 PID:216475
FT                   PID:40918 percent identity: 63.87; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09812"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXS8"
FT                   /protein_id="AAF09812.1"
FT                   /translation="MTSSPDITVSVQVHHLPAQSTPQRQLFAYFITIENNTDDSWKLLS
FT                   RHWTITSGDGQQFTVEGEGVVGEQPLLAPGAQYTYNSFVTVDALPGRMEGHYVMGDAWG
FT                   QTAQVPIPPFRLDIAPESGERLLN"
FT   gene            228863..229990
FT                   /locus_tag="DR_0229"
FT   CDS_pept        228863..229990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0229"
FT                   /product="endoglucanase, putative"
FT                   /note="similar to GB:AE000782 percent identity: 63.16;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09817"
FT                   /db_xref="GOA:Q9RXS7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXS7"
FT                   /protein_id="AAF09817.1"
FT                   /translation="MERVAVLCRHPRNSENCSRLHLMSDTPSPINRDFLFELLSQAAPS
FT                   GAERRAADVWKKEAATFARVSEDHYGSVYAELGPENGPAIALMGHLDEIGLIVSHVDDK
FT                   GHLSVLGVGGWDPQVLVGQRIRLLAPGGDLLGVVGKKAIHVMEAEERTKASKLEDLWID
FT                   VGLDADEVKAKVPVGTYGVIEQGPVMVGNKVVSRALDNRVGAFIVLEALRALKDVELKH
FT                   RIVAVGTSQEEIGVFGAQTSAYRLDPVAGIAVDVTHETDQPGVSEKKYGVAPFGSGANL
FT                   SVGPMTNPTLLRQLTEAAGRENIPYTLSASGRYTGTDADALTLVRAGVPTGVVSIPNRY
FT                   MHSPSEMVDERDVKACIDILAAWIRGLEETLEFTR"
FT   gene            230019..230504
FT                   /locus_tag="DR_0230"
FT   CDS_pept        230019..230504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1652545 percent identity: 61.43;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09818"
FT                   /db_xref="GOA:Q9RXS6"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXS6"
FT                   /protein_id="AAF09818.1"
FT                   /translation="MTGLPFRIGYGEDAHRLAPGLPLVLGGVAIPHAELGAVAHSDGDA
FT                   VLHAVADALLSGLALGDIGQYFPDTAAEWKGMDSRRILAKALELVEERGYRPVNVALVV
FT                   TLDRPKLGPLRADIAASVAELLGLPAGEVGVSFKTSEGLALEHVQTRVTVLLGRVDD"
FT   gene            230497..230973
FT                   /locus_tag="DR_0231"
FT   CDS_pept        230497..230973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0231"
FT                   /product="RNA methyltransferase, putative"
FT                   /note="similar to SP:P33899 PID:466744 GB:U00096
FT                   PID:1790034 percent identity: 65.28; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09819"
FT                   /db_xref="GOA:Q9RXS5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXS5"
FT                   /protein_id="AAF09819.1"
FT                   /translation="MTDAEASGPLLHVVLFEPEKAGNVGNVARTCSVLGAELHLIRPFG
FT                   FHLHDREFRRAVMDYLQGVTLHEYAGWSDFQAQLPDAARVFAFSTHATEYHTRAGFKRG
FT                   DYLLFGPESRGLPVWLRDALPKLKLPQPGRGRSLNLSVAVGAAAFEAGRQIERW"
FT   gene            231066..231293
FT                   /locus_tag="DR_0232"
FT   CDS_pept        231066..231293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0232"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09830"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXS4"
FT                   /protein_id="AAF09830.1"
FT                   /translation="MSENRQKMNKTYQRILSGLLLNAERDVRLARAGTDEAARAKANVR
FT                   LETLRAALEIYAASHKLAYGERPWPREERT"
FT   gene            231290..231487
FT                   /locus_tag="DR_0233"
FT   CDS_pept        231290..231487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0233"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="similar to GB:U00096 PID:1789021 PID:1800053
FT                   PID:1800057 percent identity: 56.72; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09820"
FT                   /db_xref="GOA:Q9RXS3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXS3"
FT                   /protein_id="AAF09820.1"
FT                   /translation="MSADLAARAALFRALSHPARLTLLRLAWTEALSGEHLARLVQLAP
FT                   ATVSHHLAQLTEVGLMTVQP"
FT   gene            231531..231860
FT                   /locus_tag="DR_0234"
FT   CDS_pept        231531..231860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0234"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09831"
FT                   /db_xref="InterPro:IPR018656"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXS2"
FT                   /protein_id="AAF09831.1"
FT                   /translation="MSLTSLVQGSADVPFVEDPYEQRVLRAFLRGGKLLQIPAQRKKRD
FT                   VVLRFLAGLFEPERRYPEAEVNALLGEYHPDFFTLRRELVGAGLLEREQGEYWRPEPTE
FT                   TPSRL"
FT   gene            231866..233551
FT                   /locus_tag="DR_0235"
FT   CDS_pept        231866..233551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0235"
FT                   /product="6-aminohexanoate-cyclic-dimer hydrolase"
FT                   /note="similar to SP:P13397 GB:D26094 PID:148711 PID:488343
FT                   percent identity: 60.26; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09821"
FT                   /db_xref="GOA:Q9RXS1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXS1"
FT                   /protein_id="AAF09821.1"
FT                   /translation="MTKRWHSFLASGASTKHEQNGEWSGWRCCSDARVIRRTALSCLML
FT                   TFAEYDRLDALDLAQLFRRGELSAEDMCTAAIHRAQVVNVALNAVVYPLYDQGLAQARA
FT                   TDAARARGEQATGPFAGVPFLVKDFGSRLAGVPHTGGTRAYRDQIPEWDDELVRRWQAA
FT                   GLLPLGKTNTPEFALMGVTEPELHGPTRNPWDLGRTPGGSSGGSASAVAAGIVPLAGAG
FT                   DGGGSIRIPASCCGLFGLKPSRGRVPCGDGVGEPWQGAAVEHVLTRSVRDSAALLDLEQ
FT                   GPDAGAALFLPSPERPYSEEVGREPGRLRIGFSTAHPLGRSVHPECVAAVQGAARLLES
FT                   LGHEVEEVALPWDGPALAQAFLMLYFGETGASLAALRDTLGRPARASDVEAVTWLLGQL
FT                   GRSYSAADFAAARASWNVHARAMGRFHQNYDLLLTPVLATPPLQIGELQPRGVQAALLR
FT                   AAQQMDVSGLLRRSGQVDALATDILEKMPYTQLANLTGQPAMSVPLHWTADGLPVGVQF
FT                   VAPLAREDVLLRLAGQLEQARPWFARRPTVGRAAVGEAAYSGSA"
FT   gene            233548..234783
FT                   /locus_tag="DR_0236"
FT   CDS_pept        233548..234783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0236"
FT                   /product="aminopeptidase"
FT                   /note="similar to GB:D13386 SP:P42778 PID:912448 percent
FT                   identity: 67.08; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09822"
FT                   /db_xref="GOA:Q9RXS0"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXS0"
FT                   /protein_id="AAF09822.1"
FT                   /translation="MTPSSFDERLARYAELLVKVGVNLPAGGKLLVNAPLSAAPLVRLV
FT                   ARAAYRAGALDVRVEYHDEHLALALYEDGSDEAMGFLPPWATEQVQHMLDDGYARLSIR
FT                   GDDPALLKNVNPERIARRSKLMAQASREVSAAVSGFAVNWTVAAMSTPAWAQAVYPELP
FT                   EAEAVACLWDDIFKVTRADLPDPLGAWEDHVAALARRSAHLNDKQYAAVHLTTELGTDL
FT                   TVGLAERHIWQGGAEEAKNGIVGVPNLPTDEVFTMPHRDRVNGVAVASKPLSVRGQVVE
FT                   GIRVRFENGKAVEVSAEKGEDTLKSLIATDEGAAHLGEIALVAASAPVAQTGTLFFNTL
FT                   FDENAASHIALGRCYPTNVQGGADAQQRQAAGGNDSLIHVDWMIGTPGASVDGITADGQ
FT                   REPLMRGGEWMI"
FT   gene            234954..235535
FT                   /locus_tag="DR_0237"
FT   CDS_pept        234954..235535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0237"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /note="similar to PID:2058370 percent identity: 67.88;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09823"
FT                   /db_xref="GOA:Q9RXR9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR9"
FT                   /protein_id="AAF09823.1"
FT                   /translation="MRLMSDTYNAEGFTQTPYLSTERQTKFTQAPELGDAIEPGKQYRA
FT                   VLETSKGRIVVELYPDEAPMTVNSFAYLLRHHYYDGIKFHRVIDGFMAQTGDPTGTGMG
FT                   GPGYKFEDEFAGNHHRHSGKGVLSMANAGPGTNGSQFFITFTATPHLDNRHTVFGKVVE
FT                   GLDVLDRITRIQPGMGGTPDVIETAYLVEK"
FT   gene            235673..236931
FT                   /locus_tag="DR_0238"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   GB:AL009126 percent identity: 52.56; identified by sequence
FT                   similarity; putative;conserved hypothetical protein,
FT                   authentic frameshift"
FT   gene            236931..237335
FT                   /locus_tag="DR_0239"
FT   CDS_pept        236931..237335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0239"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09832"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR8"
FT                   /protein_id="AAF09832.1"
FT                   /translation="MRRWPVLLLPLLLSACQDREARAQNAELARRVAALESEVQSLKKE
FT                   QAAPGLTPPADAAAVTARAAARNCATQLARTLEDYRRGSLEKRYPAAGDIALPPPCQNQ
FT                   KVRWQTRTAQAYAFSVVDDAGAVLAEGQGP"
FT   gene            complement(237452..238306)
FT                   /locus_tag="DR_0240"
FT   CDS_pept        complement(237452..238306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:2224832 GB:AL123456 percent identity:
FT                   55.68; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09824"
FT                   /db_xref="GOA:Q9RXR7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR7"
FT                   /protein_id="AAF09824.1"
FT                   /translation="MSFGGAGGSVWLMPLRLIASDLDGTLLRDDLSVSPRTRRALDAAR
FT                   AAGIHVVPVTARQPVGVRRIAQGAGFDGWALCSNGALGIHLTTGEVLFERHLAPEMQRA
FT                   LAEAIRQQVPGTVFASIREAGEGFYAQGEYADLASETDHKRDPATMGRYSLDEVLSAPS
FT                   LKFVLRHPEVSPPELLVAVRALGLTGFHATHSGAAFVEVAAEGITKAAGLALLCENLGV
FT                   AQADTLAFGDAPNDAEMLAWAGRGVAMGNAHPEARAAADEVTLSNEEDGVAVVIERALA
FT                   GLG"
FT   gene            238308..238655
FT                   /locus_tag="DR_0241"
FT   CDS_pept        238308..238655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09833"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR6"
FT                   /protein_id="AAF09833.1"
FT                   /translation="MFAKGGPAMSEFHELQPPHAPRWLPLVLETEVTAATLRYRTRRGG
FT                   PWREVPRADILSADVVHPARWSWPYSRRLDPGSEQLLSTSGRAVRLRLRGGQVLVLGSG
FT                   RAAELLSALRG"
FT   gene            complement(238652..238990)
FT                   /locus_tag="DR_0242"
FT   CDS_pept        complement(238652..238990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:2181996 GB:AL123456 percent identity:
FT                   55.17; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09825"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR5"
FT                   /protein_id="AAF09825.1"
FT                   /translation="MTHITTPAAWAAAQRAGVYSAPSMEMQGFIHLSAPAQVIGVANFL
FT                   YAGQSGLLLLVIDPAKLRAELRWEEYEPGSPHFPHLYGPLNLDAVTEVLPFEAGADGRF
FT                   ELPARLRS"
FT   gene            complement(239002..240990)
FT                   /locus_tag="DR_0243"
FT   CDS_pept        complement(239002..240990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0243"
FT                   /product="arginine decarboxylase"
FT                   /note="similar to PID:1653772 percent identity: 64.31;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09826"
FT                   /db_xref="GOA:Q9RXR4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXR4"
FT                   /protein_id="AAF09826.1"
FT                   /translation="MCPARLRTPRTASLPTHRRSAMTTANPLNTSFTSADAAELYQVPN
FT                   WSGGWFRVSDKGLMEATPAPGLHASLRAIVDEIVDRGESLPVILRFPQVLAGRVKHLNE
FT                   AFQAAINEYNYSGHYQGVFPIKVNQRRAVVETVAAAGYDYAHGLEAGSKAELALCLAQK
FT                   MHPDALLCCNGFKDDGFIKLALWGRTLGKNVVITIEKFTELDRILKQAKALGVKPAVGV
FT                   RFKLHARGSGQWEESGGDQAKFGLNAYELLRVVERLKEENMLDSLVMLHTHIGSQITDI
FT                   RRVKVAVREAAQTYAGLIAAGADLKYLNVGGGLGVDYDGSKTTFYASMNYTVKEYAADI
FT                   VYTVQEVCKAREVPEPVIVSESGRALTAHHAVLILPVVDVTGPTRNLEDQELTVPGEDS
FT                   HQIVRDMYETLENISMRNYRESYNDAVGDKQTLHNLFDLGYVTLEDRARGEALFNAILR
FT                   KIAKLIQGEKYVPDELEDLQKVLADKFICNFSLFQSLPDNWAIGALFPIVPLDRLNEQP
FT                   TRQATLVDITCDSDGKVEKFIDLRDVKATLPLHEPGDRPYYLGAFLMGAYQDVLGSAHN
FT                   LFGKVSEAHVTVRPGGRFNIDLFVRGQKARRMIESMGYEEPMLRDAIEDQADAAIGRGT
FT                   LTQEQEHELLEDYGEELLGYTYLEYES"
FT   gene            complement(241049..241507)
FT                   /locus_tag="DR_0244"
FT   CDS_pept        complement(241049..241507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09834"
FT                   /db_xref="GOA:Q9RXR3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR3"
FT                   /protein_id="AAF09834.1"
FT                   /translation="MTAIRPATPTDAPLLAELRGVMQADNGVGQEQIARDLATWQAWFA
FT                   EVLASGEYVAWVAEVDGQSAGTVGLMFFPQIPSAADPHTRRPQVANMAVRPEFRRRGLA
FT                   GQLLGTALAWAQAGGYRHIGLNAAPMGIELYRRAGFTENANPAMTLKV"
FT   gene            complement(241532..242368)
FT                   /locus_tag="DR_0245"
FT   CDS_pept        complement(241532..242368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0245"
FT                   /product="hemK protein"
FT                   /note="similar to SP:Q10602 PID:1322424 GB:AL123456 percent
FT                   identity: 52.28; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09827"
FT                   /db_xref="GOA:Q9RXR2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXR2"
FT                   /protein_id="AAF09827.1"
FT                   /translation="MQLRDLLTQATARLTRAGVPSPEVDARLLLEHVLGLNRTAFLLRG
FT                   GEEIGPDAEARAWDSIERRAARVPLQHLTGEVEWGGVRLTSDARALVPRPETEWLLHLA
FT                   LEELRRVEKPRVLDVGTGTGALALGLKAAIPQAEVTATDLSPEALSLARENAALSGLDV
FT                   KFVEGSLLAGLSGPFNLIVSNPPYLPTADRATADPEVRHDPDLALYAGEDGLDVARPLV
FT                   AEAAAALVPGGALLLELDPRNAPTLAAELRTAGWQAEVRPDLTGRERFVRARRAGG"
FT   gene            complement(242373..242954)
FT                   /locus_tag="DR_0246"
FT   CDS_pept        complement(242373..242954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0246"
FT                   /product="Jag-related protein"
FT                   /note="similar to GB:D26185 SP:Q01620 GB:Z14225 PID:467387
FT                   PID:580905 percent identity: 57.53; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09828"
FT                   /db_xref="GOA:Q9RXR1"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR1"
FT                   /protein_id="AAF09828.1"
FT                   /translation="MDNRTNLDDYLAGLGISDADESALPPPAPDAAPVSAPLHGADEDP
FT                   RAVLEQFLAELTARIDPGLRVQVRETEDALEAEISGENAARLAGRDGRTLGAIEVIAYA
FT                   VLAKHAGRGDLRVRVDVGGFRKRQADTLTKLAERLAVQVAKSGEPHELQPMPPAERRVI
FT                   HIALKENPDVMSESVGEGAARRLVIRPRHG"
FT   gene            complement(243002..243403)
FT                   /locus_tag="DR_0247"
FT   CDS_pept        complement(243002..243403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0247"
FT                   /product="holo-acyl carrier protein synthase, putative"
FT                   /note="similar to GP:3449256 percent identity: 52.10;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09829"
FT                   /db_xref="GOA:Q9RXR0"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXR0"
FT                   /protein_id="AAF09829.1"
FT                   /translation="MIVAVGHDLIEIARIRRMLEREGVRAERLFTATELAYAGRYRDPA
FT                   PSLAARFAAKEAFQKVWLRPHGWRDVWVERERTPDGPFPYAAPMLGFAPAIAGEMHERG
FT                   WVAHLTLTHTREHASAVVILEHLEQRAAP"
FT   gene            243688..244404
FT                   /locus_tag="DR_0248"
FT   CDS_pept        243688..244404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:L77117 SP:Q57877 PID:1591139 percent
FT                   identity: 62.34; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09835"
FT                   /db_xref="GOA:Q9RXQ9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ9"
FT                   /protein_id="AAF09835.1"
FT                   /translation="MSAPLFPDLRLQSVAALLREGAGEWRTLGVTRIRVFGSVARGEAD
FT                   AASDVDLLVDFAPGAEVGLLHLMRVKAVLEHLLARRVDAVTEASLRAPLRGEILADAVD
FT                   VMDVPATLAPTHRPKRWRWRLFDLLATLDRLFALTAPLTLTTFQMREEVQDAALLGLLR
FT                   LGETTKYIPQSVQDRHPELPWAYLRDIRNLIAHDYFSIDPVLVWHTVRDELPALRPLLQ
FT                   ALADSPELDLIPSPRP"
FT   gene            complement(244413..245486)
FT                   /locus_tag="DR_0249"
FT   CDS_pept        complement(244413..245486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0249"
FT                   /product="oxidoreductase, putative"
FT                   /note="similar to PID:829054 percent identity: 46.58;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09836"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ8"
FT                   /protein_id="AAF09836.1"
FT                   /translation="MYGQVRASGRGPRASLSRQDRQNIRMTAPSTQSVSASPRQTHTPR
FT                   LGLGLAALGRPGYLNLGHGADLGPDKGRDDLRDHTWAMLDAAWDAGLRVFDAARSYGRA
FT                   EEFLGGWLRARGHAPDTLTVGSKWGYTYVADWRSDAPVHEVKDHSLATLERQWPETLSA
FT                   LGRAPDLYLIHSATLDSGVLDDERVLARLAELGRQGVRVGLSTSGPRQADTLRRALATR
FT                   VNGACPFRAVQATWNLLEPSAGAALAEAHAAGWTVVVKEGVANGRLSARGVTGQSDVPA
FT                   PLAAEARRLGVTPDAVALAAALQQPWVNIVLSGASTAEQLRQNLRALHLEVDLAALITL
FT                   AQPAETYWRERSALSWT"
FT   gene            245486..247498
FT                   /locus_tag="DR_0250"
FT   CDS_pept        245486..247498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 62.46;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09837"
FT                   /db_xref="GOA:Q9RXQ7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ7"
FT                   /protein_id="AAF09837.1"
FT                   /translation="MCGVTDLSDSRPSRTAARVAQVASGAALLALLLTPLAALGRTFDG
FT                   APVLLHLFGGLLNLGSTTDVRLPPAGPTQLLGLTSFALLLATFVGALRRQRWFWITGLL
FT                   AALVSVAAVLLLNRALGDEVARVAADTTIRRPVKIRLRSFYEGGGMNLGLFFSVLGGLI
FT                   ATGAGLSAQRVWWERLNRLRGLLVPAAAIALAIAVGAVVVLLVQEPINQTGAALGTWGA
FT                   WLARTDLVYFVYSTLFAPITSLNPFLDSLKLATPLIFTGLSVAFAFRTGLFNIGAPGQL
FT                   TMGAIAAMLVGVYAPASLGWLLLPLSIIAAGAGGALWGAIPGLLKARFGSSEVINTIML
FT                   NYIAAGIFVFLIGSNEFPFLGKTYNLPIKAEGYEAQSAELHEAARLPTMLDLLNVGKEG
FT                   AMALSLGWLFALITYFVARPFLRRTRQGGLLAFIAALLVGALTWRIGVPINIAGSQLNA
FT                   SFLLALACVALFGTLMWRTATGYALRAVGLSPKAAEYGGISVARGTILAMTIAGMFAGL
FT                   AGTHYVQGGALDDYRLKQNIPVNVGFDGIAVALMGQSTPAGVVASSLLFGTIDTGGVDA
FT                   DLKLDGVNKDIVTVLKALIVLFIAAGGFLSRRVTDPPPPQLAGPGGSDPNATSSLPNVA
FT                   QASRGQTGSGQGTDGIDTDPQAREGQTPAPQQGSF"
FT   gene            247495..248408
FT                   /locus_tag="DR_0251"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   GB:AL009126 percent identity: 66.32; identified by sequence
FT                   similarity; putative;conserved hypothetical protein,
FT                   authentic frameshift"
FT   gene            248513..249634
FT                   /locus_tag="DR_0252"
FT   CDS_pept        248513..249634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 56.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09838"
FT                   /db_xref="GOA:Q9RXQ6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ6"
FT                   /protein_id="AAF09838.1"
FT                   /translation="MMPSSSTPNAFQYAWRNPWVRLVVFLGLFYLLYLFIGQITTVLVD
FT                   FAVAFLIAYLANPLLGWLERGRVRRGLGVFFVLLLFLGLLALAGALVVTVGGQFVQLFQ
FT                   NLPAQIDNLNRILDGAVQWLSGRGIPGLADAQTRMTEALRDWIANIGNNIVPILQNALS
FT                   STGTLFNRLISIGGVIGQVLLILLLSVYLMLDYARVNASLLRAFPRPWQPKVLEFSDLI
FT                   GTAVGGYVRGQLLIAAFIGIFVWLGLTIVGIPSAAAIGFLAGAFNIVPYLGPIIGATPA
FT                   LLLALTLPNAGFKMILVVVVFVLANQIEGNFLSPYILSKTTDLHPVTVLLAILVGVALM
FT                   GFAGALLAVPLVALGKLMLEKYYYPSRVYSQGP"
FT   gene            complement(249638..250144)
FT                   /locus_tag="DR_0253"
FT   CDS_pept        complement(249638..250144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0253"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09839"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ5"
FT                   /protein_id="AAF09839.1"
FT                   /translation="MPRGGRKCCARGHLLGKCRGDTLTPGRATPSLRRGSPSTAREAKC
FT                   HPGRGSRSRSIILSNAQGLSERHFGSGQIRALQRDARPVERPLHSKSGPLDIFSGGPYS
FT                   FFRWSGSVAVSISACHAEGRGFKSRPDRQQDERGALGSSLVFLFVWLPQRNKKCLPSKE
FT                   ALAKV"
FT   gene            complement(249750..249822)
FT                   /locus_tag="DR_t0253"
FT                   /note="tRNA-Asp-3"
FT   tRNA            complement(249750..249822)
FT                   /locus_tag="DR_t0253"
FT                   /product="tRNA-Asp"
FT   gene            complement(251343..251762)
FT                   /locus_tag="DR_0254"
FT   CDS_pept        complement(251343..251762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09840"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ4"
FT                   /protein_id="AAF09840.1"
FT                   /translation="MIGAGILTCCPSAAPFGLTLGPDFPWADDPSPGTLVLTAKKILTS
FT                   FIVTHAGIRTSVGSTTPSGMASPRTERSPTRQLASRVESIASVDHLSPDHFRRIVTRPV
FT                   SYYALFEGWLLLSQPPGCLCDDTSLTTERSFRDLS"
FT   gene            252343..254285
FT                   /locus_tag="DR_r02"
FT                   /note="rrnaC23S"
FT   rRNA            252343..254285
FT                   /locus_tag="DR_r02"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(252983..253994)
FT                   /locus_tag="DR_0255"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   PID:1737165 percent identity: 49.68; identified by sequence
FT                   similarity; putative;transposase, putative, authentic
FT                   frameshift"
FT   gene            254392..254515
FT                   /locus_tag="DR_r03"
FT                   /note="rrnaC5S"
FT   rRNA            254392..254515
FT                   /locus_tag="DR_r03"
FT                   /product="5S ribosomal RNA"
FT   gene            254523..254595
FT                   /locus_tag="DR_t07"
FT                   /note="tRNA-Gly-3"
FT   tRNA            254523..254595
FT                   /locus_tag="DR_t07"
FT                   /product="tRNA-Gly"
FT   gene            complement(254721..256574)
FT                   /locus_tag="DR_0256"
FT   CDS_pept        complement(254721..256574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0256"
FT                   /product="pyruvate dehydrogenase complex, dihydrolipoamide
FT                   acetyltransferase E2 component"
FT                   /note="similar to GB:L42023 SP:P45118 PID:1007136
FT                   PID:1221359 PID:1205473 percent identity: 64.22; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09841"
FT                   /db_xref="GOA:Q9RXQ3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ3"
FT                   /protein_id="AAF09841.1"
FT                   /translation="MAAMVSHSSPVDGAPVSRPRSPVMATELKLPDVGDNIEKGTVVTV
FT                   LVNPGDSVTEGQPIIEIETDKAVVEVPASAAGTIEAVNVKVGDTIPVGGVIATLGGGAA
FT                   SASDSAPSASAPSPANGGGDQAANVESTPATDSGTAQRVAQAQQDAQKEQAGQPTSGGT
FT                   ADANQAQATPSEGQSSGGQQVTLPDVGDNIEKGTVVTILVNVGDTVSEGQPVIELETDK
FT                   AVVEVPANASGTVQSVAVKIGDSIPVGGTILTLSGAASTQPTAPAPESAQPASQSQQST
FT                   QPEPARPAGAPQAQAAAPQQSGTQNPQTFDGRPVVPAAPSVRRLAREIGIDIHAVHGTG
FT                   IAGRISEEDVRRTAGTPSVQAQASAASAAAPAPMAAPLPNFEKWGTVRREDMSGIRKAT
FT                   VRSMTTAWTTIPMVTHFDKADVTAMEETRKRFGARVEKEGGKLTMTHILMKVVANALRK
FT                   FPKFNASLDLGAEQVIYKEFVNIGVAVDTPVGLLVPVVKDADRKGITELVLDLSELAGR
FT                   ARERKLKPDEMQGATFTISNLGGIGGNAFTPIVNSPEVAILGVSRGGFEPVWNKEKGEF
FT                   EPRNMLPLSLTYDHRLIDGADAARFLRYICESLEDPFLISL"
FT   gene            complement(256624..259425)
FT                   /locus_tag="DR_0257"
FT   CDS_pept        complement(256624..259425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0257"
FT                   /product="pyruvate dehydrogenase complex, E1 component"
FT                   /note="similar to GB:U09865 PID:497264 SP:Q59097 percent
FT                   identity: 70.21; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09842"
FT                   /db_xref="GOA:Q9RXQ2"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ2"
FT                   /protein_id="AAF09842.1"
FT                   /translation="MTNSGGQSPELFMLEGVSGASYTAFMTPQPPPRPPRADLPEQQRE
FT                   QLNTVETQEWLDSLAYVFANAGSKRAADLLEDLDHYAYFHGAPIEFRQTTPYINTIAAE
FT                   DQPEYPGDLELERKIRNINRWNSVAMVIKANKKSDGIGGHLSTYASAAELLEVGFNHFF
FT                   RGHGAGQDRDLVFYQGHAAPGMYARSFLEGRFDEARLNRFRRELQPDGEGLSSYPHPWL
FT                   MPDYWEFPTVSMGLGPIQAIYQARFIKYLENRGLKPQGNAKVWAFLGDGEMDEPESVGA
FT                   IRFAAYENLDNLIFVLNANLQRLDGPVRANSKVIQEFEALFRGANWNVIKVIWDSKWDE
FT                   LLQHDYNGVIVKRFEDLVDGESQRYAAFGGKELREHFFNTPELKALIQDWTDADLELLN
FT                   RGGHDVQKVHAAYASAMGHKGSPTIIIPRTVKGYGLGETAQARNVAHQVKKLEFDALKN
FT                   LRDLLELPLSDEQVEHLEYYHPGSDSPEVKYTLARREQLGGLIPARQVNFPHLTVPQGS
FT                   FYEEFAKGSGERQVSTTMAAVGIMSKLLRDKEIGKYIVPIVPDEARTFGMDALVPRIGI
FT                   YSPRGQTYRPVDFGSLMAYKEAKDGQMLEEGITEAGAMASWIAAGTAYAHHGVPTIPFY
FT                   VFYSMFGMQRIGDLVWAAADQRARGFLLGATAGRTTLAGEGLQHQDGNSLLQGYVVPTM
FT                   KTYDPAFAYEVAVIFEEGIRRMYVEDVEEFYYVTVDNENEVQPPMPEHLSHEEIRHGIM
FT                   KGLYRFQPSTLEGAQHHAQLLASGPAMGAAQEAVKLLEGYGVAADLWSVTSYKELHQEA
FT                   LMVQRHNMLHPTEEPQVSYVAAQLNEENAPGVLISVSDYVKLGADGLNGHLDRKLWTLG
FT                   TDGFGRSEAREELRDFFEVDTKHVVLATLYALQQRGEVKGEVVAKAIADLGIDPSKPAP
FT                   VLR"
FT   gene            complement(259538..261172)
FT                   /locus_tag="DR_0258"
FT   CDS_pept        complement(259538..261172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0258"
FT                   /product="multidrug-efflux transporter, putative"
FT                   /note="similar to GB:AL009126 percent identity: 61.54;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09843"
FT                   /db_xref="GOA:Q9RXQ1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ1"
FT                   /protein_id="AAF09843.1"
FT                   /translation="MTAAAPIPAAPHNTLSEREKLLAFAGILTVLFLSSLNMTVVGSAM
FT                   PRVISDLGGFHLYAWAFTAYSLTTTVTIPIVGTLSDRYGRRPLILLGIVVFALGSMGLG
FT                   FVQSMEQLIALRAIQGIGGGTLMAMSFTAIADLFTPIERGRYQGYTGAVWGISSVVGPL
FT                   VGGFLTDHFGWRSVFFLNLPFALLALFFIWRFFRLPAPTPGSVKGGFDALGATLLAGAV
FT                   TTLTLAVSWGGGTYAWDSPRILGLLGATLALGAWYAAHSARQERAILDLGLLRDRGILL
FT                   ASLAGFLVSAGMYAAILYLPLYMQGVRGSSASGSGLALAPLMGGMILTSTLSGQLVSRT
FT                   GRYKRLIVGGALVASLALVLSSTLSLSTPLWLAVTMMILLGLGLGPVNSQLTLAVQNAA
FT                   PRQKLGSATGGNQFFRQIGGTLAVSLFGALVNAHLSHDLSAKLPAAVRRLPAPMQDAIA
FT                   NPNLLTSERATHLLGWALKKMGHHEMLAPIMQALRGVMVGAIDQVFLVSAGLVGLAFVL
FT                   TLALPERPLQGRAQSRPQVAEEAVATD"
FT   gene            complement(261169..261675)
FT                   /locus_tag="DR_0259"
FT   CDS_pept        complement(261169..261675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:Q10846 PID:1403442 GB:AL123456 percent
FT                   identity: 49.63; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09844"
FT                   /db_xref="GOA:Q9RXQ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ0"
FT                   /protein_id="AAF09844.1"
FT                   /translation="MEMNVPPPSPESDELYALVRTVLRLSRRLRQTLDDPLERALGLNT
FT                   RELLVLSAIMDGYDTPGAVAERHNLPAPTVTRVVTKLVEGGLLSRENDPSDLRRQRLVL
FT                   TPQGERTRSETRRRASATVQEHFGHLDPALVQATLSNLRALEGTLPVPTEKIPTEKNTP
FT                   REVTA"
FT   gene            complement(261733..262881)
FT                   /locus_tag="DR_0260"
FT   CDS_pept        complement(261733..262881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0260"
FT                   /product="CynX-related transport protein, putative"
FT                   /note="similar to GB:D26185 SP:P37482 PID:467333
FT                   GB:AL009126 percent identity: 59.89; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09845"
FT                   /db_xref="GOA:Q9RXP9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP9"
FT                   /protein_id="AAF09845.1"
FT                   /translation="MNRAPRPLLVLGIVLVALTLRPVIAGFGPLLPRVQAELHASAATM
FT                   SLLTTIPLVCWGIFALVTPRLTRWRSPEVLIGLCTALIALGTWLRTGAALPPILLGTVL
FT                   VGVGIAIVNVLLPSLLRRDFPRQLGLMTGLYSLAVVGGAALASALAVPLERTLGGWRGS
FT                   LGVWAWLSGAALLAWVPAMLGRPARSAGPAVRGPSVWSNPATLPVTLYMGTQSLVFFTW
FT                   LTWLARLLQDRGLSAEAAGALLSLGNLVQLPFTLSVPVLASRLGNVRPLVFGLVACNAA
FT                   GLLGLTLWPTASPLPWVLLLGVGAGSAFPLALHLIAVRARDAAEVPRLSATAQGFGYLL
FT                   AASGPFLFGALHDLSGGWSASLSALLVGTAAMLVTGLWAAQR"
FT   gene            complement(262878..263456)
FT                   /locus_tag="DR_0261"
FT   CDS_pept        complement(262878..263456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0261"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GB:D10483 SP:P08337 GB:M20791 GB:X04831
FT                   PID:147795 percent identity: 58.72; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09846"
FT                   /db_xref="GOA:Q9RXP8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP8"
FT                   /protein_id="AAF09846.1"
FT                   /translation="MCSQPLPKQGTPGDASGSITACSEAGRVPDLPTLLLGASLPAMTL
FT                   LVWVVLRGASGRVLLARRQGTAYANGLWGLPGGRVESGETLQDAARREVREEIGVEVTG
FT                   LGVFGVSRFEAQGQPGVAFLFLAEQWQGEPTPLDLTSEVGWFTLDSLPPDALPWLAPVL
FT                   DLHLRRGVRVSEQHTGTVTALPDAPLRQP"
FT   gene            263536..264567
FT                   /locus_tag="DR_0262"
FT   CDS_pept        263536..264567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0262"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, solute-binding family 1"
FT                   /note="similar to GP:3319740 percent identity: 61.30;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09847"
FT                   /db_xref="GOA:Q9RXP7"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP7"
FT                   /protein_id="AAF09847.1"
FT                   /translation="MRKLIVAALLLGAAQAQAQTTLTVITHDSFDVDKKLVAQFEAQNK
FT                   AKVRFVKGGDAGELLNRLILTRRAPIADVVYGLDNSLLARAQQMNLLQPYRSPALGKVP
FT                   AGYRLDDAGLLNTVDYGYVALNYDRAYFQKAGLALPKSLDDLKKPEYARLTVVSSPATS
FT                   SPGLAFLLATVNHYGEAGAWQWWKTARAGGLKVVRGWSDAYYKDFTRAGGKYPIVLSYA
FT                   SSPAAEVFYADNYDPAKLPAQAPTANLLLPGSTWLQLEGVGVLKGAKQPALARKFVDFM
FT                   LSPAVQADIPTRMWIYPAVSGTKLDPVFKFTQQPDPAPVKASVTANPQRLVDAWVQNVL
FT                   RSR"
FT   gene            264954..265340
FT                   /locus_tag="DR_0263"
FT   CDS_pept        264954..265340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09852"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP6"
FT                   /protein_id="AAF09852.1"
FT                   /translation="MTCGSSFASMFMAGLFTPGSFVDIEGQHRRFGGHFAALAQFAHLV
FT                   GLLVGQRPNAVRHLIGHVGKLHALDFHAALAAFQRDEAGRDRAVLKDHHEVFVHGSYLS
FT                   ACPGRRPSRALPSPQENAPAGAQT"
FT   gene            complement(265347..267509)
FT                   /locus_tag="DR_0264"
FT   CDS_pept        complement(265347..267509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0264"
FT                   /product="glycogen operon protein GlgX"
FT                   /note="similar to SP:Q10767 PID:1403478 GB:AL123456 percent
FT                   identity: 73.33; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09848"
FT                   /db_xref="GOA:Q9RXP5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP5"
FT                   /protein_id="AAF09848.1"
FT                   /translation="MPYKSLTLRPGSPFPLGATWDGKGTNFALYSENATGVELCLFDAE
FT                   GHETRFPLTEQTAFVWHGYLPGIQPGQRYGYRVHGEYAPEKGLRFNPNVVLLDPYAKAL
FT                   DGTEQFDRGVFGYVAGGEDDSQMQEEEQRGAPLGLVVDPMFNWVGDQKPGIPFHQSVIY
FT                   EAHVKGLTMTHPDVPEELRGTYAGVATPAILDYLRDLGITAIEFLPVHQHVDDPFLLDK
FT                   GLTNYWGYSTLNFFAPDVRYSAEARKGNPSGAVPEFKNMVRALHDAGIEVILDVVYNHT
FT                   AEGNHMGPTMSFKGIDNPTYYRLVADDQRFYFDYTGTGNSLNVRHPQTLQLIMDSLRYW
FT                   VTEMHVDGFRFDLASTLARGLHEVDQLSGFFTIIHQDPIISQVKLIAEPWDVGEGGYQV
FT                   GNFPVNWAEWNGIYRDDMRSFWKGEGGLASEIGYRITGSSDLYEFNGRKPYASINFVTA
FT                   HDGFTLRDSVTYEQKHNEANGEGNNDGHNHNITWNCGVEGPTDDPEINRLRGQQMRNFL
FT                   ATLLLGQGTPMILGGDEFGRTQGGNNNAYCQDNDISWYDWEKVDEELLAFTRKLIALRK
FT                   AHPSLHRRKFFAGRNIRGEDVRDIVWLRFDGAEMSDEDWNNPQTQSLGMFLAGDGLADV
FT                   DAEGKPLTDDHLLLLLSSSYVDLPFKMPDLGGCGEWDLLLDTSDDGAEEKVAAGGETTL
FT                   RGRSVKLYRCQVPEKELEKLAEPAEA"
FT   gene            complement(267723..268487)
FT                   /locus_tag="DR_0265"
FT   CDS_pept        complement(267723..268487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0265"
FT                   /product="histidine utilization repressor HutC, putative"
FT                   /note="similar to GB:AL009126 percent identity: 51.79;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09849"
FT                   /db_xref="GOA:Q9RXP4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP4"
FT                   /protein_id="AAF09849.1"
FT                   /translation="MCVDELNFTITSVSALRGASPEARMAKYPLIKTTLKDRLLGGHYP
FT                   EGLPLPSEPQLAREFEVSRMTARRAIDELEREGYVYRVQGAGTFPTGKRFRQGVFRVRP
FT                   FKEWARHPDHRTTVLRAMQIEATPEIAVILQIDPGDPVIFVHRLRTAGDEALVIEKRYI
FT                   NARMVPNLLERNLAVESIHETMVSMGVPLQRVEQNLEAVNLRQEEADLLRVPLGTAAFL
FT                   LRRTTYSENRRASYANYWVRGDRYAFQDTFEP"
FT   gene            complement(268693..269690)
FT                   /locus_tag="DR_0266"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   GB:Z35277 SP:P39757 PID:516272 PID:1648856 GB:AL009126
FT                   percent identity: 75.52; identified by sequence similarity;
FT                   putative"
FT   gene            complement(269795..271330)
FT                   /locus_tag="DR_0267"
FT   CDS_pept        complement(269795..271330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:Q11024 PID:1419057 GB:AL123456 percent
FT                   identity: 59.20; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09850"
FT                   /db_xref="GOA:Q9RXP3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP3"
FT                   /protein_id="AAF09850.1"
FT                   /translation="MQASNRSGAPSLMKLTPLHVLLLLSATLHLGLTLVNTGESAAPLW
FT                   AIDAVFLVVIALSFGVAVQGWLAERRRPERQRGLGGFVVSMLLLLLAEAWTLRYDLPGR
FT                   VVPEISLADPLYLLSYLGMAQTLMRLSGLRGWSVGAAVNLLDSLTVMIVVAEVAWLRFL
FT                   AAALAEPGISPLMRGINLTYVALDLLVLGLALLALRRRFSPPLLLFGVGMLAFVMADFQ
FT                   YFALGMKGTYRAGTLLDSLWAWGTAAQACAIVWAWQTRSWSLPRTPAGTLQVARRDRVL
FT                   VLLPYLAMIVSGFLLLRSGVSPQFPHKQIEIWTVALFVVVMLRQAFVGWESARLNQQLA
FT                   RQAQELHHLAFHDALTGLHNRAAFEDELQRQLHVPRPQPLALLYLDLNNFKPVNDTLGH
FT                   AAGDQALAQVAQRLQAALPAGTFVARLGGDEFAVLLTSIPDEDAAWAAEEQIRAALERP
FT                   MQLGEHVVHLSAAVGVTLAPAGEAVVPEILWREADQAMYRVKHSASDPGALPS"
FT   gene            complement(271585..272550)
FT                   /locus_tag="DR_0268"
FT   CDS_pept        complement(271585..272550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09853"
FT                   /db_xref="GOA:Q9RXP2"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP2"
FT                   /protein_id="AAF09853.1"
FT                   /translation="MKRFTVPALVLLGALAGPAQAAAPARTVTIGLGYVPNVQFTPFYV
FT                   ADRLGYFGAEGLNVKFQHGYISELMPLLLQGKLDFVVGDPEDAIFARNQGAPVKYALAM
FT                   YQKSPVTLFSLKPLTNAASLRGKTLGIPGPFGSSYHAVQAYLANAGLKEGRDVRLATIG
FT                   FTQQEAVRSGRVNAAAGYLNNDVVLLRAAGKKVYTLDTFAAYPMVGVGLIAQDKTLGTA
FT                   LAKKVVRASQRGLKYTVQNPAGAFKTAQPVFGKAGGTLDILKASVPLMQSAYTRQNGLG
FT                   AGAPANWTKAVAALVKQGKLPAGAQASTFYTNALIDKAVR"
FT   gene            272688..273698
FT                   /locus_tag="DR_0269"
FT   CDS_pept        272688..273698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXP1"
FT                   /protein_id="AAF09854.1"
FT                   /translation="MTTGLPAVGAKEQEMTNADEQNMGQQEGTDTATTAQDTNTQTVGT
FT                   QSENTQNTQQASDAQTEQTPAELRDVLPQLTGEVDEDDVLDAQEEQAAGQSARKVDEDG
FT                   EEYEEEFIDADDLMGLLGEMKEMLEAQSKEIRGLRREMRELRESQGGGFRGGDRGGDRG
FT                   GFRPREDRGGFGGDRDRGGFRPREDRGERSFGGDRGGDRGGFRPREDRGGFGGDRDRGG
FT                   FRPREDRGERSFGGDRGGDRGGQGGFRPREDRGGFGDRDRGGFRPREDRGERNFGGDRG
FT                   GDRGGQGGFRPREDRNFGDREFRPRTDDAQGNQEGGFRPRARADRGWANRRTDEE"
FT   gene            273991..274986
FT                   /locus_tag="DR_0270"
FT   CDS_pept        273991..274986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0270"
FT                   /product="ElaC family protein"
FT                   /note="similar to PID:1001103 PID:1001126 percent identity:
FT                   48.81; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09851"
FT                   /db_xref="GOA:Q9RXP0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXP0"
FT                   /protein_id="AAF09851.1"
FT                   /translation="MLSAAVLGQPTRDNALWVTADSGKGQTRLLLDCGGHTLDTLPLHE
FT                   VQATDHLLFSHLHMDHIAGFDDFFRVNFDRQSRENHLWGPPGAARILAHRLQGYWWNHA
FT                   PQLRATWRIHEVDDAAVHTWRFELHEAFEIAHDEGRTPRTGPLIETPHLRVDAVPLQHQ
FT                   GPCLGYVLREPGRVNVDPAGLTRLDLTPGPWLAALKAGAEEVEIAGERRPAAPLRAELL
FT                   REEAGDSLAYLTDFLLDEAELARLAPLLAGVRTLYLEAQYAPADADLAARNHHTTTEQG
FT                   ATLAARAGAQELVLLHLSRRYREADWREMLRAAQAIFPAARFAESWLRGT"
FT   gene            complement(275110..275949)
FT                   /locus_tag="DR_0271"
FT   CDS_pept        complement(275110..275949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09867"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN9"
FT                   /protein_id="AAF09867.1"
FT                   /translation="MRILNIPVTPAELGRWRGHLAPPRQPFFLSRADAERLDLPATPRS
FT                   LLQLTPEERDTFTLWAVDQAADQVTWLSPAQWAALPPAGRRELLRLQVRAGRGNVPLGR
FT                   HYSDLVPGLAPGRFLWQRDHLTPAVLARLVSREGVACQREAVPPAVWEAARPLLPRARE
FT                   LAGTFPQGSAGNCFGAVMGAAGLSGAEHEWMQRDPFEAFLRERARQGGQDEQPGTLLVW
FT                   RSERGVEHAAVTLGGGWAFQKAAQTWWTPRAVLPVAEVKRTNRVRGWRLERWQLRPG"
FT   gene            276011..276340
FT                   /locus_tag="DR_0272"
FT   CDS_pept        276011..276340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 58.23;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09855"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN8"
FT                   /protein_id="AAF09855.1"
FT                   /translation="MITVANRIFVNPERAAAFEERFRRRPRRVDRQPGFIADHVLRPTQ
FT                   AGDPYVVLSFWDSRAAFEAWRTSPGFKDGHKGGRTLPEDTVLSNVIEIHEVFTGSDDAG
FT                   TGEES"
FT   gene            276327..276908
FT                   /locus_tag="DR_0273"
FT   CDS_pept        276327..276908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09868"
FT                   /db_xref="GOA:Q9RXN7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN7"
FT                   /protein_id="AAF09868.1"
FT                   /translation="MRKAEVTTIHDLRSTFPRAGRLNWIGLREGRRLPVLSVPEAEAHP
FT                   LVGLLGDHGKTAPPRLTALSGEAGEVATPAHAPAIPGGPGRRQVTLIQAEHLPVIAALA
FT                   GLGSVAPELLRRNLLVSGIPLLALKDRRFQIGEVVLEGTGECHPCSRMEETLGPGGYNA
FT                   VRGHGGLTARVIRGGRLRVGDPVTVWEEER"
FT   gene            276905..277441
FT                   /locus_tag="DR_0274"
FT   CDS_pept        276905..277441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0274"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to SP:P54570 PID:1303984 GB:AL009126 percent
FT                   identity: 50.00; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09856"
FT                   /db_xref="GOA:Q9RXN6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN6"
FT                   /protein_id="AAF09856.1"
FT                   /translation="MIHLPTMEHAPGLVQRLREGAVCVTRTAVKAVIRREGQLWLLHSP
FT                   PWACFKFPGGGVEMGESHAEALARELREELGAELRGPGPLLLTVTELWPAREPDAELFR
FT                   MDSLYFACEVEAGQHAPQLEAYESELGLTPCWVTPQAAAEANAAAQAREGAPDWLKREV
FT                   AVLRALGKPGATLTP"
FT   gene            277438..277986
FT                   /locus_tag="DR_0275"
FT   CDS_pept        277438..277986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 52.90;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09857"
FT                   /db_xref="GOA:Q9RXN5"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN5"
FT                   /protein_id="AAF09857.1"
FT                   /translation="MSVSRPPPTSPRTAKGAFGLTRLIVELGVFSSAVFSLTLFVAAIV
FT                   QAYHTVAQALHKLGEEGTAKGLMIAAVEQADLLLVGMALLMMSFGMQALFVGRLENVPD
FT                   WLHIRSFDDLKQKLIGIVVVALGVNFFSVALAWKGGSDLLSYGAALAAVILALSGYSLL
FT                   LGRRGHAGEAGEDHDASRA"
FT   gene            277967..278644
FT                   /locus_tag="DR_0276"
FT   CDS_pept        277967..278644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:P54471 PID:1303835 GB:AL009126 percent
FT                   identity: 52.49; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09858"
FT                   /db_xref="GOA:Q9RXN4"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN4"
FT                   /protein_id="AAF09858.1"
FT                   /translation="MTLPALDARLEAVLHLIRAEVHADIGTDHARLPLRLVRGGRVSRC
FT                   VAVELNPGPLALARRMVARARLTEQIDVRQGDGFAPIQPGELGSASVTGMGAYTIRGIL
FT                   DRAGERLPPALVLQPNDSPLWLRTWARENSYHLRAERLLPGYWAYPVLRLERAEGPDPA
FT                   YADLPAAAALRYGPLLLRKGPALLRARIEADIERLTPVAAPGREAWAELAAAREALAVV
FT                   DAG"
FT   gene            complement(278664..279530)
FT                   /locus_tag="DR_0277"
FT   CDS_pept        complement(278664..279530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0277"
FT                   /product="gluconolactonase, putative"
FT                   /note="similar to SP:Q01578 GB:X67189 PID:48655 percent
FT                   identity: 54.15; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09859"
FT                   /db_xref="GOA:Q9RXN3"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="PDB:3E5Z"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN3"
FT                   /protein_id="AAF09859.1"
FT                   /translation="MTLRAARPEFLDLFPAGAEARRLADGFTWTEGPVYVPARSAVIFS
FT                   DVRQNRTWAWSDDGQLSPEMHPSHHQNGHCLNKQGHLIACSHGLRRLERQREPGGEWES
FT                   IADSFEGKKLNSPNDVCLAPDGSLWFSDPTYGIDKPEEGYGGEMELPGRWVFRLAPDGT
FT                   LSAPIRDRVKPNGLAFLPSGNLLVSDTGDNATHRYCLNARGETEYQGVHFTVEPGKTDG
FT                   LRVDAGGLIWASAGDGVHVLTPDGDELGRVLTPQTTSNLCFGGPEGRTLYMTVSTEFWS
FT                   IETNVRG"
FT   gene            complement(279578..280192)
FT                   /locus_tag="DR_0278"
FT   CDS_pept        complement(279578..280192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0278"
FT                   /product="phosphoglycerate mutase, putative"
FT                   /note="similar to PID:1556402 percent identity: 53.57;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09860"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN2"
FT                   /protein_id="AAF09860.1"
FT                   /translation="MAGPDLTLLLVRHGATAWNEGGQWQGWTDNPLGDAGRAQARALRE
FT                   ELAGQTFDAVYSSDLTRARQTAELALPGRALRLDARLRELNLGDYEGHTLAQMQAHGGY
FT                   AGWQADPWAQAVPGGESLQDVAARMRGWLTDVQAEFPGGRVIAFSHSIALRTLARDLLG
FT                   LPLEPQVNYPIPYAERIKNGRCMVLECRGGTWRRAGANAAS"
FT   gene            complement(280195..280863)
FT                   /locus_tag="DR_0279"
FT   CDS_pept        complement(280195..280863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:2995392 percent identity: 60.45;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09861"
FT                   /db_xref="GOA:Q9RXN1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN1"
FT                   /protein_id="AAF09861.1"
FT                   /translation="MAVRVCCHAPPGVSNHLFTFCAGNLTTGFSGGSVTSQKGGAAGLP
FT                   TCSRRCPRGCLPGSDPLPRHPRRYAPPVTPPVTPPTTPAPRSRARMLELVFPKDTNYHG
FT                   TAFGGWVLALMDKAASVAAVRHAGGNVVTARMDGVDFHVPIRVGDAVALDARVIRVGRS
FT                   SMTIRVDVYRENMASGEQQLATGGLFTFVALGEDGKPRPVPPLPEGSTDSEQPDYEARP
FT                   "
FT   gene            280898..281992
FT                   /locus_tag="DR_0280"
FT   CDS_pept        280898..281992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0280"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein"
FT                   /note="similar to GB:AE000782 percent identity: 57.28;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09862"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN0"
FT                   /protein_id="AAF09862.1"
FT                   /translation="MTGGFNMKRIGFLALLSLCAGSALADKVVNIGFSGPLSGGAAAYG
FT                   KDTLSGLQMAVDTLNKSGGIKVGNDKVTFKVVSLDDRYLPNETATNVKRLTGQDIQFIF
FT                   VPHAGGIQAVQPLAIRDPEFLLVAYSSEPKILAANNPLTFMLPPRYDNYAQPFVATEMK
FT                   TFGKKLALVGTSSAYGKQWADLIESEWKKQGGTVGRDNAVDYNTTVDFSAAVTKALSEK
FT                   PDVLFIGGPSQPTALVIKAAREQGFKGGFIVMDQAKFEQMETVIPKNYLDGSVGVLPTR
FT                   DFPGTQSFVVQYQRAYKKIPTSEAGLNYMGMNVLAKAMELAGTTSDPRKVRAQLDAAAK
FT                   ALPQSKTVYKVFGVTPQATWTPSS"
FT   gene            282172..283029
FT                   /locus_tag="DR_0281"
FT   CDS_pept        282172..283029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0281"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="similar to GB:AE000782 percent identity: 67.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09863"
FT                   /db_xref="GOA:Q9RXM9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM9"
FT                   /protein_id="AAF09863.1"
FT                   /translation="MTTVLQQLFNALALGGVYALVALGLTLVYGVMKIPNFAHGGLYML
FT                   GAYLSYAGISSLGLGYVPALLLSAVVVALLAALMERVIFFPLRNAPHVQPMIAALGVLF
FT                   FLEAGVQLIWGADFKQVAEPIPGILNIGGVTITWQRLIVLVASVVAMLGLNFFLRRTLT
FT                   GATIEAMAQNREGARLVGINTGRVGMLTFAISGALAAIGASLIAPIVSVTPAMGEIMNL
FT                   KVFAIIILGGMGSIPGAIVGAFLLAFAEVFGGYINLDFAEVIGFAVLVVVLAIRPQGLF
FT                   RRAA"
FT   gene            283026..284030
FT                   /locus_tag="DR_0282"
FT   CDS_pept        283026..284030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0282"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="similar to GB:AE000782 percent identity: 59.35;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09864"
FT                   /db_xref="GOA:Q9RXM8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM8"
FT                   /protein_id="AAF09864.1"
FT                   /translation="MMGARGKSTAAWLWIPAFLLAAAVPFLHPSGFTMELLINVMIWSI
FT                   VTYGLNVLLGYTGQLPLAHAGFFGIGAYTVGILTLKHGWSFWAAWPLAVVLCALGGLLL
FT                   GLVAFRTKGDAFSIFTLGVGVIIQQVINKWDALTGGNDGLNGIAPPAGLDTFAHGLGLK
FT                   LNGGFYLLALLALALTVLVAARARHSVFGRSLLAIRGGEDLARSAGIDVFGHKLRAMML
FT                   STAIAGFAGGLYAVYVGFLGSAVTGPVTTFTTLLYLLVGGVGTLLGPLLGTALMYGLTQ
FT                   LLKDLQDYQYIVFGPLLVLLVMFMPQGLVGLWEKVRARRRPVSAPSAAEVSHD"
FT   gene            284023..284895
FT                   /locus_tag="DR_0283"
FT   CDS_pept        284023..284895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0283"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="similar to GB:AE000782 percent identity: 70.33;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09865"
FT                   /db_xref="GOA:Q9RXM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM7"
FT                   /protein_id="AAF09865.1"
FT                   /translation="MTNPSTPPLSGAPLLEVQGLGIRFGGLHAVRDVTAQLQPGRITAI
FT                   IGPNGAGKSTFFNLISGFYKPTSGRIIFRGEDITPLRTHLVVGRGIARTFQTTTIYQEL
FT                   SVLDNAMIGHRVRTRAGLLDALLRTGRERHDESESRAGAMRALERVGLAGQAALPAGAL
FT                   NQEGKKRVGIAMALASDPHLLLLDEPAAGMNPEETENLMGLIRQLVSGGLSIALVEHKM
FT                   NLVMGLADDILVLHHGQKIAQGTPAQITRDPAVVEAYLGSHAHGGQMGQEQEQGGQPGT
FT                   VQDAGVDHA"
FT   gene            284888..285595
FT                   /locus_tag="DR_0284"
FT   CDS_pept        284888..285595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0284"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="similar to GB:AE000782 percent identity: 70.04;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09866"
FT                   /db_xref="GOA:Q9RXM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM6"
FT                   /protein_id="AAF09866.1"
FT                   /translation="MLEVRDLSVKYGNFTALHSINLTVQPGEIVVLLGANGAGKSTLFR
FT                   TLSGLQRPSGGAATWQGTPLTGGKPEFNVSHGVSQCPEGRLLFPELSVEKNLRLGAYVH
FT                   RRDAAGNERELEKVYELFPAMVDKRHAPAGSLSGGQQQMVAIGRALMARPSLLLLDEPS
FT                   LGLAPLVVEQVLAAAQQINAQGVSVLLAEQNAYAALSIAHRGYVLESGQVTLQGTAQEL
FT                   MNDDRVRSAYLGV"
FT   gene            285770..286477
FT                   /locus_tag="DR_0285"
FT   CDS_pept        285770..286477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM5"
FT                   /protein_id="AAF09878.1"
FT                   /translation="MNQNFRRLSLLAGSVALASLLTACPGRRMYDPGVTLRFSLPEGES
FT                   QSGPMAIQAMYTTRDEAGQVVMKPLPEGSGYGYFGGREGSITLNKVSLDKVLADGKCLP
FT                   YRADKVTRVTEPAAVRSCDINFFVYSGSANSPAQPSSANLRYLTHDTYSYAGQNFTYTS
FT                   AFSDKGLTSQETGTRRAGWSLVRHLVLHPSDAPNTYRVVRDSVEDSQLNLPITLHAPSD
FT                   YFTSMGVSTGGAQ"
FT   gene            286474..287112
FT                   /locus_tag="DR_0286"
FT   CDS_pept        286474..287112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0286"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09879"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM4"
FT                   /protein_id="AAF09879.1"
FT                   /translation="MTSHTVKSQTAKLTPLLALTVLGAALVSCGQQNTAPNLGGLPPLD
FT                   TGITVRFDAAPDNTYLTLSTDEDAASKVVYQKAVPTGARDFKPDLNDWKALSKDAVALT
FT                   LPGGQTTPAVLFLKWGMFQDKNSNGKPDAGEWLNRMTHDRVAYADKAFQAEFDEPAAMH
FT                   QVWNIASGWSRAEHYVYAPLEGKDDFRRFSRSTTFWDFTLHVETPLSSM"
FT   gene            287245..290115
FT                   /locus_tag="DR_0287"
FT   CDS_pept        287245..290115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0287"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /note="similar to SP:Q59106 percent identity: 71.15;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09869"
FT                   /db_xref="GOA:Q9RXM3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM3"
FT                   /protein_id="AAF09869.1"
FT                   /translation="MTQSHDEPMQTMMWGGNAAFIEGLYESYLQDPSSVGAEWRSYFDG
FT                   LRGGAQERVHSEVQQRFYELGQHRGPVTVQVTGGASGAQQAAGALVTAYRVYGHISARN
FT                   NPLKLRGVPTVPELTPEFYGLSEADLSEQVQDSPFSGTLRDVIAQLQDTYCGAIGFEYN
FT                   YLPANERAWFQERIEKGRGQGRYGLSQDERRRLMQKLNAAEGLELYLKNRYPGVKRFGL
FT                   EGGESFIPLMDRIIQQAGGRYGVKEVVVGMAHRGRLNTLVNIFGKPSGTLFDEFDGKKK
FT                   LSDDPDIAGDVKYHMGYSSDVRTPGGPMHLAMAFNPSHLEIVSPVVHGSVRARQDRRGD
FT                   TERKQVLPITVHGDAAVSGQGVVMETLNFSRLRGFTTGGAIRIVINNQIGFTISDPRDS
FT                   RSSRYCTDVAKIANAPVMHVNGDDPEAVAFCGDLALAYRQEFGKDVFIDLICFRRNGHN
FT                   EGDEPRMTQPVMYREIDQHPGTRALYAAQLEKDGVLAAGEGDKLVNDFRDRLDRGETVV
FT                   EEMENAEQSKLAVDWSGYTNTHWKDDEVATAVPREKLEALGLKLTQVPEGFRVHRTVER
FT                   TVIKAREAMARGEQPLDWGMGEMLAYASLLDEGFGLRLDGQDSGRGTFVHRHAVLHNQD
FT                   AVDPLSEEYMALAHLSPEQGRVEVIDSTLSEEAVLAFEYGYSTSEPKALVAWEAQFGDF
FT                   ANGAQAVVDQFLSAGESKWQRLSGLTMLLPHGYEGAGPEHSSARLERYLQLCAQKNMQV
FT                   VVPSSAAQIFHLLRRQVLRPYRKPLIVMTPKSLLRNKHAMSPLSDLYDGVFHEVIGDAE
FT                   VQNARRVVLSSGKLHWELTEAREKDKEGYAGTALVRLEQLYPFPAEQVKAELAKHPGAQ
FT                   VVWAQEEPENQGAWLMIWEDLEHCLQPGQTLTHASRPRSASTAVGYTSVHVREQAKVIA
FT                   DALGEPITRQDVDAQVPLTEEASAQG"
FT   gene            290239..291282
FT                   /locus_tag="DR_0288"
FT   CDS_pept        290239..291282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09880"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM2"
FT                   /protein_id="AAF09880.1"
FT                   /translation="MRRMFAPLLLAAALLSAAAQAQAVYGPPAPPAPVSPAPGLPAPVT
FT                   PAPAAAVAVAPGLALTAPADTLREYRLSETTRVRYDNVQLEVSGGTPETAAAFQNQFRA
FT                   ALRAREGERTLNAKQFLKVLPAEGTPGRYLWNTISSEGGKAVSSRSLRTLGTADGGTLT
FT                   FQPEAVAAGTDPSVAALLAPVQAELARTHAELLAGLDPASFGLLRGGPAAGSPKPGQGF
FT                   VRLKTLQPPSPLMSLPGQQVVGAPLQVEQQLRFENEEGGQLVFFRQARVVQPGQLLSGS
FT                   VEGLMTLSRYVYDGELRLTPDGLPVSAERGEAYAVQMSGRLKQGDLSATYSLNVTVTSL
FT                   LTLTPVK"
FT   gene            291364..292041
FT                   /locus_tag="DR_0289"
FT   CDS_pept        291364..292041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0289"
FT                   /product="endonuclease III"
FT                   /note="similar to SP:P46303 PID:726273 percent identity:
FT                   69.31; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09870"
FT                   /db_xref="GOA:Q9RXM1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM1"
FT                   /protein_id="AAF09870.1"
FT                   /translation="MTRNSASPRLPAGARARAPQVLSALGRLYPDARTELVFNTPFELL
FT                   VATVLSAQATDVSVNAATPALFAAYPDAHALSQATADDIEPYIRSIGLYRGKAKNLAAL
FT                   ARLLVERHGGEVPNDFDAVVALPGAGRKTANVVLSNAYDYPAIAVDTHVGRLARRLGLS
FT                   VQTNPDKVEADLQKLFPRDRWVFLHHALILHGRRVCHARKPQCPSCELASFCPKVGVEH
FT                   VEG"
FT   gene            292117..293337
FT                   /locus_tag="DR_0290"
FT   CDS_pept        292117..293337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:Pyro_h percent identity: 47.06;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09871"
FT                   /db_xref="GOA:Q9RXM0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM0"
FT                   /protein_id="AAF09871.1"
FT                   /translation="MSWRFTRQVWLYLLSAFSFGLSQAFMMLFLNFYLRALGLDPAWQG
FT                   FLNALPALTLAALSLPAVALARRISNAHTLKVGAALSMLGTLLMALAHGPVLVIVGGLI
FT                   QGAGSALSVVAGAPFMANNSDEKSRVALFSVQSALMTGAGFLGNLLGGRVPELYAAATH
FT                   TLPSSLGALRVALLVAAGLQLLGLLPVLFLRPSGKTRPAGRSLAVRDKATMARLVFPNV
FT                   LVGLGAGATIPFLNVYIEGRFHVDYASLGSLFAWTSLATALTSLVQPLLVRRLGQLPTV
FT                   LAVQVSSLPFLALLGFAPQLWMVTVAMFTRGALMNAAGPVYSAYAMTVLPEEDRPMYSA
FT                   VNTMAWDLGWALSSMLSGVVRGALDFSLAFNVLFGWTLLMYAASVLAIYLGLYRRAGAG
FT                   VRAGGVH"
FT   gene            293341..294063
FT                   /locus_tag="DR_0291"
FT   CDS_pept        293341..294063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:Q10513 PID:1261931 GB:AL123456 percent
FT                   identity: 44.26; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09872"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL9"
FT                   /protein_id="AAF09872.1"
FT                   /translation="MMSELTPLQRLHRIQAIDLNLDRLRAEEGNFPDDLRAARAEQDRL
FT                   NNDLEDTEITLEGFEKKVRQHELDLASLREQLARAREDQEKNAFDSRAQSQYGSRIQQL
FT                   EERAEELEEDLAPLRERVQELSGKASGLRDQHRALRPQLGELEDRDEGRIQGLRDQGEG
FT                   ERQERASLVEHLDARTVKEYDMIRKAKKGVGLAEVRGGRCSACNVMLPVNVQQKVAQAK
FT                   LPPVKCPSCGRFLIRLDA"
FT   gene            complement(294135..294488)
FT                   /locus_tag="DR_0292"
FT   CDS_pept        complement(294135..294488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1652105 percent identity: 71.19;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09873"
FT                   /db_xref="GOA:Q9RXL8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL8"
FT                   /protein_id="AAF09873.1"
FT                   /translation="MPNLGAPEILIILLVALLVFGPRKLPELGKSLGAGLREFRRSTQG
FT                   LKEEFDGAMRDAGPAAPAPAQVQVIAAQPQVEAGQGTPVAAAAVTPQQVTPQAVAAAVA
FT                   PVQAVPEPVKQEG"
FT   gene            complement(294646..294718)
FT                   /locus_tag="DR_t08"
FT                   /note="tRNA-Ala-2"
FT   tRNA            complement(294646..294718)
FT                   /locus_tag="DR_t08"
FT                   /product="tRNA-Ala"
FT   gene            complement(294803..295441)
FT                   /locus_tag="DR_0293"
FT   CDS_pept        complement(294803..295441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0293"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="similar to GB:U00096 PID:1789046 percent identity:
FT                   44.55; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09874"
FT                   /db_xref="GOA:Q9RXL7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL7"
FT                   /protein_id="AAF09874.1"
FT                   /translation="MPRLNLRSLQERLRPHPRLPALDPASQVLLLDVDGVLIELPDFFC
FT                   SRFPAAPVRAFFADGFQSASTGKSSVLEHLPTLMQAVGREGSPEEFYREWLEYENRPNR
FT                   DMLAATADLRSAGWGVYLATNQEQLRVQHLMTESGLDAVTDGHFASYAVGHRKPSGDYY
FT                   AAVTATLGVAPEQIVFWDDSIENVEAARAAGWSAHLFTSAADFRRRMGM"
FT   gene            complement(295479..296867)
FT                   /locus_tag="DR_0294"
FT   CDS_pept        complement(295479..296867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0294"
FT                   /product="pre-B cell enhancing factor-related protein"
FT                   /note="similar to PID:1001780 PID:1001813 percent identity:
FT                   73.45; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09875"
FT                   /db_xref="GOA:Q9RXL6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016471"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041529"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL6"
FT                   /protein_id="AAF09875.1"
FT                   /translation="MTTPLSDLNLILDTDSYKSSHFLQYPPGTTRLFSYLESRGGRYPV
FT                   TRFFGLQYILSRYLTRRVTMEMVEEARAVIEAHGEPFPYEGWRRVVEVHGGKLPLEIRA
FT                   VPEGTLVPIHNVLMSCTNTDPELPWLPGWFETMLMRVWYPTTVCTQSWHIREIIRQALE
FT                   DTSDRAAEELPFKLHDFGSRGVSSRESAGIGGLAHLVNFQGSDTLEALRVGRNYYGAEL
FT                   AGFSIPAAEHSTITSWGKEHEVDAYRNMVRQFGKPGKVYAVVSDSYDLKHAINVHWGET
FT                   LRKEVEESGGTLVVRPDSGDPPAMVRLAVNALAAKYGTTTNSKGFKVLQHVRVIQGDGI
FT                   DESTIRQILQNLYVDGFSAENVTFGMGGALLQKVDRDTQRFAYKASAGLIDGEYRGIYK
FT                   DPVTDPGKRSKDGVLDLVEENGRMVTRQYRTFDTDFPGSLMRTVYRDGELLVQDTLEEI
FT                   RGRG"
FT   gene            complement(296920..297768)
FT                   /locus_tag="DR_0295"
FT   CDS_pept        complement(296920..297768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0295"
FT                   /product="phosphoprotein phosphatase"
FT                   /note="similar to GB:U00096 SP:P55798 PID:1736483
FT                   PID:1788143 PID:2039141 percent identity: 52.70; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09876"
FT                   /db_xref="GOA:Q9RXL5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL5"
FT                   /protein_id="AAF09876.1"
FT                   /translation="MRQVIVIPDLHGRVDLLRAAVDRFPSAHFLSLGDAIDRGPNSLAT
FT                   IELLLELHAAGRATLLMGNHERMAQEGPRWYKDYLGTHDMGDYRRAMEGYHWWMRAGGE
FT                   TVRRELGSLTLEQFPALLERYLNLPDLRRVVYVTADGEIHAEAPGADRPSVLVSHAAPP
FT                   VAHQTHPNPLSAALWLRPFEGPFPLPDGVVYSLHGHTPVRQPTRLGRHVYVDLGAYETG
FT                   RLALVELGNPQERPVIRVLQGRGTPETARKYMQFGEPMPSEELRLSEPRPAPPQSNSSP
FT                   W"
FT   gene            complement(297765..298061)
FT                   /locus_tag="DR_0296"
FT   CDS_pept        complement(297765..298061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09881"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL4"
FT                   /protein_id="AAF09881.1"
FT                   /translation="MTQDSADTLLVIDVLDEDAGLADVEDEQGRTFQLPAEWLPGAADG
FT                   QGYRVRAAQGHLTFTPDTDAPRLLRERSKQTLLDFSDEPGADEPEDSQLGEKA"
FT   gene            complement(298105..299577)
FT                   /locus_tag="DR_0297"
FT   CDS_pept        complement(298105..299577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0297"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /note="similar to PID:2104320 GB:AL123456 percent identity:
FT                   55.10; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09877"
FT                   /db_xref="GOA:Q9RXL3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXL3"
FT                   /protein_id="AAF09877.1"
FT                   /translation="MRLSDLAAALQLPAPETDPQTDTEVTGVTHNAAWVQPGSAFVAIR
FT                   GAKFDGHSFMEQAQAAGAVAVLGEGLADGQTSPLPYLTVPNARAALADAAAALAGHPSR
FT                   ELKVVGVTGTDGKTTTSWLTRHLLRSAGLATGLLSTVGYELPDGELRHFPAHFTTPEAP
FT                   QVQDTLREMVAAGAQATVLEASSHALSLDRVRGVDWDVAVWTHLSSEHLDFHGTLDNYF
FT                   ADKRKLVERARFAVLNVDDPWTAQLRGIAPGETTYSAENQHADWRAQDIEERHSGLHFR
FT                   VVSPAGDFQAELPMIGRFNVANALAGMAAAHHLGATALQLQAGLASFRGVPGRMELVPG
FT                   GATSPRVIVDFAHTPPSLEKALGTLRATTAGHLWVVIGSAGGPRDPYKRAPLGEVATRL
FT                   ADHAILTEEDCRDTPLQDILNEMERGAREEGRSNFVSIGDRREAIRYAVTHAQPGDTVL
FT                   LAGKGPEDTLERATETLPWNEVAEARAVLAER"
FT   gene            complement(299653..300276)
FT                   /locus_tag="DR_0298"
FT   CDS_pept        complement(299653..300276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0298"
FT                   /product="deoxyguanosine kinase/deoxyadenosine kinase
FT                   subunit"
FT                   /note="similar to GB:U01881 PID:403984 percent identity:
FT                   60.41; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09882"
FT                   /db_xref="GOA:Q9RXL2"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL2"
FT                   /protein_id="AAF09882.1"
FT                   /translation="MYVAVSGNIGSGKSTLTRMLAERYGLRPVYEPYAENPYLEDFYHD
FT                   MRQYSFHSQVYFLSRRLEQHLGMVTGARYVIQDRTVFEDANIFARNLYESGQMGERDWQ
FT                   TYRGLYEGVLPALRVPDLLIHIDAGLPTLRRRIALRGRDYEQAIPDEYLAGLNRLYAGW
FT                   IAAFDLCPVVRVDGDALDFVHDPQAFEWVCGRVQAHGYGLPLLR"
FT   gene            complement(300276..300893)
FT                   /locus_tag="DR_0299"
FT   CDS_pept        complement(300276..300893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0299"
FT                   /product="deoxyguanosine kinase/deoxyadenosine kinase
FT                   subunit"
FT                   /note="similar to GB:U01881 PID:403984 percent identity:
FT                   62.11; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09883"
FT                   /db_xref="GOA:Q9RXL1"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL1"
FT                   /protein_id="AAF09883.1"
FT                   /translation="MYVVVEGPIGVGKTSLAQRLAQRSGAELNLEVVEENPFLAKFYEQ
FT                   PQAYAFQVQAFFLLSRFKQLSQLWQPGLYRPEVVSDYLFDKDFIFAAMNLRDAEFDLYQ
FT                   DLYGHLSPRLPTPDLVVYLRADPPELLRRIARRGRPFEHDMKAAYLADLTGRYDDYFRT
FT                   YAHPHLILEAGNYDFVANEADQQAIFDQIDAALAQAPAGEDR"
FT   gene            complement(300976..302075)
FT                   /locus_tag="DR_0300"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   GB:AE000520 percent identity: 53.56; identified by sequence
FT                   similarity; putative;serine protease Do, putative,
FT                   authentic frameshift"
FT   gene            complement(302072..302368)
FT                   /locus_tag="DR_0301"
FT   CDS_pept        complement(302072..302368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0301"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09888"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL0"
FT                   /protein_id="AAF09888.1"
FT                   /translation="MRDGLSPSRPPVLPGTAPSRRSPPPRRTPLMPTYLYKDLNTGEIY
FT                   ELVQHMRDDPYTEHPETGAPVKRVLSRPAIAFKGSGFYVNDSRKSGGEGGGGE"
FT   gene            302750..304678
FT                   /locus_tag="DR_0302"
FT   CDS_pept        302750..304678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0302"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /note="similar to PID:1184044 SP:Q56213 percent identity:
FT                   80.33; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09884"
FT                   /db_xref="GOA:Q9RXK9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXK9"
FT                   /protein_id="AAF09884.1"
FT                   /translation="MAVRGAVPRWTFPFRPGAEAESSGRGKAPTHARGAFMCGIVGYIG
FT                   PRQAQDVLLSGLSKLEYRGYDSAGVAVGDGACIAVRKKAGKLANLAGDLQAAPLSGSFG
FT                   IGHTRWATHGLPNDRNSHPHTTEDGRIVLVHNGIIENYLPLKEELLARGHTFKSDTDSE
FT                   VVAHLIEEAYQGNLEEAVQAALAQVRGAYALVVTHVDHREIVAARTVSPLVMGVGEGEM
FT                   FLASDVPALLAYTRQMVFLMDGDMVILSDDGYRVTDLQGHPVQRDVETIEWDAEAAEKG
FT                   GFDTYMLKEIYEQPQALTNTLLGRLRDEQGAVDLDISLDPTSFKRISIVACGTAYYAGL
FT                   VGEYLIEQLARIPVEVDVASEYRYRNPLVGENTLAIAVSQSGETIDTLEAMREAKKGGA
FT                   QTLGVINAKGSSMTRELDSTLYIHAGPEIGVASTKAYTSMVSAFLMLALWLGRARGTLS
FT                   DAEGAELIHAARELPRLVEDALKPERVQRIKEVAEKYAHARDYLFLGRGVNSPTAFEGA
FT                   LKLKEISYIHAEAYAAGEMKHGPIALIDENLPVAVIATESRLLEKTISNVQEVRARAGK
FT                   VILFLSDGDEENALHGDDVVYLPRAHELVSPVVNAVAMQLLAYFTATALGKDVDKPRNL
FT                   AKSVTVE"
FT   gene            304954..306602
FT                   /locus_tag="DR_0303"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   GB:L24077 SP:P38569 PID:438428 percent identity: 76.38;
FT                   identified by sequence similarity;
FT                   putative;phosphoglucomutase, authentic frameshift"
FT   gene            complement(305418..306878)
FT                   /locus_tag="DR_0304"
FT   CDS_pept        complement(305418..306878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0304"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09889"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXK8"
FT                   /protein_id="AAF09889.1"
FT                   /translation="MTNGKRRAWPRCHFHEVITSGVKRKCSESARVADAEKRPWCNPFP
FT                   EHAFQPCHDKREHRRVTSAAANNVGEQEQERGGEACTSAALSSLSRLLLTAERRRHHLA
FT                   GFFEDLLQVLLAPEALAVDFVHVLGAAGPGGEPSVLGGDLEAADGRVVAGCAGQLGGDG
FT                   VTRQRGRRDLFGREVRQDLFLLGVGGRVHPAVRRFAVAGGQVAQALGGRLARPGRHLGG
FT                   EQTGNQTVLVGAPGAAVEPQETRARRLLTAEAEFTREQTLHEVFEAHRHLDEPPPQARC
FT                   HPVNEGRTHQRFADPSTGLPAGAILEQVFDHDGEVVVGVHQAVFGHDAVAVGVGVVADG
FT                   DVEIVLEAQQARHRVGAGAVHANLAVLVHRHEGEARVDLAVDDGQAEAIARLNRLPHRQ
FT                   AGPTERIDADAHARLPNHIQVDDLRQLLDVGRDEVEGQGRSQRVGEGNLFYIFQAAAHR
FT                   SLARACTCPVTSVSAGPPEGGLYLKPPS"
FT   gene            306969..307364
FT                   /locus_tag="DR_0305"
FT   CDS_pept        306969..307364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0305"
FT                   /product="ribosomal protein S12"
FT                   /note="similar to SP:P17293 PID:581812 percent identity:
FT                   89.47; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09885"
FT                   /db_xref="GOA:Q9RXK7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXK7"
FT                   /protein_id="AAF09885.1"
FT                   /translation="MPTTQQLLRKGRKVLQKKSKVPALKGSPFRRGVCTVVKTTTPKKP
FT                   NSALRKIARVRLSSGFEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDT
FT                   QGVKDRNKSRSKYGTKKPKAGAAAAKK"
FT   gene            307475..307945
FT                   /locus_tag="DR_0306"
FT   CDS_pept        307475..307945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0306"
FT                   /product="ribosomal protein S7"
FT                   /note="similar to SP:P17291 PID:48275 percent identity:
FT                   90.38; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09886"
FT                   /db_xref="GOA:Q9RXK6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXK6"
FT                   /protein_id="AAF09886.1"
FT                   /translation="MARRRRAEVRPVQPDLVYQDVLVSAMINRIMRDGKKNLASRIFYG
FT                   ACRLVQERTGQEPLKVFKQAYDNVKPRVEVRSRRVGGSTYQVPVEVGPRRQQSLTLRWM
FT                   ISAVDGRPERTAIERLAGEIMDAAQGRGGAIKKKDDVERMAEANRAYAHYRW"
FT   gene            308203..310299
FT                   /locus_tag="DR_0307"
FT   CDS_pept        308203..310299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0307"
FT                   /product="elongation factor G"
FT                   /note="similar to SP:P13551 PID:48240 percent identity:
FT                   86.21; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09887"
FT                   /db_xref="GOA:Q9RXK5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXK5"
FT                   /protein_id="AAF09887.1"
FT                   /translation="MTITKSQQYLTHFRNIGIAAHIDAGKTTTTERILFFTGRIRNLGE
FT                   THEGASQMDWMEQERERGITITAAATTAHWTHTETGEDYTVNIIDTPGHVDFTIEVERS
FT                   MRVLDGAVAVFDSSQGVEPQSETVWRQADRYGVPRVAFANKMDKTGASFDLVVNDIRER
FT                   LGAIPAPIQYPMGAENDFKGVIDIVRMQAHTFTNDLGTEIQVGDVPAEYMDKVNEMRQQ
FT                   LIEAAAEVDEDLMMKFLEGEEPTQQELIAAIRKGTIDKQIFPVLCGSALKNKGVQLLLD
FT                   AVVDYLPSPLEVPSIKGTHEDGETVTEFPADPEGKLAALAFKIMADPYVGRLTFVRIYS
FT                   GTLTSGSYVYNASKDKRERVGRLLKMHANSREEVTELKAGELGAVIGLKDAGTGNTLIG
FT                   DGDDRVLLESIDIPEPVIKLAIEPKTKADQEKMGVGLQKLAEEDPTFKVETDQESGQTT
FT                   IAGMGELHLEILVDRLKREYKVEANVGAPQVAYRETITKQVEVDSKFARQSGGRGQYGH
FT                   VKLRVEPLEPGAGFIFENAVVGGTVPKEYIGPAQKGVEEAMQSGPMLGFPVVDIKVVIY
FT                   DGSYHEVDSSEMAFKIAGSMGLKEAVQKGSPAILEPVMRVEVTTPEEYMGDVIGDLNSR
FT                   RGQIQGMEARGNAQIVKAFVPLSEMFGYATDMRSKTQGRASYSMFFDHYTQVPTNLAQQ
FT                   LMKK"
FT   gene            310391..310834
FT                   /locus_tag="DR_0308"
FT   CDS_pept        310391..310834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0308"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09907"
FT                   /db_xref="GOA:Q9RXK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXK4"
FT                   /protein_id="AAF09907.1"
FT                   /translation="MSLPSSPNRQPNKQVVTGPPPQRLSFVTVPLMIGLVYNAISLLTI
FT                   PFSGTTINDLLADYGKASGQPIPPLSPEMIQTTLWLAFFLTALLILWLYFTRRAVLEGK
FT                   SAGRVSSIVIAVLSLLFFPFGTVLGVIMLIGIFDEQVTAYLSR"
FT   gene            311142..312359
FT                   /locus_tag="DR_0309"
FT   CDS_pept        311142..312359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0309"
FT                   /product="elongation factor TU"
FT                   /note="similar to SP:P33168 percent identity: 97.28;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09890"
FT                   /db_xref="GOA:Q9R342"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R342"
FT                   /protein_id="AAF09890.1"
FT                   /translation="MAKGTFERTKPHVNIGTIGHVDHGKTTLTAAITFTAASADPTIET
FT                   LAYDQIDKAPEEKARGITINTAHVEYQTETRHYSHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSSADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDEELLELVEMEVRELLSKYE
FT                   FPGDDLPVVKGSALRALEALQSNPKMARGTDKWVDYIWELLDAVDSYIPTPERDTDKTF
FT                   LMPVEDVFTITGRGTVATGRVERGTVKVQDEVEIVGLTDTRKTTVTGIEMHRKLLDSGM
FT                   AGDNVGVLLRGVARDDVERGQVLAKPGSIKPHTKFEASVYVLSKDEGGRHSAFFGGYRP
FT                   QFYFRTTDVTGVVELQEGVEMVMPGDNVTFTVELIKPIAMEEGLRFAIREGGRTVGAGV
FT                   VSKVLE"
FT   gene            312365..312688
FT                   /locus_tag="DR_0310"
FT   CDS_pept        312365..312688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0310"
FT                   /product="ribosomal protein S10"
FT                   /note="similar to SP:P80375 percent identity: 91.18;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09891"
FT                   /db_xref="GOA:Q9RXK3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXK3"
FT                   /protein_id="AAF09891.1"
FT                   /translation="MVAPKIRIKLRGFDHKALDQSASKIVDTVRRTGADVSGPVPLPTR
FT                   IRRFTVLRSPFKYKDSREHFEIRTHNRLVDIMNPTKKTIDSLMTLDLPTGVDIEIKTVG
FT                   GRA"
FT   gene            312685..313320
FT                   /locus_tag="DR_0311"
FT   CDS_pept        312685..313320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0311"
FT                   /product="ribosomal protein L3"
FT                   /note="similar to PID:1143612 SP:P52860 percent identity:
FT                   83.90; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09892"
FT                   /db_xref="GOA:Q9RXK2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2OGM"
FT                   /db_xref="PDB:2OGN"
FT                   /db_xref="PDB:2OGO"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXK2"
FT                   /protein_id="AAF09892.1"
FT                   /translation="MKGILGTKIGMTQIWKNDRAIPVTVVLAGPCPIVQRKTAQTDGYE
FT                   AVQIGYAPKAERKVNKPMQGHFAKAGVAPTRILREFRGFAPDGDSVNVDIFAEGEKIDA
FT                   TGTSKGKGTQGVMKRWNFAGGPASHGSKKWHRRPGSIGQRKTPGRVYKGKRMAGHMGME
FT                   RVTVQNLEVVEIRAGENLILVKGAIPGANGGLVVLRSAAKASAAKGGK"
FT   gene            313320..313937
FT                   /locus_tag="DR_0312"
FT   CDS_pept        313320..313937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0312"
FT                   /product="ribosomal protein L4"
FT                   /note="similar to SP:P49665 PID:1033073 percent identity:
FT                   71.29; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09893"
FT                   /db_xref="GOA:Q9RXK1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="PDB:1J5A"
FT                   /db_xref="PDB:1JZX"
FT                   /db_xref="PDB:1JZY"
FT                   /db_xref="PDB:1JZZ"
FT                   /db_xref="PDB:1K01"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXK1"
FT                   /protein_id="AAF09893.1"
FT                   /translation="MAQINVIGQNGGRTIELPLPEVNSGVLHEVVTWQLASRRRGTAST
FT                   RTRAQVSKTGRKMYGQKGTGNARHGDRSVPTFVGGGVAFGPKPRSYDYTLPRQVRQLGL
FT                   AMAIASRQEGGKLVAVDGFDIADAKTKNFISWAKQNGLDGTEKVLLVTDDENTRRAARN
FT                   VSWVSVLPVAGVNVYDILRHDRLVIDAAALEIVEEEAGEEQQ"
FT   gene            313934..314221
FT                   /locus_tag="DR_0313"
FT   CDS_pept        313934..314221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0313"
FT                   /product="ribosomal protein L23"
FT                   /note="similar to SP:O24691 percent identity: 70.24;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09894"
FT                   /db_xref="GOA:Q9RXK0"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="PDB:1GS2"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2AAR"
FT                   /db_xref="PDB:2D3O"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXK0"
FT                   /protein_id="AAF09894.1"
FT                   /translation="MSHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQA
FT                   FGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQA"
FT   gene            314235..315062
FT                   /locus_tag="DR_0314"
FT   CDS_pept        314235..315062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0314"
FT                   /product="ribosomal protein L2"
FT                   /note="similar to SP:P38510 PID:437926 GB:AE000512 percent
FT                   identity: 78.18; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09895"
FT                   /db_xref="GOA:Q9RXJ9"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ9"
FT                   /protein_id="AAF09895.1"
FT                   /translation="MAVKKYRPYTPSRRQMTTADFSGLTKKRPEKALTEALPKTGGRNN
FT                   RGRITSRFIGGGHKRLYRIIDFKRRDKSGVNAKVAAIEYDPNRSARIALLHYADGEKRY
FT                   ILAPEGLTVGATVNAGPEAEPKLGNALPLRFVPVGAVVHALELVPGKGAQLARSAGTSV
FT                   QVQGKESDYVIVRLPSGELRRVHSECYATIGAVGNAEHKNIVLGKAGRSRWLGRKPHQR
FT                   GSAMNPVDHPHGGGEGRTGAGRVPVTPWGKPTKGLKTRRKRKTSDRFIVTRRK"
FT   gene            315074..315361
FT                   /locus_tag="DR_0315"
FT   CDS_pept        315074..315361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0315"
FT                   /product="ribosomal protein S19"
FT                   /note="similar to PID:2344836 percent identity: 87.91;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09896"
FT                   /db_xref="GOA:Q9RXJ8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ8"
FT                   /protein_id="AAF09896.1"
FT                   /translation="MPRSLKKGPFVEDHLLKKVDAQNDKKDKRVIKTWSRRSTIVPEMI
FT                   GHTIAVYNGKQHVPVFVNEQMIGHKLGEFSPTRTYRGHGADKNAKGSKKK"
FT   gene            315358..315762
FT                   /locus_tag="DR_0316"
FT   CDS_pept        315358..315762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0316"
FT                   /product="ribosomal protein L22"
FT                   /note="similar to SP:P48286 PID:1001933 percent identity:
FT                   84.40; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09897"
FT                   /db_xref="GOA:Q9RXJ7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="PDB:1J5A"
FT                   /db_xref="PDB:1JZX"
FT                   /db_xref="PDB:1JZY"
FT                   /db_xref="PDB:1JZZ"
FT                   /db_xref="PDB:1K01"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1OND"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ7"
FT                   /protein_id="AAF09897.1"
FT                   /translation="MTAPEQTFRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVI
FT                   RGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLK
FT                   RLIPRARGSANIIKKRTSHITIIVAEKGNK"
FT   gene            315762..316511
FT                   /locus_tag="DR_0317"
FT   CDS_pept        315762..316511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0317"
FT                   /product="ribosomal protein S3"
FT                   /note="similar to PID:1652421 percent identity: 68.22;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09898"
FT                   /db_xref="GOA:Q9RXJ6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ6"
FT                   /protein_id="AAF09898.1"
FT                   /translation="MGNKINPNGFRLGVTKGWNSRWYAGKKQYASLLKEDEQIRQLINK
FT                   KLAAAGIARIEIERAGQQVNVIISAAKPGVVIGKGGESIKELRGDIERLVSAGTVAVNV
FT                   AEIPNPNISAPLVALRIAEQIERRFAFRRAMKQAAQRVMESGARGVKVILSGRLGGAEQ
FT                   ARTEKVLEGRVPLHTLRADIDYGTALARTTYGILGIKVLVFNGEVIGGKTETFARPQRR
FT                   DRDERRPEGGDRPARRRPTARRRTGGE"
FT   gene            316508..316936
FT                   /locus_tag="DR_0318"
FT   CDS_pept        316508..316936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0318"
FT                   /product="ribosomal protein L16"
FT                   /note="similar to PID:1652420 percent identity: 80.74;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09899"
FT                   /db_xref="GOA:Q9RXJ5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="PDB:1GS2"
FT                   /db_xref="PDB:1NJM"
FT                   /db_xref="PDB:1NJP"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:1Y69"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ5"
FT                   /protein_id="AAF09899.1"
FT                   /translation="MMLLPKRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKS
FT                   NQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVM
FT                   FEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEAQ"
FT   gene            316923..317126
FT                   /locus_tag="DR_0319"
FT   CDS_pept        316923..317126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0319"
FT                   /product="ribosomal protein L29"
FT                   /note="similar to SP:P04457 percent identity: 66.13;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09900"
FT                   /db_xref="GOA:Q9RXJ4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2AAR"
FT                   /db_xref="PDB:2D3O"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ4"
FT                   /protein_id="AAF09900.1"
FT                   /translation="MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQ
FT                   LRREVAQLNTVKAELARKGEQQ"
FT   gene            317123..317413
FT                   /locus_tag="DR_0320"
FT   CDS_pept        317123..317413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0320"
FT                   /product="ribosomal protein S17"
FT                   /note="similar to SP:P24321 PID:48103 percent identity:
FT                   74.68; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09901"
FT                   /db_xref="GOA:Q9RXJ3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ3"
FT                   /protein_id="AAF09901.1"
FT                   /translation="MKKTFTGVVVSDKADKTVSVKVERRFAHPLYGKVVTRSHKYAAHD
FT                   ENNEYKIGDRVEIIAVRPISKTKTWKVTKLIERPRGIETTLAETEVAGGEA"
FT   gene            317410..317814
FT                   /locus_tag="DR_0321"
FT   CDS_pept        317410..317814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0321"
FT                   /product="ribosomal protein L14"
FT                   /note="similar to SP:P24317 PID:48104 PID:755806 percent
FT                   identity: 86.18; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09902"
FT                   /db_xref="GOA:Q9RXJ2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="PDB:1GS2"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ2"
FT                   /protein_id="AAF09902.1"
FT                   /translation="MIMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYA
FT                   HVGDIIVASVKDAAPRGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIINNQGE
FT                   PRGTRVFGPVARELRDRRFMKIVSLAPEVL"
FT   gene            317814..318161
FT                   /locus_tag="DR_0322"
FT   CDS_pept        317814..318161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0322"
FT                   /product="ribosomal protein L24"
FT                   /note="similar to SP:P04455 percent identity: 73.53;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09903"
FT                   /db_xref="GOA:Q9RXJ1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:1GS2"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2D3O"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ1"
FT                   /protein_id="AAF09903.1"
FT                   /translation="MPRPSAGSHHNDKLHFKKGDTVIVLSGKHKGQTGKVLLALPRDQK
FT                   VVVEGVNVITKNVKPSMTNPQGGQEQRELALHASKVALVDPETGKATRVRKQIVDGKKV
FT                   RVAVASGKTID"
FT   gene            318280..318822
FT                   /locus_tag="DR_0323"
FT   CDS_pept        318280..318822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0323"
FT                   /product="ribosomal protein L5"
FT                   /note="similar to SP:P24315 SP:P41201 GB:S77828 PID:48106
FT                   PID:243185 percent identity: 90.91; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09904"
FT                   /db_xref="GOA:Q9RXJ0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ0"
FT                   /protein_id="AAF09904.1"
FT                   /translation="MQQLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKE
FT                   DSKAIDKAAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFLEKLI
FT                   NIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGMDITIVTTAKTD
FT                   EEARALLQSMGLPFRKQ"
FT   gene            complement(318924..319568)
FT                   /locus_tag="DR_0324"
FT   CDS_pept        complement(318924..319568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0324"
FT                   /product="serine cycle enzyme, putative"
FT                   /note="similar to PID:694120 SP:Q49135 percent identity:
FT                   50.30; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09905"
FT                   /db_xref="GOA:Q9RXI9"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI9"
FT                   /protein_id="AAF09905.1"
FT                   /translation="MTLWDQTAADLLQATASHKPTPGGGSIAALSGAFGVGLLSMALTI
FT                   SRNKARKASQDLSPELSATLDRLQTIQARLQALADEDVAVFRRFVDATKLPKDSDEEQQ
FT                   ARADALAAAGEAARATPLEIATQCVQALTEAEGTVTEVHAEVVSDIGAGAALLRGAIDA
FT                   ALLTVDINLLRLSEEEKAPLQAHRDELAQQGQERAARLLKQAQKQIAENQE"
FT   gene            complement(319690..320682)
FT                   /locus_tag="DR_0325"
FT   CDS_pept        complement(319690..320682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0325"
FT                   /product="malate dehydrogenase"
FT                   /note="similar to SP:P10584 PID:295401 PID:48179 PID:581795
FT                   percent identity: 83.49; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09906"
FT                   /db_xref="GOA:Q9RXI8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXI8"
FT                   /protein_id="AAF09906.1"
FT                   /translation="MTMKQPVRVAVTGAAGQIGYSLLFRIAAGDMLGQDQPVILQLLEI
FT                   TPALKALNGVVMELRDGAFPLLADVITSDDPMVAFKDADYALLVGAMPRKAGMERGDLL
FT                   GANGGIFKPQGEALGAVASRNVKVLVVGNPANTNALIAQQNAPDLDPKCFTAMVRLDHN
FT                   RALSQLAEKTGAAVSDIKNVTIWGNHSSTQYPDLSQATVNGKPALEQVDRTWYENDYIP
FT                   TVAKRGAAIIEARGASSAASAASAAIDHMHDWALGTKDGEWVSMGIPSDGSYGIPEGLI
FT                   YGFPVRVKDGKYEIVQGLDVSDFSRGKMDATAQELEEERDEVRKLGLVK"
FT   gene            complement(320869..321465)
FT                   /locus_tag="DR_0326"
FT   CDS_pept        complement(320869..321465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09913"
FT                   /db_xref="GOA:Q9RXI7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXI7"
FT                   /protein_id="AAF09913.1"
FT                   /translation="MDTLKKAGTMLAHLDLFHSMLDLRRLLQLAAYMKERGDRAMLISA
FT                   GEITLIGSESMTAPEVVTSKGETIDAATAYRVLGQLEGYEAPEYAVNREALAALNARAV
FT                   AELEGSEALRAFGDTLARISAAPTDPAGPERPGTDRAERTAAERTASERATHDRASTER
FT                   PARPRRSAEPEAVRTEDAPQPNAEASEAGENTPAA"
FT   gene            complement(321592..322686)
FT                   /locus_tag="DR_0327"
FT   CDS_pept        complement(321592..322686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0327"
FT                   /product="periplasmic serine protease, HtrA/DegQ/DegS
FT                   family"
FT                   /note="similar to GP:3329293 percent identity: 54.61;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09908"
FT                   /db_xref="GOA:Q9RXI6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI6"
FT                   /protein_id="AAF09908.1"
FT                   /translation="MGGTGPDCPPGGPEPAHCAAHGHSPQAAAGQAAHGAGKCRPASAL
FT                   YQAAPRHVRIEQCPVNDCTEPDGIGTGFLISADGLALTAYHVVFQAPALSARTSNGNRY
FT                   PVKVVGYDDQNDLAVIRVSVPKGTPFLPLASSTPKLGDAALAIGNGGGEYLRPKVGRFT
FT                   ALRSEAGRADFPPGTLELSAPLVPGDSGGPIINRAGEVAGVVSYVRFESTGEREEDVEA
FT                   HAYAVPVTVDDTRVAELRRGVKRDAAVIGISLEGEWSLLANLPEQAFVESKLGKTAGAF
FT                   FTRVVPGSPAAKAGLQPLRLSEKGDLISGDIVTAVNGRRVYNFSDFQYAVRRYAPGDTI
FT                   TLSVLRGGKNISVKLTLAARSSVQ"
FT   gene            322750..323274
FT                   /locus_tag="DR_0328"
FT   CDS_pept        322750..323274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1001103 PID:1001178 percent identity:
FT                   46.97; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09909"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI5"
FT                   /protein_id="AAF09909.1"
FT                   /translation="MGDMRAIVLRSGREFCVSALCRPERRAGGLECGSMVPLLPVFVYG
FT                   TLLPGERNAHIAAQGGEFTVRPATLRGFRLFDLRPESYPGIVPGAADDLIHGALLTYGP
FT                   ADWEQALALLDELEGVDEMPPVYTREQVRLTLEGGETLTAWVYVYALADRLRQTGAVLV
FT                   PEGDWRGVADR"
FT   gene            complement(323396..324367)
FT                   /locus_tag="DR_0329"
FT   CDS_pept        complement(323396..324367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0329"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GB:AL009126 percent identity: 49.12;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09910"
FT                   /db_xref="GOA:Q9RXI4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI4"
FT                   /protein_id="AAF09910.1"
FT                   /translation="MSDLMKLRAVWGNRPLLGVAAGVLIQNERGEVLLQKRGDDGLWGE
FT                   PGGGLDPGEAFLAAAQRELKEETGLECGNLTWLGVHDGLTSGPDLYTRYPNGHELYLVG
FT                   TLFHGTLPADALAHAQPDDSGETLELRWCALDDLPPLSSNINRTSLNVLRRRVGLPELP
FT                   MQPQPPRQPDPTYWADLGRLLGGRLWFMPGSSVLVTDEAGRLLLLRHKATDQWTLPGGK
FT                   LEPGESFEECAARELLEETGLRARRLERLHLLAGPELRFQQQGQTWDSLGLLLRASDVS
FT                   GELRPPAGELSEARYFAPDELPGVDVLGTYTRQALAFWLGQS"
FT   gene            324386..325942
FT                   /locus_tag="DR_0330"
FT   CDS_pept        324386..325942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0330"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09914"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI3"
FT                   /protein_id="AAF09914.1"
FT                   /translation="MAPYRRGVQWFMTSWRWRLTFACGAGVWLGAGALAQTNKPEPLKT
FT                   TVQTCGSYQVKITGNGFGEPQDTLRLMKGGRTYATYRDEAVSLDSCTDLTGDGVPEAIL
FT                   TQYSGGAHCCTMGQIYSLTTPPRLLLEQGLSNSTGWEIVQLDGKGPKELLTSDWRFAYA
FT                   YGLSYAESPALPQVLAYRGGRYVDVTREYPALLLKGIRAPQPEESVSGTFLSNYALYLL
FT                   AGQPQKAEAYLQTLPRPEREWLQNYAPDIRQNLSTVGLDDWPQRAGGQGGASWRDLRGG
FT                   AGGSFTRPGTLEYLGTTVRQGRGTVRLYQQRGGQVVASAPLLSFREPADHPELDPLATF
FT                   TVRRTGGRDDVVLRDELAGRAQLRAYRVSPQRLTELTGDPLGVAARLLSDVENLGRQRE
FT                   RLTDGSSRTDTQKQALQGRIAAALPRAQAWQKTYDPASKTPLNLAKLGVFNVQSVEVYR
FT                   ENASSALVAGVVEMGDVVPGQGYVQRTRQTFAVFLDNKGGTWQVTRWQLSPRQGAGPLD
FT                   R"
FT   gene            complement(325994..326356)
FT                   /locus_tag="DR_0331"
FT   CDS_pept        complement(325994..326356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0331"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI2"
FT                   /protein_id="AAF09915.1"
FT                   /translation="MGLAELRRREDFAKAWGEGDLFSKHPTKRLYAAHICPPRPISKLG
FT                   SSSISGGSTMGEGKPNTNQTATNQTNTAAPADITAPEGSRADGVSDGANTNFGPTLGAV
FT                   PHEGGETKQTDEDSKK"
FT   gene            326390..328327
FT                   /locus_tag="DR_0332"
FT   CDS_pept        326390..328327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 68.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09911"
FT                   /db_xref="GOA:Q9RXI1"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI1"
FT                   /protein_id="AAF09911.1"
FT                   /translation="MSHALGPAVGTFAPRPAHYPLLMSRPARQFPDIQSFMRVLEERGE
FT                   LLRVREPVSRDLEITEISDRLVKKGGPAVLFENVVGSDYPVVMGLMGTRERMALAVGVN
FT                   DLDELAQKIRALIDLGGGGSRFGLLSNLPKLRDAMNLPPRRVKTAPVQEVVWRGDEVDL
FT                   SKIPVLKCWPEDGGPFVTFPLVITKDPETGERNMGMYRMQVMSKNTTGMHWQRHKTGTR
FT                   HLEKARQRGQRLEVAVAIGGDPALIYAATAPIPPVPGLNEFAVAGYLRGQRYPVVKGLT
FT                   VDLEVPANAEFVLEGYVDPQEDWVVEGPFGDHTGFYTLADLYPLFHVTCVTMRQNPVYP
FT                   ATIVGRPPMEDAYLIEASERLFLPAAQLIVPEIVDYHMPPAGVAHNLVVVSIKKDFPGQ
FT                   AYKVANGLLGLGQMMFAKVIVVVDADVKVNDMDAVWREVAAKAVPGRDTLTGRGPIDVL
FT                   DHSSRGWGYGGKLIIDATTKRPEETGSGVSSREGQAEDFAPDAPFVPFASADLPTFDGV
FT                   VAQRQTDDGYWFVALNKTRPGQARELAQAFAVHPAARGVRHLLIADQDTDVNDAGDVWW
FT                   TVLNNIDPERDVWHLPAEAGGGGLAWDGARKLPEEGFVREWPQKIVMDEAVRRRVDALW
FT                   HVWGLPEQWR"
FT   gene            328300..328959
FT                   /locus_tag="DR_0333"
FT   CDS_pept        328300..328959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09916"
FT                   /db_xref="InterPro:IPR024976"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI0"
FT                   /protein_id="AAF09916.1"
FT                   /translation="MGLAGAVALSLFDELDVVFGPAALADALFYRHSPALRFELEGGKT
FT                   YIAQFLQAVDRARTVLNVAFAGMEAVTAVLGVWGDDPPAQLWATAEAALHELGIKLPAP
FT                   ELSASELPTPETRVLHGEEDTQVLFAFTLSTARLPELLWGSLAADLGIFPQLRGRLWLA
FT                   APELGLLACPYDSRGMDMIGPNTARLAQLYHQFGDWLLDHDRARMAEMLSPGSKKP"
FT   gene            complement(329006..330466)
FT                   /locus_tag="DR_0334"
FT   CDS_pept        complement(329006..330466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0334"
FT                   /product="lipase, putative"
FT                   /note="similar to PID:1321706 percent identity: 57.03;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09912"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH9"
FT                   /protein_id="AAF09912.1"
FT                   /translation="MGRSISTSRCSRREVAMNPVLRSAAVLSLTAVLAACGQTTPPIAA
FT                   VSQTAPTPQITQAGQPQDSYAARRAALPAQAPEPLSGQLGASSLQQTYPGGQPLHAQVL
FT                   NKSVPLILVHGLMGWGTDEMMGMPYWGGLYNVVGDLRGQGYTVSAASVGPISSNWERAA
FT                   ELFAQIKGGCVDYGAAYSARYGFNRFDKAKCYPGIYPQWDAAHPINLLGHSMGGQTSRM
FT                   LVKLLEDGSPADADGNNLFRGGRVGWVKAVITVSTPNSGTPATDNLQAMVPVLKDLLKN
FT                   AAAGLGVSSQSMVYDFDLGQWGLRRQAGESFDAYFDRVMASHFGKNDSNAAYDLSSDGS
FT                   AELNQFIGRSTHTIYASWATSATSKGLVTGWAYPMPVMFAPLSALAWPYPWPMRQTIGN
FT                   MTGSSPLGKVQYDASWWENDGLVPVKSQGAPLGQSEVAYAGGPVQPGQWYDLGKLSGWD
FT                   HTAIVGIPGLQDVRPFYRNQAAWLASLP"
FT   gene            331099..332535
FT                   /locus_tag="DR_0335"
FT   CDS_pept        331099..332535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0335"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /note="similar to SP:P23304 GB:M63288 GB:U03750 PID:432406
FT                   PID:606102 percent identity: 54.68; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09917"
FT                   /db_xref="GOA:Q9RXH8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH8"
FT                   /protein_id="AAF09917.1"
FT                   /translation="MSPAATSPRRQRQDGRQPQAAQQADPAPQPTMISLASPEEWRKLL
FT                   GEREPTPVQAKAIPELLAGRDVIATARTGSGKTLAFLIPAAARGIGVTGKTRGMAPEVL
FT                   IVSPTRELAVQIRDVARELGMTAGRITGGITPAATTREASNKGVVSGTPGRLKDLIGKG
FT                   ELSLAHVRYVVLDEADELLSLGFLKDVEWIVNQARAQARGGEIQVALASATFPEEVRGV
FT                   AARVLRNPVRIDIEPPRTAEAAPLKAGEVVAAGEGRAEHVARDTTRDEVLEHAAAEIRE
FT                   ALREPGGCVVVFCRTKALTKRRAEKLGQLLPHEEVVPLEGNMDQRKRERVMDKLRDGTA
FT                   RVLVATDIAGRGIDLPEVRLVIHADVATTSEDHVHRSGRTARAGRGGRNLVFIIPEQRQ
FT                   RWAQVRRGLPAHLHPPKTAQEHLIDKDIQEKQGRGSGNGVDPVRSGSGRSGGGRDGGQR
FT                   GGSGQRSQGQGRGGPRGGRR"
FT   gene            complement(332678..334252)
FT                   /locus_tag="DR_0336"
FT   CDS_pept        complement(332678..334252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0336"
FT                   /product="fatty-acid--CoA ligase, putative"
FT                   /note="similar to PID:1903034 percent identity: 61.09;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09918"
FT                   /db_xref="GOA:Q9RXH7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH7"
FT                   /protein_id="AAF09918.1"
FT                   /translation="MPMNTPLTPLTLVRRGLKLYPDHTAVIEPGGPRFTYREWGRRIYQ
FT                   LARAIQAAGYGGQHVAVLSPNTHGGLLTYAGVPWAGSVLVPLNTRLTPEEYEFQLRHAE
FT                   VRLLLVDESLHDRVREVAAGLGIEVWVMGDARGAGTAFEAKLAAQDDSPLPLPVQDENG
FT                   TITLNFTSGTTSDPKGVMMTHRSTMLNAIETIYYFKADQDTVYLHTLPDFHANGWGGVW
FT                   SPFGVGATHVTLPTVRADAAYDAIEQHGVTHLCAAPTVLSMLTDPAHARPLSRQIRVAT
FT                   AGSPPHARIIADMNALGFHVTQVYGLTETSPLITVAELSAQQEELPTPRRAALIAKQGV
FT                   EMILAGEVEVLDPELRPVPGDGETLGEIMVRGNLVMKGYYRNEEATAKALEGGWFHTGD
FT                   VAVVHPDGRIEIRDRNKDVIISGGENISSVEVEGVLYAHPAVREAVVVAMPHEKWGEVP
FT                   CAFIALHQGQEVTPEDLTAHVREHLAGFKVPKHYEFRDDLPKTASGKFQKFILRAELWQ
FT                   GKARGVN"
FT   gene            complement(334388..336184)
FT                   /locus_tag="DR_0337"
FT   CDS_pept        complement(334388..336184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0337"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09927"
FT                   /db_xref="GOA:Q9RXH6"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH6"
FT                   /protein_id="AAF09927.1"
FT                   /translation="MRVFWRLALLGLLLGAGVWLWRASQSGDLTLPRPPSAGQPAARTG
FT                   EGPPPAAAQPPAPPPANKRPGPIPNTALRVPPPSGEIRAAAVTFTPPLPRSADGWYDLG
FT                   VRAREAGDPHKAARAFAQAAALNPSAANWRALANEQVKLGDYAAATRAYGQAAARYRAS
FT                   GDDETARALEYLAAPFRQRLEVRRVVPKVGAAPPHLARLEPPRGVLLGIYAGADGVQGA
FT                   WGQPPRMAPKLRPFAVAFRYWKFSRSDDPAVIFPGRFAQAVRANGMALHLALEPGMPLA
FT                   QLSDDVIHAFARQAKAAGLPIFVRFGSEMNDPHNEWGRDPALYRRTFARVARILHTEAP
FT                   NTALVWMPMPGDLAQIAGYYPGPAAVDWAGLSLYSVPFENGDVNKPRLTAHPLDVLDGF
FT                   YRQYAPRHPIQLSEYAASNRSGAAPERDFSAFAAQQVREVYWGAWLKYPRLKNINWLDV
FT                   DMHGGDDNGKAATRRNDYRLFASDAKWRTFEQVREMPAFFQSWKIATCPTCEVPTARPW
FT                   GTPDADRTLSGALWLVTARPVGGVKLTVDGENVPVEQTLPHRFRVPPLPAGKHTLRVLV
FT                   WDDQSRELLRQEQVFAVRVGAD"
FT   gene            complement(336254..336640)
FT                   /locus_tag="DR_0338"
FT   CDS_pept        complement(336254..336640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0338"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09928"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH5"
FT                   /protein_id="AAF09928.1"
FT                   /translation="MRSCPQASRGRPRQFPTCLHPPLSNFSGTCRVIGSVKPTRSARPV
FT                   KGTLNARGGTRPSRAAPKRGGLTLTKVLAYVPIAVELAAYLRGQQKARRGKYYKPSKRG
FT                   QAFDFVLGQAQKRFGKAPKKKGWF"
FT   gene            336631..337809
FT                   /locus_tag="DR_0339"
FT   CDS_pept        336631..337809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0339"
FT                   /product="N-acyl-L-amino acid amidohydrolase, putative"
FT                   /note="similar to PID:1653860 percent identity: 70.99;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09919"
FT                   /db_xref="GOA:Q9RXH4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH4"
FT                   /protein_id="AAF09919.1"
FT                   /translation="MTATEDRVSALRPQLEAWRRHLHMHPELSFQEFETARYIVGELNK
FT                   LPGLEVSQLTPTSVLAVLRGGQPGRTVLLRADIDALPIQEENSFEFVSQNPGVMHACGH
FT                   DGHTAILLGTAQLLAEDAANVPGEIRMIFQHAEENGPGGAEELVMNTPLMDGVDVVTGL
FT                   HLDSQLPAGQVVVKAGAFMAAPDMIELTIRGKGGHGAHPDETVDPIAIGAQVVTNLQHV
FT                   VSRNVSAQDALVVSITYFQSGSTHNVIPDTARLMGTVRTFDPDLRRKAPQLIERVIKGV
FT                   CEAHGATYDLKYELGYRPVINTEWVAEELRQIALNTVGAEHFAEAKATMGGEDFSAYLE
FT                   KAPGAYFNVGSGSDEHDSRWPHHHPRFTIDELSLETGVKMMHAAALKLAQPQ"
FT   gene            337871..339121
FT                   /locus_tag="DR_0340"
FT   CDS_pept        337871..339121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0340"
FT                   /product="folyl-polyglutamate synthetase"
FT                   /note="similar to GB:L04520 SP:Q05865 PID:142936
FT                   PID:1119198 GB:AL009126 percent identity: 53.64; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09920"
FT                   /db_xref="GOA:Q9RXH3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH3"
FT                   /protein_id="AAF09920.1"
FT                   /translation="MSQSRWRKTRYLYDKCSSVSSMPDPLPDYDWLYAQTRAGRERGPG
FT                   PARALLDRLGAPDRKFQTIRVVGTNGKGSTCAMLEAGLLAAGVRAGRFTSPHLHAYEER
FT                   IRVGGENLDPARTAQFIDWAKQNAPGEAFFDLTLALACQAFAEAGVDWAVMEAGVGGVS
FT                   DATQALGNVRAVALTNADLDHTATLGPTIRDIASDKAGVAQAGVPLLTTATGEALDVVR
FT                   EVAAELGAPLFTPQTHPDLFAVPHAPSLSGPHQRTNAALALATLRVLGFERGAEAALNA
FT                   SHPGRLERFTVAGKTVLVDGAHNPHAARALAAAVPQADVLLFGGLARKDTAATLAPLLP
FT                   IAPERVFTAPSDLAAPPAELAAEYGGEARSNPAEALRLALALTPTGGTLLVAGSLYLAG
FT                   FIREELAGSPLAASDIK"
FT   gene            complement(339245..339324)
FT                   /locus_tag="DR_t09"
FT                   /note="tRNA-Leu-3"
FT   tRNA            complement(339245..339324)
FT                   /locus_tag="DR_t09"
FT                   /product="tRNA-Leu"
FT   gene            339492..339767
FT                   /locus_tag="DR_0341"
FT   CDS_pept        339492..339767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0341"
FT                   /product="ribosomal protein S15"
FT                   /note="similar to SP:P80378 percent identity: 74.39;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09921"
FT                   /db_xref="GOA:Q9RXH2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXH2"
FT                   /protein_id="AAF09921.1"
FT                   /translation="MIDKQQVISDNAAGANDTGSTAVQVALLTARINNLAGHLQTNKKD
FT                   KAGQRGLQLMNGQRRRLLKYLERTDYDAYIALTDKLGIRRGQRIVR"
FT   gene            complement(339824..340387)
FT                   /locus_tag="DR_0342"
FT   CDS_pept        complement(339824..340387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0342"
FT                   /product="cytochrome complex iron-sulfur subunit, putative"
FT                   /note="similar to PID:927524 percent identity: 53.21;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09922"
FT                   /db_xref="GOA:Q9RXH1"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH1"
FT                   /protein_id="AAF09922.1"
FT                   /translation="MAVDESKRTLLSYWWVLPVVGTAGAFGYMANYARRVTYDKSAPGP
FT                   PNYQPGPRQAIARLGDFKGPYSFREFLYRKTPCLVMELPAPTPTSVTVGGRHFAAYSRL
FT                   CTHLGCQVNPVEDTEVLALTYSYRADHPMLGCPCHFSVFDPQQQGQSVFGKALFPLARV
FT                   QLRAEGDTLYAHGLEPDPRVGKDS"
FT   gene            complement(340392..341414)
FT                   /locus_tag="DR_0343"
FT   CDS_pept        complement(340392..341414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0343"
FT                   /product="cytochrome c family protein"
FT                   /note="similar to GB:X63125 PID:402789 percent identity:
FT                   68.09; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09923"
FT                   /db_xref="GOA:Q9RXH0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXH0"
FT                   /protein_id="AAF09923.1"
FT                   /translation="MMYVLLALGLLTFALLLRPILAPARVTPADTRRTELEEERELLLS
FT                   NLGELQSQGADAGTLTREKVRLTQVLHELDTLPPAPKPGQARPALPAAAVTLLGVALLL
FT                   GVGTVTFLPKWRNLGLSPAEQTQLANASRLPVLASQAKRSGQTADYLAWGDAAWDARQY
FT                   RQSAEAYTQVLLKERDNPRAMRRVGYFLLTDPKMAENGLSFIARAAQLDPQSPEGQLLY
FT                   GYGLGAFGQYQDALTVLTNYQKLAPDSHEADDLIVEYQAKVGGTVDGALVFAQNCASCH
FT                   GQKGAGGAGPKLIGSPALRNETALRQIVLHGAAGMPAFPQLGGKQLDALVKTLQGQDWR
FT                   "
FT   gene            complement(341411..342010)
FT                   /locus_tag="DR_0344"
FT   CDS_pept        complement(341411..342010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0344"
FT                   /product="cytochrome c-type biogenesis protein CcmH"
FT                   /note="similar to SP:P45406 PID:575373 percent identity:
FT                   57.14; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09924"
FT                   /db_xref="GOA:Q9RXG9"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG9"
FT                   /protein_id="AAF09924.1"
FT                   /translation="MKGKGMKGAQAVLTALLLASPVLAQGTTTPAQQNATQGAASQAAP
FT                   KDTDQRGRADSVRTGVAEVDRTAPLPLSVEQERQAERIGTKLHCPVCSGESIAQSQTDI
FT                   SRQMMNEVRDGIRQGQSESQILGRFVASYGERILMEPPKKGINWLLWGFPVGALVLGTG
FT                   LWQGYLRRASREPVETLSAEDERRIAALLREREEQA"
FT   gene            complement(342007..342573)
FT                   /locus_tag="DR_0345"
FT   CDS_pept        complement(342007..342573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0345"
FT                   /product="cytochrome c biogenesis protein, thiol:disulfide
FT                   interchange protein"
FT                   /note="similar to GB:M96013 SP:P36893 PID:294659 percent
FT                   identity: 54.36; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09925"
FT                   /db_xref="GOA:Q9RXG8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG8"
FT                   /protein_id="AAF09925.1"
FT                   /translation="MTSPTPPTSPSLSPQPRRASWTRWIVPAVMVGLVGLLAYGLFTPD
FT                   PEGGPALLGKPAPAFALEDLGGRTHALTAAQGKPVVINFWASWCVPCRQEAPLFSKLSQ
FT                   ETAGKAEFFGVIYNDQPADARRFMDQYGLIYPALLDPGSRTALSYGVGKLPITFIVDGQ
FT                   GKVVHIKDGPIEEPELRAALKQAGL"
FT   gene            complement(342570..344564)
FT                   /locus_tag="DR_0346"
FT   CDS_pept        complement(342570..344564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0346"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="similar to SP:P45403 PID:563332 PID:572603 percent
FT                   identity: 56.62; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09926"
FT                   /db_xref="GOA:Q9RXG7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG7"
FT                   /protein_id="AAF09926.1"
FT                   /translation="MLDFLGYNFSPLGAAGSLSLLLALGFALVALVSGVLGGVRRDERL
FT                   TGMARYALWGNFGFMTVATLLLQYAILTDDFSVRYVAQHSMTVSPLWVKWVTLWAALEG
FT                   SILLWAWILSLYAFLVSLTARRDVLRPWVLATMALSVVFFVGLNLTVASPFTPVVDVPL
FT                   QGRGPNPLLQNHWMMAVHPVLMYLGFVGLSVPFAYAVAAMITGRLGESWLVQTRRWTLV
FT                   AWGFLSAAIVAGGWWSYEILGWGGYWAWDPVENASFIPWLLATAFLHSVQIQERRRMLK
FT                   TWNIYLIVFAYAATVLGTFLTRSGVVESVHAFSNGPIGPVFLGFFVLLVALGVGLATWR
FT                   LPQIRDPHSLDSPLSREGSMLGGNVVFVVFGLLVVLGTLFPVLVEEVRGIRTSVGEPFY
FT                   NYFAIPLGLLLLLVMGVGPVLPWRKAGNGDLRSLWALTRWPVAAAVVGTVLAFALGVRN
FT                   VGLALTLGLCAYNVVGLGQLVAGSARARGGLGALPGLVREYPRRYGAYVAHLGIVLIAI
FT                   GIGFSGTYKARQEVTLRPNVPQTVLGKTLTLTNLGTEQRPERQSIVATVQAGSETLMPK
FT                   LNTYVNMPQQVAMPAVKYHLMGDTYVTLLSGDVNQQWATVAVIDSPLVGWIWWGGLVLL
FT                   LGTALSVTAPVRETVAVRAPARGLEGVTA"
FT   gene            complement(344724..345230)
FT                   /locus_tag="DR_0347"
FT   CDS_pept        complement(344724..345230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0347"
FT                   /product="cytochrome c-type biogenesis protein CcmE"
FT                   /note="similar to SP:P45401 PID:563331 PID:572602 percent
FT                   identity: 53.12; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09929"
FT                   /db_xref="GOA:Q9RXG6"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXG6"
FT                   /protein_id="AAF09929.1"
FT                   /translation="MTTAPSGLPGTPLPPARRRERPRWPLLVAGAAVLGLIGYMVLGNA
FT                   NSNLVYYVLPSEYQQDTAKFAGKTLRMGGLAKDVVYNRDTLALKFNMTDGQVAYPVQYQ
FT                   GAVPDMFRNDAVVVMEGQMQQGVFHGKSLLVKHSEEYKAADSKGEGQYSQDDLKKILND
FT                   QSTKP"
FT   gene            complement(345357..346067)
FT                   /locus_tag="DR_0348"
FT   CDS_pept        complement(345357..346067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0348"
FT                   /product="cytochrome c-type biogenesis protein, heme
FT                   exporter protein C"
FT                   /note="similar to GB:M60874 SP:P30962 PID:152076 percent
FT                   identity: 58.18; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09930"
FT                   /db_xref="GOA:Q9RXG5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG5"
FT                   /protein_id="AAF09930.1"
FT                   /translation="MKDRLTAALGGLSLLLLLAGLYLAFASPPDVNQKELVRIYYLHVP
FT                   AAWTSYMAYVGTMIYSLIYLVRRDTRFDRMAAASAELGVLMTALALFSGSLWAKPTWGT
FT                   YWTWDPRLTTTAVGLLIYLGYFIIRGLIDDPHRRARVAAVLGIVGTLYIPVNYMSVYWW
FT                   RSIHQTATVKILGKLELAADPRMLQAFFTMLAAFTVLYFFLVRLRGILAKREEALELAR
FT                   DEAELRGLSRQGGV"
FT   gene            346377..348842
FT                   /locus_tag="DR_0349"
FT   CDS_pept        346377..348842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0349"
FT                   /product="ATP-dependent protease LA"
FT                   /note="similar to GB:D00863 SP:P36772 PID:402504 percent
FT                   identity: 70.94; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09931"
FT                   /db_xref="GOA:Q9RXG4"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXG4"
FT                   /protein_id="AAF09931.1"
FT                   /translation="MPDSTALPTTIPVCPVRGSVIYPTMVQHIDASRAISINAIEAAMS
FT                   GEKVILIVSQRDKDVDDPKGEDLYDVGTACNVLRVRKNPDGTLQMLVSAVARVQVSAYQ
FT                   LGDYLTADIEPLDAGKSGGVELQALSRELKDKFETVASGGRINAESVQTINSKDDIGEM
FT                   ADHIAFNLDFKLEDKQAILEAANVTERLKKLLTLLDTEQEVQAVQAKIRAQVKEEIDKN
FT                   QREYYLREQMKVIQKELQGGDEEEGDEAEAFRAKIDALGLNPEVKKEIDREVNRLARMH
FT                   PDAAEASVIRTYLTWVTELPWNERSDDRLDVEEAAQVLDEDHYGLEKVKDRVLEFLAVR
FT                   RLRKERAERGEISAEEVNKGPILVFTGPPGVGKTSIAQSIAKSLGRKYVRIALGGARDE
FT                   SDIRGHRRTYIGAMPGRIIQGIRTAGTKNPVILLDEVDKLGSSYQGDPSSALLEVLDPS
FT                   QNQHFTDHYLGVPFDLSEVMFIATANYPEQIPAALMDRMEVIEFNSYIEQEKLEIAKRY
FT                   LLPRQLLQNGLKPNQISFSDAALEKLISHYTREAGVRNLEREIGTVARKVARNIATGKT
FT                   KRAKVTDKELEKYLGQPRHTPETENMEDMVGVSTGMFYTPVGGDILFVETSIMTGKGGG
FT                   LLLTGQLGDVMKESARAALTYAKSNAERFHIDREKLDNSEIHVHVPAGAIPKEGPSAGG
FT                   AMATSLISALTGIPARHDVAMTGEMTLTGRYLPIGGLKEKVLGARRAGIKHIILPKANE
FT                   RDINDIPLHLRSSMRFHPCETVDQVLDVALVGGLKALETPRTDSQVTPPADSGSKGRKT
FT                   GRRSPEARA"
FT   gene            complement(349031..350746)
FT                   /locus_tag="DR_0350"
FT   CDS_pept        complement(349031..350746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 41.33;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09932"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG3"
FT                   /protein_id="AAF09932.1"
FT                   /translation="MTGPDSSKPAGQGAAPEPSQTQPTPTPALPTQPIDGKYQVLRELS
FT                   RAGNVTLYEVRAAEGVTRRVAWFEVQTPAERQSFHAYRTALRTAAPAGLTDVVARPGAY
FT                   YAVWQDVPGTPLAEVAAQPTKRQEMIEAVEALGTRLADAGFALSDADIVLQGDQPQVAY
FT                   LRPVPPRTPEQIATLNAGVLGDLRDGKVKRKRERRPGAWLTFVPGLVFLAGASWLGAQA
FT                   AKVYLNPPVGEVSNVISQPAADAARALTKKGFRVEYAYGENGNQPIGVVIRQEPDGGTS
FT                   LPTGRLVVLTVNKPAPLTVPKVEDMTLTQAQGPLGDSALKLGKVIRVDGTQTRTPEGRI
FT                   IAQIPPAGASTQRSVPVQVLVSTGVRSEETFIPDLRGMTFEQARDWARAAGLVVTDWSR
FT                   EPSDKTENTVLSQEPAPWANVTVGSKVKLVIAGVRTAPPSVPTEPLPIPPPYVPPPPPE
FT                   PITAPEQTPPTQGQPSTQPGTQPGTTPAPDTAAPPAVDTTPRQVNLNYTFPAELPAGIY
FT                   SITVQDASGEREIMPGVPAGQVASRRAQAPIQVQGNAVFIIRRDGGEYARVPVQ"
FT   gene            complement(350808..351491)
FT                   /locus_tag="DR_0351"
FT   CDS_pept        complement(350808..351491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09934"
FT                   /db_xref="GOA:Q9RXG2"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG2"
FT                   /protein_id="AAF09934.1"
FT                   /translation="MSPLRSPAYHGAMPHSAVSASRLLLGAGLGLVLALLLPHGWPWEA
FT                   RALLGWNVFCAVNLLRLLPLLGFSPEDVTRHATREDDTRALAAALTLAATLVSLVGVFV
FT                   TLGQANHSHGLQAYLLTGLAVLTVALSWLLVQAEYTLHYARRFYSDGAGIRFIQRGTDD
FT                   PLPNPDYFDFLYLSLTIGMTYQVSDTNLDTREMRRLLLAHAALSYFFSVVIIAVTVSGV
FT                   AGLLG"
FT   gene            complement(351536..352009)
FT                   /locus_tag="DR_0352"
FT   CDS_pept        complement(351536..352009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0352"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09935"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG1"
FT                   /protein_id="AAF09935.1"
FT                   /translation="MPLERGERGGRSSGPRRVITLERPRNEHLRPVNITVQRMYFGDWT
FT                   TDNMPPEDGYNGPRAGRERGYDRGERRGEGRGYTRGGNDRGAARLNGNGGPGAGRGSQG
FT                   QPRSAAPRAAAPQAPVAAAEPVQNSAPSDAQSEEARRRRRRRGRRGGAPGSAE"
FT   gene            complement(352185..354467)
FT                   /locus_tag="DR_0353"
FT   CDS_pept        complement(352185..354467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0353"
FT                   /product="ribonuclease"
FT                   /note="similar to GB:U14003 SP:P21499 PID:537020 GB:U00096
FT                   PID:1790622 percent identity: 58.16; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09933"
FT                   /db_xref="GOA:Q9RXG0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG0"
FT                   /protein_id="AAF09933.1"
FT                   /translation="MHVRDLERTFTRQALERLGGWRNITDLLEDLVESGKVIRTRKKTY
FT                   GLPEAMSLVRGRFQASAAGFGFVVPDSNMGKGGGEDYYIPQDRTLEAWNGDTVLVRMDG
FT                   RGDSRSDRDGGRDNGRGGRRGQKGDGNPRATVVRIVQRAYKQLVGTLEFSHGHPILKPD
FT                   DFRARHRILLLPEGLEELEAGARVVTELFWPEHTGEDEVFGQVVRVLGAEDDPETETEA
FT                   VIVKFGLRGEFPDDVQEQANAIPGEIPEEALVGRLDLREFNIFTVDGRDAKDFDDAIHI
FT                   QPTPEGNFVVGVHIADVSHYVQEGTPLDGEAYARATSVYLPGRVLPMLPEHLSNGVCSL
FT                   VPYQDRLTMTALVELSAEGDILDVKLSPSVINSKARLTYDEVQAYSEATATLPDHARHL
FT                   EGDLHLLLKITTKCARSAARRLTRLQVREVKVDVDKDGRMELIPIREETARGMIEDLML
FT                   LANKVVAHYLIEREIPTLFRIHEEPTLQKFQDVTGAIGRLGFSFPGGEPTPQAYQAVLK
FT                   QVRGTGRESVVNTLLLRSMQQAKYAGENLGHFGLAFDEYLHFTSPIRRYPDLVVHRTLK
FT                   KVLSGDFKAGNREVAQFQGRLPSMGEHTSDRERTAAEAERDLTKYYQCKWAQEHRGESF
FT                   MGNVSGVVSSGLYVALDNGVEGKLHISHLDDDYYIFIEDAQILKGRSNGKSFRLGDAVQ
FT                   VTISDVKPLARQIDLTLADPEDPDYTPGSYDLPAAAQETPMTDVKVRARRRRTASRSGR
FT                   KNSRAFP"
FT   gene            complement(355939..356790)
FT                   /locus_tag="DR_0354"
FT   CDS_pept        complement(355939..356790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0354"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="similar to GB:AE000666 percent identity: 59.11;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09936"
FT                   /db_xref="GOA:Q9RXF9"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF9"
FT                   /protein_id="AAF09936.1"
FT                   /translation="MSLLAPAQVPGSQSSHALWSAPMSAPAAPPLTGPLKVTTFNVNGL
FT                   RSALRKGLADWVESNQPDVLLLQEVRAEPMPDALPGYHSAWFPAQKAGYSGVAILSRLP
FT                   LKDVRLGMPHDEMDAEGRVVSAVVAGVRFVSVYLPSGSSGEARQGFKDRVLADYQAWVS
FT                   ELLAAGEPVVIGGDYNIAHREIDLKNWRSNQKNSGFLPHERTWMTAHLAAGLVDCHRDC
FT                   LGEEAEYTWWSNRANAYANNVGWRIDYLLSAGVRVSGVRSDRSVRLSDHAPLTGWVELE
FT                   SE"
FT   gene            356849..357157
FT                   /locus_tag="DR_0355"
FT   CDS_pept        356849..357157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09945"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF8"
FT                   /protein_id="AAF09945.1"
FT                   /translation="MADIKFMNESDGQEFQMTHPKAARVLQDIRAWAAGNDFSRVVFWR
FT                   DADDAHKLWVQLGDDRLNYWIHDSTFTEGKHETVEMQMDYARGAQRRSAAGFGKFDK"
FT   gene            complement(357189..357710)
FT                   /locus_tag="DR_0356"
FT   CDS_pept        complement(357189..357710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0356"
FT                   /product="methyltransferase, putative, BioC family"
FT                   /note="similar to PID:1001734 PID:1001725 percent identity:
FT                   60.83; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09939"
FT                   /db_xref="GOA:Q9RXF7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF7"
FT                   /protein_id="AAF09939.1"
FT                   /translation="MLDIGAGAGHGLGALAWRGHTGRAVGVDPIPGLGVTAGQAEALPF
FT                   PDGTFDVALLVRVLAHLPDPARALAEAWRVLRPGGQLVLAAQGADHLAGTWRALGRPTS
FT                   ANGPDNALREALQAAGHPAWRLDVRLPVTLTADNAEALVESYGLRLTINPARFPITDRL
FT                   HLCVYIAVKS"
FT   gene            complement(357818..358393)
FT                   /locus_tag="DR_0357"
FT   CDS_pept        complement(357818..358393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:L42023 SP:P43980 PID:1003501
FT                   PID:1222231 PID:1204557 percent identity: 58.02; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09937"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF6"
FT                   /protein_id="AAF09937.1"
FT                   /translation="MGGKAKPSPRPRYAAPMSGPLTFLVASPHLQGSFFEGAVVLLLEH
FT                   DAQGAMGLMVHLPAGPTVAELLPDLAQEQAPVWLGGPVDPSLGWCLYRAPVGLEGEVQL
FT                   TEGLMVSSSQDVLHAVIAGGQRYMLVLGYAGWAAGQLTEEARVGTWLWVEQDTPELLWD
FT                   VAPEDRWNEALRRLGVSPDTIVPGGAQA"
FT   gene            358383..359294
FT                   /locus_tag="DR_0358"
FT   CDS_pept        358383..359294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1001613 PID:1001622 percent identity:
FT                   47.87; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09938"
FT                   /db_xref="GOA:Q9RXF5"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF5"
FT                   /protein_id="AAF09938.1"
FT                   /translation="MPPTLCPVFSPYPDLMWTRLPSSGLRVTGADRTDFVHGQMTGDLR
FT                   GAPTPGLVPCAFLNVRGQIEQFARAYRRPDDIYLHLDAGQAPLLAARLRRYIIFDQVEL
FT                   EDVSEVLRTVHVWDQAVPGWDDAGAGAQQWTLGGSLVLGGRVNRSGQPGVDLHYLARDE
FT                   EAVLAALGGEERPLSELDALRVAAGIPDIQRDGLTGTLPQEVGLDVSGPLPAISYRKGC
FT                   YVGQEIMARIEARGQTRFHLARVAGEGLPSHAEIRQGDKVVGQSGLSTGPLALARLRRE
FT                   LEDGAAVEVGGVSARVQLLGHD"
FT   gene            359287..359766
FT                   /locus_tag="DR_0359"
FT   CDS_pept        359287..359766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0359"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09946"
FT                   /db_xref="GOA:Q9RXF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF4"
FT                   /protein_id="AAF09946.1"
FT                   /translation="MTEPAGPGRPRHRRPGTLARLSAALRGTPAEQLAGMRLALRLAFL
FT                   VLALPGLPLGLLYLLTRPAPLSLPVTAALVGTALVLGLGTLWLARRAAVNPDIPREQRG
FT                   LSAAIQGASAPAVAFLLGCASLSSWPALLLLWGLAAAFYFFVWQQLPVWAGQTQA"
FT   gene            359866..360297
FT                   /locus_tag="DR_0360"
FT   CDS_pept        359866..360297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09947"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF3"
FT                   /protein_id="AAF09947.1"
FT                   /translation="MRSNKRRGEDIMGKATEARATGAAVNVILWAAAGGDMNEREQAEG
FT                   WSERWVVDGLEDSPRGRLARVELPSGHTRTIPLHELPDGVREGDLLEVRAGVGGLVFRR
FT                   LEAETLAARLQAQLRLEQLNAGEGRQGPLTINDDGEIEL"
FT   gene            360595..361422
FT                   /locus_tag="DR_0361"
FT   CDS_pept        360595..361422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0361"
FT                   /product="competence protein ComEC/Rec2-related protein"
FT                   /note="similar to GB:L15202 SP:P39695 PID:289262
FT                   PID:1303798 GB:AL009126 percent identity: 53.63; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09940"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF2"
FT                   /protein_id="AAF09940.1"
FT                   /translation="MQHQPRQAPGRATQRSDRAACAAGEVTVQFLDVGQGDAVLVRSPE
FT                   GKTMLVDGGRSTERMREHLKALGVNKIDLMVASHADADHIAGLVEAAKTGHPTLFINNG
FT                   LGGTTQTWNKLVAALQDAGTTFQKANNQVINLGSVKVRVIAPPAGMGDDQNDNSVGIRV
FT                   EFGQFAALMTGDSETKETLAWVAERRPEIRGPVQVYKSIHHGAANGDHQAWFNVVKPEN
FT                   VVISVGENNYGHPTQAALDLYQKNNLRVYRTDRQGTITFKGKADGSYVVATVR"
FT   gene            complement(361570..362589)
FT                   /locus_tag="DR_0362"
FT   CDS_pept        complement(361570..362589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0362"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /note="similar to PID:1652758 percent identity: 69.23;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09941"
FT                   /db_xref="GOA:Q9RXF1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXF1"
FT                   /protein_id="AAF09941.1"
FT                   /translation="MKRRILLLAGGQSGEHEVSLRSARSVLAALPRDQFDVTPVVISKQ
FT                   GRWLPPTETQKALETGVSSQGGDLMLHRAAAAEGYDAVFPLLHGPMGEDGTIQGLLTLA
FT                   GIPFVGSGVLGSAVSMDKVMTKQVLDSAGIPQVAWRLAVRREWQQTPDAVRARAAELGY
FT                   PLFVKPANLGSSVGISKVGSPEELDAALTLAFGLDRRVILEAMTPHKPREVEVGILGND
FT                   VPVASPVGELSFDADFYDYETKYTEGRAEMHIPARIPPEVSERIRTEALRAFRALDCAG
FT                   LARVDFFYVEETGELFLNEVNTMPGFTTTSMYPKLFEAAGLSYSELVTRLVELALEER"
FT   gene            362790..364541
FT                   /locus_tag="DR_0363"
FT   CDS_pept        362790..364541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0363"
FT                   /product="peptide ABC transporter, periplasmic
FT                   peptide-binding protein, putative"
FT                   /note="similar to GB:U00096 PID:1742427 PID:1742438
FT                   PID:1787762 percent identity: 49.22; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09942"
FT                   /db_xref="GOA:Q9RXF0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF0"
FT                   /protein_id="AAF09942.1"
FT                   /translation="MHTDHVLFRRLMKKVALLSTLLIAGTALAASPKDTLVLQYSADVP
FT                   TLDPGVSYDTASGEMIENMYETLLTYKGSSLKTLEPLLATKWTASNGGKTYTFDLRKNV
FT                   KFHSGATMTCTDAEYTFERNLVTNSGESGNWFIAEPLLGTQNNANDDKSVTWDKIDKAV
FT                   ECNSKGQLVFNLAKVDPAFLAKLAYSGQSIVERKYNASIGEWDGTEKTWKTWVGKDLTG
FT                   SNLSKKPNGTGPYRLVKQDANNLLFQAFDGYWGKAPSIKNVIRQKVSEIAPRQQAFLRG
FT                   DADVIEGGGRNVDEAQIKGKPGVAWLDNLPNTSAFVIFMNQNIKATNLLGSGKLDGNGI
FT                   PANFFRDANLRRAFSYSFNYQQYIDDVQKGKGKQRTMALPDSFPGYDPKVNTYTFDKAK
FT                   ATQYFKQAWGGNVWKQGFTLTVNYRAGSTTSQTAMEILKRNVESVNPKFKVKIQPEQWS
FT                   EMLAASKRGEEAMVLIGWSPDYADPDNFLYTFYASDGFYSPRSNFKDASIDKWLNQARA
FT                   TVNTAERNRLYSLVGKRAYEQAPYILVPGGVSYTFFRSNLVGVTANSYNPMTAGTLGVL
FT                   WKDLSKK"
FT   gene            364757..365779
FT                   /locus_tag="DR_0364"
FT   CDS_pept        364757..365779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0364"
FT                   /product="peptide ABC transporter, permease protein,
FT                   putative"
FT                   /note="similar to GB:U00096 PID:1742426 PID:1742437
FT                   PID:1787761 percent identity: 62.23; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09943"
FT                   /db_xref="GOA:Q9RXE9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE9"
FT                   /protein_id="AAF09943.1"
FT                   /translation="MINFIVRRLIQIPLVMVVLSLLLVGITQLLTPEQRAAPYIRGDNQ
FT                   AARIEQIIDQRGLRDPFPVQYGRWAASAVQGDLGFSRASGKDVIDTIKERLPNTIELTL
FT                   LTAIPILLLSVWLGSLSALNKDKFIDQVLRVLTILGYSLPTFVLGIVLLAIFYAYLGWL
FT                   PGAGQLEVVNQFAVSDMKRYTGMLTVDALLNGRWSVAWDVVRHMILPATTLAIVSSADI
FT                   IKVMRNSMLDVLSSDYIRTARAKGLTPGVVNRKHARRNALLPVITLGGLLIINLLSGSL
FT                   ITETIFAYPGIGQWVVQSALQIDLAGVLGFALLSALIVVVMNTLVDILYGIVDPRVRFD
FT                   "
FT   gene            365779..366798
FT                   /locus_tag="DR_0365"
FT   CDS_pept        365779..366798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0365"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /note="similar to PID:1813497 percent identity: 59.73;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09944"
FT                   /db_xref="GOA:Q9RXE8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE8"
FT                   /protein_id="AAF09944.1"
FT                   /translation="MAAPTTTPVAPAAAPARGFWTSPALRKLRRNPLAVTGFVIVLLFG
FT                   LMALLAPLIAKPTGNCLRDLGMETQGQIYQPGFALKAIFASPPECYKMERVSFAQEPAP
FT                   ASSVTGTFAPFGTVNGYNIFYGLIWGTRTALKMSFIIVGITLSIGILIGAISGFYGGWV
FT                   DGLIQGIINVIYALPPLVLTVTILTILRAKNPGGDPTGPIIFAMCITGWATYARVIRGD
FT                   ILKTRQLEYVDAARALGARDMRMILRHVVPNSLTTVFTLAVLALATVPLSVAALSFLGL
FT                   GFESGYSEWGQLIDFARAWLKPDYWYVLAFPAIFIVLFSLAFNLFGDGLRDALDPKTR"
FT   gene            366924..368054
FT                   /locus_tag="DR_0366"
FT   CDS_pept        366924..368054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 67.87;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09948"
FT                   /db_xref="GOA:Q9RXE7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE7"
FT                   /protein_id="AAF09948.1"
FT                   /translation="MKWLRDPGLAPIVEKVEAGQRLTFDEGMQLFHTRDLNTLMRLADL
FT                   QKRQLHGDKVFFVHSMRLEFTNICYVGCTFCAFAARKGEERAWDYDPDEVVAQVGRRYL
FT                   PGITELHMSSGHHPNHKWEYYPAMVQKLREAYPDLQVKAFTAAEIEHLSKISKKPTREV
FT                   LAELQAAGLSAMPGGGAEIFADRVRKQVAKNKVKAEKWLQIHREAHELGMRTNATMLYG
FT                   HIETLEERLDHMHRLRELQDQTGGFHAFIPLAFQPLGNTLAQNLGKTEYTTGLDDLRNL
FT                   AVARIYLDNFPHIKGYWVMIGSELTQVSLDWGVSDIDGTIQEEHIAHAAGATSPMALSQ
FT                   AGMVKMIQSAGRVPVLRDAYYNELEVFGRAGEEAAD"
FT   gene            complement(368207..369007)
FT                   /locus_tag="DR_0367"
FT   CDS_pept        complement(368207..369007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09955"
FT                   /db_xref="GOA:Q9RXE6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE6"
FT                   /protein_id="AAF09955.1"
FT                   /translation="MTPSTRGVQWRLPHSLLRPPLYPAAMSVPTPLTVRCVTDPQDPAL
FT                   AAFGRIQEEVYYAPDMLIPPAAFSRLLAGGQDERQDRILVAEQGSEVVGGTIYSLLPAA
FT                   GFNSFMGVSRAAQGQGAGRALHAASLADVRAAGLPGMFADSVHPSRQSAAEREAEARSG
FT                   SDPFTRRQQLHALGLRTVDVPYWQPVGGENGGPLKDLDLLYCPLDGGETVPLALVTRTM
FT                   EAYWRGWLGPQRAAAEAQALAERAGNAERVRLLPGTETPGYWAR"
FT   gene            369006..369773
FT                   /locus_tag="DR_0368"
FT   CDS_pept        369006..369773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000666 percent identity: 47.12;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09949"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE5"
FT                   /protein_id="AAF09949.1"
FT                   /translation="MDYTWAASTEREVRSGNDRIEVLEYSAEPLEKPLAGFHQTFQRPP
FT                   RWRQLAVHSSGQGVATLETGALQYLRGGMEVQAVNATGGSGLGGLLRGAVTAASSGEGL
FT                   FKTALRGAGTAYTEPTRLHLLLGELRGESLIVDDGAFVACVGQIQVGRHVNRGLAQMLG
FT                   SGEGRVQPKLSGQGVFALQSPVPPGEFQVLELRDETLKVDGNLVVAYTDGLQFSVERSS
FT                   RGLLGSAKTGEGFVQAFRGTGRVWLAPTLPLHA"
FT   gene            370025..370285
FT                   /locus_tag="DR_0369"
FT   CDS_pept        370025..370285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0369"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09956"
FT                   /db_xref="GOA:Q9RXE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE4"
FT                   /protein_id="AAF09956.1"
FT                   /translation="MKLAAGFFGAGMAFLISGLLAGAFPALWSSYRLLQLLYSLGIFRD
FT                   DVAFAGNFPDPLASAVGRVFLLLSLVSFALAALSYLLKRTP"
FT   gene            370282..371157
FT                   /locus_tag="DR_0370"
FT   CDS_pept        370282..371157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:3328857 percent identity: 45.68;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09950"
FT                   /db_xref="GOA:Q9RXE3"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="PDB:2I6E"
FT                   /db_xref="PDB:6O9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE3"
FT                   /protein_id="AAF09950.1"
FT                   /translation="MTNHHPSSTGPQHPYRAGWIHFTNVAPILDSLELPPGVTAITGVP
FT                   TQMNAALLSGEVDIANVSAVEFIRHADTLAALPDFSVAVLGPVYSVNLFHTCPLPELRR
FT                   VALTSQSAMSVALLEVLLRQKGLSPVLERAEGTAESLLAAGYDGVLRIGDDALREWYGV
FT                   VGPLTPERTMTSLPHTGRGITVTDLAQEWFDLTGHPFTFAVWAYRKDNPPPAALLQAMR
FT                   EARRRGIGHLAEVSQRHAEKLGLPERVVQHYLWNFRYHLEAPDRLGLREFADLAVPGHA
FT                   ELTFGAREEA"
FT   gene            371276..371497
FT                   /locus_tag="DR_0371"
FT   CDS_pept        371276..371497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0371"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09957"
FT                   /db_xref="GOA:Q9RXE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE2"
FT                   /protein_id="AAF09957.1"
FT                   /translation="MFGVAGGVGLAVVHAFEGRLAVVLDFVHFFLVAVVVLGLAGVALV
FT                   LVVFVRHGGSVSQRPAPKTREVSKPVHR"
FT   gene            371543..373120
FT                   /locus_tag="DR_0372"
FT   CDS_pept        371543..373120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0372"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="similar to GB:X70708 SP:P41255 PID:486665 percent
FT                   identity: 74.70; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09951"
FT                   /db_xref="GOA:Q9RXE1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXE1"
FT                   /protein_id="AAF09951.1"
FT                   /translation="MPDAPRPPRPEGLHEQTIARLNNLDAQVDAGFEAYPYSYPQTHHA
FT                   RDVFAAHPAREEGTGEGGTLEPGQKWEEESYSLAGRVTLMRHMGKAAFADLSDEDGKIQ
FT                   LFFSKQDTAGFDATKKIDLGDIIGVKGHPFVTKTGQLTLHVTEWQPLVKSLHPLPSKFH
FT                   GLQDEELRARRRYVDLMVTEGAREKFQARSRMIRYIRNELDERGFMEVEGPTLQVTAGG
FT                   AEARPFMTHHNALSYDFKLRISLELYLKRLLVGGFERVYEIGRVYRNEGIDRTHNPEFT
FT                   MLELYWAYADYSDIAKLVEDLLSGLAKEVHGSYQFEYQGKTLDFTPPFARVDYLGGLRE
FT                   HVPGLDFDPLDLDRLRAFCDERFPQWKGVPSYKLLDKLFGEFVEPLLSNPTFVMDHPAV
FT                   ISPLAKKHRSRPEAVTERFEVFCSGFELANAFSELNDAFDQRERFEAQTARQAAGDDEA
FT                   HPQDEDFLLALEYGMPPAGGLGIGIDRLAMLLTDSDSIRDVLLFPLLRPEGGEAEEADD
FT                   TAQENTAG"
FT   gene            373252..374472
FT                   /locus_tag="DR_0373"
FT   CDS_pept        373252..374472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0373"
FT                   /product="cation exchanger, putative"
FT                   /note="similar to PID:1653233 percent identity: 63.09;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09952"
FT                   /db_xref="GOA:Q9RXE0"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXE0"
FT                   /protein_id="AAF09952.1"
FT                   /translation="MWMNLLLAFLPVSLLLEYVFHAPPLWVFFTATIAIIPLADWLRQA
FT                   TEQIAERVGQTIGGLLNVTFGNLAELIIAIFVLLSGNAVVVKAQITGSIIGNALLGLGL
FT                   AILIGSVGRQRQKFSWQNAGQLNSMLVLVTIALLIPALFDYTERLPGFAAGSDLARSDL
FT                   DERLSLAVAVVLIAAYALNLVYTLVTHKDIFALDDGTEEGSAEGPAESTAEGAGHSHVA
FT                   PWPVWKAVGVLVGATVLIAWMSEILSGALEATSQTLGLSPFFLGIIVLAVVGNFAEYIS
FT                   GSYFARQGKIGLAINIAVGATIQVALFTAPVLVLISYLIGKPMNLVFGSPLELVAIVAV
FT                   AITVSTVTRDGEATWFEGVLLLTVYVLLALAFFFVTPRGEEGAPAALYAPAPALVQAAP
FT                   ERLALAS"
FT   gene            374541..374843
FT                   /locus_tag="DR_0374"
FT   CDS_pept        374541..374843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000666 percent identity: 62.30;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09953"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD9"
FT                   /protein_id="AAF09953.1"
FT                   /translation="MARVPHTSPHTRAVLAALLAAYPAHRYGYDLSKQTELKSGTLYPI
FT                   LQRLHEQGYLVAEWEASPHAGKPPRHIYRLTEDGLRLAREQRGENQRLRLKGALA"
FT   gene            374840..375292
FT                   /locus_tag="DR_0375"
FT   CDS_pept        374840..375292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0375"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09958"
FT                   /db_xref="GOA:Q9RXD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD8"
FT                   /protein_id="AAF09958.1"
FT                   /translation="MKRDEWRAARLNEAANVPDTQWATETRRSLWWWEMTFSALYFAAL
FT                   AAIQVLCFAVQPPTQLWLGVMLVVVGLGLSLGFGGRSPFTVGAASLVYFPAAWLTVVLW
FT                   QALSWGQVPMSPGVDDAGFFVLPVLAASAALVGGFLRVAAQWGKRF"
FT   gene            complement(375947..376906)
FT                   /locus_tag="DR_0377"
FT   CDS_pept        complement(375947..376906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0377"
FT                   /product="L-serine dehydratase, alpha subunit"
FT                   /note="similar to PID:2315866 percent identity: 62.89;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09954"
FT                   /db_xref="GOA:Q9RXD7"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD7"
FT                   /protein_id="AAF09954.1"
FT                   /translation="MTSPTSPPRQDWPRSPPARRSLTMTLEELMNAPAPASRWVLERDC
FT                   AETGLDPADIRAEMLRRIGEMRSSVERGLQSDARSITGMVGWNAKGLWDAPDVLGAPLL
FT                   KRVQAYAMAVNEENARMGRIVAAPTAGSAGTIPGALLGVADHLGLSDEQLVDPMILAAG
FT                   VGKAISKRMFISGAAGGCQAEIGSSAAMAAAAVVELLGGTPRAAVHAASLALMNTIGLV
FT                   CDPVGGYVEVPCVSRNAFFAVHAVSAAQLALAQLESFIPPDEVLGAMASVGRLMPAALR
FT                   ETAEGGLAQTPTGLAVTARMEGKGEGELPGGMVELPLA"
FT   gene            complement(377018..377659)
FT                   /locus_tag="DR_0378"
FT   CDS_pept        complement(377018..377659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0378"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="similar to GP:2983549 percent identity: 62.28;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09959"
FT                   /db_xref="GOA:Q9RXD6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD6"
FT                   /protein_id="AAF09959.1"
FT                   /translation="MHVVPVASSRPLRARSALEKTRRRDDILRSAERLWLSTPYADLSM
FT                   NQVAREAKLAKGTLYLYFDTKEELFLALLHEYLQGWFQRFGELLGAQRPQTPREMAATL
FT                   TDALHDQGHLRRLLLLLTTVLRSHLAPEVEANFRRETQQLLKQAVSAMPYAPEINQQIL
FT                   VHCYALAVGWQQMAPTFGQAPHPEYQFVEGEAAFQLALEAVIERLAPRLD"
FT   gene            378131..380671
FT                   /locus_tag="DR_0379"
FT   CDS_pept        378131..380671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0379"
FT                   /product="outer membrane protein"
FT                   /note="similar to PID:2231197 percent identity: 45.54;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09960"
FT                   /db_xref="GOA:Q9RXD5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD5"
FT                   /protein_id="AAF09960.1"
FT                   /translation="MRHPLTFAVTTVLIASAPALAQQAGTVQDISVVGTTDLLSEFLKT
FT                   TLTVQPGAALSSVNLRQVEQEVLASGYFKTATAELRTTGGRDTLVVTVTANPVIKDVQA
FT                   TGLTFLPADAFKQSVAELLNIAPGAVLNTQRLEQAKEALAQNYRQEGFPFVPSISADTK
FT                   TNKDGTATVTFVVDESAPLSRIEVTGATLLPQATVQNIFRPLQTSKRFTTQAFFAASDA
FT                   LQAAYEAAGYFQAGIDPRSVTLENGVLKLSVIESRVASVDLSPLGTLAQTPALQTKAGQ
FT                   PLRLAQLQADVRALANQTGQPVGFALQADPQNPSQVTVLFGAADVESGPVKSIAFVGNT
FT                   KVPTAQLQAAIKTKPGDVYSPQLAQDDFMALRNVYRQAGYEISTRDAITFQNGVLTYNL
FT                   REVRLAGYELAWQGQHRTKDRVILRELPAAGQTFNSKDVQAALGRVSALGYVTINDVRV
FT                   KSDPQNPENVTYVIALSEGRTGIPVNLSLGYDSLQGGWSGDVAYTNSNAFGLGHSFGVR
FT                   LGAVQNQAGQNWVGSLNYTIPWLDLDFADFRKNRTSLSFGVGSDVGGNIALLDANKEDT
FT                   GRDYTTRTNGFSLGLGRNITPNLTASANVAFNNRTSYLEPKQEGETSNLDDAAATALLP
FT                   ATSLTTRLSGNLNYDNTDNVNFPGRGVRAYGALGYNVGRAGDAPLSWTDGEIGVSGYYG
FT                   FGGRIKRSFGLETYRQVLAARANTGTTTGTFPDGTGYFIGGSNPLASRELRGLEDGQLF
FT                   GTNYFSSSLEYRYDFGLSGGVAQGLYGVLFADYGGVWNSGEAFRSAYGVGAGVQLNLGF
FT                   GGAQLPSLRFDYGYSGQNAQKPNGRFHFRIGNFW"
FT   gene            380874..381380
FT                   /locus_tag="DR_0380"
FT   CDS_pept        380874..381380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000782 percent identity: 52.17;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09961"
FT                   /db_xref="GOA:Q9RXD4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD4"
FT                   /protein_id="AAF09961.1"
FT                   /translation="MIVLYALSILLANITLNKFIQLPVFGLLSVGTIFFAAVFTLRDRI
FT                   HRAGGVPAVLIAIALALAVNTVAALLLGTPLRFVGASFLAILVGELADTGVYQRLIHRS
FT                   WWTRVLASNAVSVPLDSVLFTLLAFYGDMSSREISEIIFADILAKYAIAALFAFRVRRS
FT                   HLQAA"
FT   gene            381377..381781
FT                   /locus_tag="DR_0381"
FT   CDS_pept        381377..381781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09966"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD3"
FT                   /protein_id="AAF09966.1"
FT                   /translation="MTDSLSSENAHLLGTIANARPALDMTVEHVLTLPELCPATQNPKP
FT                   GSTLTLSYAGGERLLELFSLDTYVDAFIGHPVVRDMEFFVQTVAEDAANALGCPVTARA
FT                   DVTYHRLRQGQRITVRALPTGAADAGTLPE"
FT   gene            381778..382814
FT                   /locus_tag="DR_0382"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; similar to
FT                   GB:AL123456 percent identity: 66.45; identified by sequence
FT                   similarity; putative;O-sialoglycoprotein endopeptidase,
FT                   putative, authentic frameshift"
FT   gene            complement(382882..383724)
FT                   /locus_tag="DR_0383"
FT   CDS_pept        complement(382882..383724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0383"
FT                   /product="S-layer-like array-related protein"
FT                   /note="similar to PID:993026 percent identity: 54.61;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09962"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD2"
FT                   /protein_id="AAF09962.1"
FT                   /translation="MKKLLTLTALTATLAATASAAPVISAQSIIVNPVQNNVNVRVWTN
FT                   KDTSGTRTPSYFPGERIQISTTVDQDAYVYLFNVDPNGQVDMILPNRYAGGANYVKANT
FT                   TKVFPAPGAGFTFDIAAPYGLNKVLALASRTPLNIEQLSQFKTQQGSFQTGIQGQGQLA
FT                   QALSIVVNPVAQPIPQNSWDSATAFYNVAQRPVSAPAQPTYPWTQVRVWRSYTPYTSGS
FT                   NVVTVYQDFNTQLTDQGYRLVSRNQRGNELSATYRGNNGTAQLYIRLVNGQFEVRINR"
FT   gene            complement(383832..384233)
FT                   /locus_tag="DR_0384"
FT   CDS_pept        complement(383832..384233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09967"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD1"
FT                   /protein_id="AAF09967.1"
FT                   /translation="MNLWGTGPFDNDSGKAFIDEVLQDGDYALAEAFDVVLDADMDFIE
FT                   AEEGQRALAAAEVLRSVLTDDTSRIVDAGLRDWVQNADVAALEPLRTSAFHALKRVLSS
FT                   ESELPELWEDEADAQEWRTDTEHLLAALG"
FT   gene            complement(384279..384674)
FT                   /locus_tag="DR_0385"
FT   CDS_pept        complement(384279..384674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0385"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09968"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD0"
FT                   /protein_id="AAF09968.1"
FT                   /translation="MEWVTPPLSSAAWPAALNAVLEALCGLGVESAELMHGWSFSDFSD
FT                   TPEFAAMEWQTEEVTLAALPELLRERARLGFCLGRDDLFLTLIGGAELKLCHEGDLHLR
FT                   AEDESFAVHLAGCLAKQGISLTRRAGA"
FT   gene            complement(384674..385963)
FT                   /locus_tag="DR_0386"
FT   CDS_pept        complement(384674..385963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0386"
FT                   /product="gcpE protein"
FT                   /note="similar to GB:AL123456 percent identity: 58.29;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09963"
FT                   /db_xref="GOA:Q9RXC9"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXC9"
FT                   /protein_id="AAF09963.1"
FT                   /translation="MSFDSLPALPLDPLPDAALPTAPRRRQTVSVNVGGVMVGSAHPIV
FT                   VQSMTNTDTANAEATAIQVAQLARAGSEIVRVTVNTREAAAAVPELVQRLADIGVHVPI
FT                   VGDFHYNGHLLLREYPETARLLAKYRINPGNVGAGQRHDENFATMIEVAKEFDKPVRIG
FT                   VNWGSLDQQVLARLMDENAAAGHPKSPTDVTIDAMIVSALDSARFAEELGLGHDKILIS
FT                   VKVSSAPELWQVYRQLAPLCDYPLHLGLTEAGMGMKGIVASSVALAPLLTEGIGDTIRV
FT                   SLTPEPGAPRKLEVEVAQQILQSLGLRQFLPQVTSCPGCGRTTSSFFQTLAQKIQDFIR
FT                   ESMPEWKAKYPGVEDMQVAVMGCVVNGPGESKHANIGISLPGTGEDPRAPVYQDGKLLT
FT                   TLKGPRIAEEFQELLEKYVEERYGQGVAQG"
FT   gene            complement(385994..386803)
FT                   /locus_tag="DR_0387"
FT   CDS_pept        complement(385994..386803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09969"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC8"
FT                   /protein_id="AAF09969.1"
FT                   /translation="MGRRERFAQYQWAAWPDETLVEASAHLYMPYVRRVEQGFHDGPDL
FT                   VVELTGEYFADVAGAEAQYTACGHNEPGLERTLRLTWQSRWEEVDGGLNGGGVTLHHSE
FT                   RIYALETYPEEYSGPYAHSYSWNSEAPDCGSTFLEVVNDPDPWITEILEDNPDYGVFPL
FT                   GGRAVQVHPDKWEQGKKLGWETPTGRFYPPASGDHVESGDYFWTGPNPPTPEERAEMDR
FT                   QVKRNREAQAALERARPRYRHLFISSNSVMVEVLCEGLPRWEWVELP"
FT   gene            386815..387309
FT                   /locus_tag="DR_0388"
FT   CDS_pept        386815..387309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09970"
FT                   /db_xref="InterPro:IPR016782"
FT                   /db_xref="InterPro:IPR019260"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC7"
FT                   /protein_id="AAF09970.1"
FT                   /translation="MPEGAAPPVAWFMPQNFRDDVLGNLTYDEQLEGWEGTFGTPEVSL
FT                   WLSGAQGDGAGQDRLPVYRDAFLRLRRDEPGLRRQVAEQLTDLAEDWREPEDDAEDDDE
FT                   EDGQPITPESVLERIALTNVMLYADGSAELYYSDGDLFAGHVIIGSVDENGELTDAGIA
FT                   G"
FT   gene            387340..387672
FT                   /locus_tag="DR_0389"
FT   CDS_pept        387340..387672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 58.88;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09964"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC6"
FT                   /protein_id="AAF09964.1"
FT                   /translation="MSGSIQITEAALASLIGLTAHEIPGVVGMAPANLKEGLSRVLGRA
FT                   NVSDGVVIGKDGGKFTADLYIVAAYGVNIPRVAENITERVQHIVKTQAGIDLAALRVHA
FT                   VGVQRV"
FT   gene            387647..389305
FT                   /locus_tag="DR_0390"
FT   CDS_pept        387647..389305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 60.86;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09965"
FT                   /db_xref="GOA:Q9RXC5"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC5"
FT                   /protein_id="AAF09965.1"
FT                   /translation="MRWGCNVSDAPMSAGLAPEHVKTLKPADLARMFRTATDWLGVYRE
FT                   QVNALNVYPVPDGDTGTNMHLTMQSVRRELETADQHSMPAVARAISYGALLGARGNSGV
FT                   ILSQLLKGFAEAIRDCGEVDAAQLGKALRAAQKSGYGAVMKPVEGTILTVARGVADGAA
FT                   KKADSADMVLENALFEGQKLLDQTPEMLPALKQAGVIDSGGQGYLYIVQGLLAALRGDD
FT                   LPAAPEITSYAQQQFENEEFGFCTEFLMSEATRPIEEIRELVSPYGDSLLVVGAEGYVK
FT                   GHIHTNEPDALLATVGRYGRMLKTKVEDMSEQHTEILGMTGAAARAEEEIPASGLVAVA
FT                   NGYGLVKQFRALGARIVSGGQTANPSVQDIVDAVRSVSAEKVVILPNNKNVLMAAEKAM
FT                   ELMEGRAVVVPTRTLGQGLGAALAFTPDTSAEELKDTMTEAAQAVTTFEVTRASRTTNI
FT                   TTKDGRTLAIAEGDVIGLQDDELVQAGGTPEESVLEMLGRGYDGQDIVTVFGGPQKTPE
FT                   DLDALAERIGKVLPSVEVEVHPGGPDLYDYLVTLE"
FT   gene            389542..389727
FT                   /locus_tag="DR_0391"
FT   CDS_pept        389542..389727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0391"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09975"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC4"
FT                   /protein_id="AAF09975.1"
FT                   /translation="MRFDLPGLTLGPTDKDVEHLARHQLRLEDANQQPEEEQAKALGLT
FT                   LEQWQTLQESLHGLRR"
FT   gene            complement(389791..391188)
FT                   /locus_tag="DR_0392"
FT   CDS_pept        complement(389791..391188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0392"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09976"
FT                   /db_xref="GOA:Q9RXC3"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC3"
FT                   /protein_id="AAF09976.1"
FT                   /translation="MTRDRNDRYDNSRDDRFDRQGQGRGVGRPGDMNDRYGHYDYGSMP
FT                   MDPASGMQQGGQRYGQSSGQGYDRDQRDYSDRGYGGGMGSMGMGRSYSEDQGRYRSMGG
FT                   QDYGRQGMGQDYGRQDYGRQDYGRQSSGMGSYDDRSGMGSMSYGQRGMGGGGYGQSQSY
FT                   GSYGDDSRYGQGMGNQRGGMGSGRDEYSYGQSSYGMGGQGYSQQGSQGYQGGGYQGGQS
FT                   YQGGYGSQGMGQQGYGGSMGGQGMGMSGMGRDYASSTSMSMGSMGTQGGYGQSYGQSQS
FT                   YGQSGMGSGQQQSYRGKGPKGYQRSDDRVKEAVSDALEDADHVDAENIEVQVQNGEVTL
FT                   TGTVSDRGQKRRAEECVEHLRGVKDVHNQLRVQQSQGQQAGMSSYGSQMAQGGQSGIGS
FT                   MGMGSQSGSSSSSSQSSNLGHDAMTSAGNETSSDSSSTGSGSSSATGSTGASSTGSSTS
FT                   TSSSTQK"
FT   gene            391614..393650
FT                   /locus_tag="DR_0393"
FT   CDS_pept        391614..393650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0393"
FT                   /product="elongation factor G"
FT                   /note="similar to GB:AE000657 percent identity: 61.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09971"
FT                   /db_xref="GOA:Q9RXC2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC2"
FT                   /protein_id="AAF09971.1"
FT                   /translation="MFPQRSGGFMPSRTVSLAAHSGAGKTSLAEALLHASGAISRPGRV
FT                   EDGTARSDFTDAEKEHGFSIQTAVLRLCSEGVDITLLDTPGYADFVREIRGAVRAADAA
FT                   LVVVSAVSGVEVGTERVWATADRFGMPRLIALNKMDRDRADFYTMLADVRASLKGPVAA
FT                   TFLPIGQGEDFRGIVEVLSGESSVEVPTSMRAELREARDALTEAIVETDDALMTRYLDG
FT                   DDVSDDELRTALEAAIRAGTLYPVIPVSALTGVGVPELLHLLACGLRSAEERGPATGQD
FT                   GQTREPSADAPFSARVWRLSVDPFVGKEAYIRVWSGTLRAGDTVRNTTRGVDLRPAHLY
FT                   VIDGKELTEVPELRAGDIGVLTKLPELHTGDTLADPAHPIEYDPLWLPDPAHTVALRPR
FT                   TRQDEDKLGAALARLLDEDPTLRFAREPQTGEQLLSGMGDMHTKIAVEKLAALGVGVDT
FT                   APPQIPYRETIHARAEGQGKHKKQSGGHGQYGDCTIRIEPGEGYNFRSAVVGGAVPAKY
FT                   LPSIEKGIQDVLQKGSLAGFPLQDLHVTVLGGSYHDVDSSDIAFRTAGSLALKKALEDA
FT                   KPGLLEPVVLLSVRAPAQLTGDLISDLQTRRARVQGMDPEGTVIVIRAVVPQAELQTYS
FT                   ADLRSLTGDRGAFSVKPHGYQDVPEPLARKVMAERQAALRSEA"
FT   gene            393726..394754
FT                   /locus_tag="DR_0394"
FT   CDS_pept        393726..394754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1652450 percent identity: 50.68;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09972"
FT                   /db_xref="GOA:Q9RXC1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXC1"
FT                   /protein_id="AAF09972.1"
FT                   /translation="MPDARRRPERQTAAVSFSARSFPALHSVLAPTALAGLVSETYGLT
FT                   QPALTLLRRGLNDTSRVQSGERRTILRVYRCGWRTPAEVGWELAFLQHLAGRGVRVSSP
FT                   LPRADGALFGVLDAAEGPRAYAMFEYLPGRALENTPADAALYGQCAAGLHDAADPFTAP
FT                   GRLALDLNHLLTEPLRQMRPLLTEFPDLAAPLEAAAERTQARLTALAPGLSWGACHGDL
FT                   HEANARLTPENEVGLFDFDCAGPGFRAYDLAVYWWSQVTQGQGAEEVQPLWDAFLGAYR
FT                   ERRPLTDADLAALPHFVAARALWFMGLMAGRAAEFGTETLGRPFFEFGLNFLTEWEERH
FT                   GA"
FT   gene            394911..395996
FT                   /locus_tag="DR_0395"
FT   CDS_pept        394911..395996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:P43531 GB:U00096 PID:1742619
FT                   PID:1742630 PID:1787880 percent identity: 51.25; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09973"
FT                   /db_xref="GOA:Q9RXC0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC0"
FT                   /protein_id="AAF09973.1"
FT                   /translation="MPLLAREFGLSTATVGTAIGSTTLAIALASPVAGLLADAFGRRRV
FT                   MLWAFALLLLPCLGAVYASSFTALNVARFAQGLLIPLVSVAITAYLAEETPPGTLGRYM
FT                   SAYISGTVLGGFLGRFASGLVAHGGQWHTAFWLLMVTNALGFWAVWRLPRSGGFRPAVD
FT                   AQETMRTLREHLRNPRLLTVCVVGFLILFVLVSVFNTVTFRLAAAPYSLGSGPLGAVFT
FT                   VYLLGVVVTPASAPLAARLGTARTLVVASGLSLLGLALTLSTALPVIVLGLAAASSGIF
FT                   IAQAAAQSAVQQSVQGGRSLAGGLYNMTYYAGAAAASVAAGLTYDAGGWRAVVGLCALA
FT                   LLAVAGLSTVVGRRQRRAEAG"
FT   gene            complement(395998..396783)
FT                   /locus_tag="DR_0396"
FT   CDS_pept        complement(395998..396783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09977"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB9"
FT                   /protein_id="AAF09977.1"
FT                   /translation="MTLPLMLLTLLLGGGPGAPAPSQVAASHSAPSPSAPAQAAPAITT
FT                   PAPQQDTEVATLRAKYAGQDVWVYGGGPLHCSLESSQASVTLSVPYTGTVRVLNVERLK
FT                   GTFPVALVKSSGVMPAQPVNNPLRLRLRLPKDFRVQSLSYSGTKEVTLKDAYTCREVTE
FT                   TYVDGADLEKNFSLIPPDAATKKALAPFQNPNNSASILGLTHTQVLWLRGIPESPAGDL
FT                   KTLLSAPVWLWNGLPGRGDNVLHFKNDRVVREEVPSMGP"
FT   gene            396838..398931
FT                   /locus_tag="DR_0397"
FT   CDS_pept        396838..398931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0397"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="similar to GB:AL009126 percent identity: 57.19;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09974"
FT                   /db_xref="GOA:Q9RXB8"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB8"
FT                   /protein_id="AAF09974.1"
FT                   /translation="MIEWPRDAELWPTVPAPPPYPPPMTATRDVLLTCPLDCPDACRLK
FT                   ITIERQPDGSEKAVKLTGDPAHPYTRGFACAKTVHYPARQNHPERPLYPLRRVNPKTDP
FT                   EPQWERVTWDEALDDIAGRLRQLIAERGPQSILPYHYAGNMGLLEGSHVHALWRALGAA
FT                   ELEETICASAGTAAWEVGYGTRLAVDPLDVPHARLIVLWGINSLSTHSHLTPQITAARK
FT                   NGARVVCVDPYRNRTAAFADEHLKIRPGTDAALALGVMRELFVNGWTDAEYLAQATEGV
FT                   DDLRAAAEEWSPQRTAEVTGLTADEVRDFARLIGTTRPTYIRVGYGMTRYENGATALRA
FT                   VTLLPALTGDWRYRGGGCVMSTSGTFKLNRRRLGAAHVTRPEAPRVNMNELANALDPAV
FT                   GFGALFVYNCNPAVVSPDSGRVRAGMRRDDLLVVVLEQAMTESARLADYVLPATTFMES
FT                   PDLYTSYGHFWLGYNPAELTPPGECRPNSWVFAELARRLGVEEPSVYWTADDLMAELLD
FT                   TDHPFLDGLTPERLKAEGTVRLNVPDGFLPYAYGAETPSGKVQLAPAPRFVPVQAELNA
FT                   DFPLRLLTPPAHHFLNSTYGNLGNLNRAEGGEPQVLLCPADAAASGVQDGEYARLTSEQ
FT                   GEVRRRVKVTDAAQPGVAVVEGTWWGLTAPDGRSINELTAQTLTDLGGGSTFHNTRIRV
FT                   SPA"
FT   gene            complement(399031..399495)
FT                   /locus_tag="DR_0398"
FT   CDS_pept        complement(399031..399495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09978"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB7"
FT                   /protein_id="AAF09978.1"
FT                   /translation="MPLLLAVLRFVGGLVLVLGLALTLVVTADDVGGWQTWLFRAGHRI
FT                   AYVEDQNAGTRTVAFLLRPKEDVTRAVQACAHSFDKMLLQDGTFVHCVAYDSAQAAQQS
FT                   RQRPQLICERGRAIQMPYGSARDATIVLNRQQQCAVQLTYLPEYVREYSR"
FT   gene            complement(399596..401467)
FT                   /locus_tag="DR_0399"
FT   CDS_pept        complement(399596..401467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0399"
FT                   /product="osteoblast specific factor 2-related protein"
FT                   /note="similar to GB:D13665 GB:D13666 PID:393317 percent
FT                   identity: 53.86; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09979"
FT                   /db_xref="GOA:Q9RXB6"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB6"
FT                   /protein_id="AAF09979.1"
FT                   /translation="MVSIVRRISQAQSRGELMKKRLGLMTLSLLLVSPALAGGAGKPAA
FT                   KPAASCKSIAAIVKSDPQFSTLATALEAADLTGELAGSGSYTLFAPTNAAFAKVPSDKL
FT                   AALLGDPETLSDVLAYHVVGEKANASDLRGASAGTTEQGADVTIKVSGNQIMINDARVV
FT                   KADIQACNGVVHAIDTVLMPPMDTAAAPAPAAPAPAAPAQPAPAPVASTSAPAAIDIRS
FT                   IPALPLSGAVTVSTPTSATTTTETSTTDTDTGMTDDTATDDTTDTTDTAEVSSNTLYDV
FT                   LVADDRFSTLRDLLSDAGLTDMLMTGDYTLFAPTDEAFAALPEGELAAIAGDPEALLSL
FT                   LRFHVVQGRLTSEQVQAGNLQTVAGSPLTISAELSPAIESSTGLIYPVDAVLLPEGFTV
FT                   PAAPADDTTSAAPVTNTADTAAAAPVTNTAATTTTTTDAAAPVTNTATTTTSATTTVTT
FT                   TTTNAAPAQATPGTAQGGAIAGGNLTSPPANVAAVLTDARFSTVRDLLTQAGLLDTLGS
FT                   GTYTIFLPTNDAFAKLDPAKLNAVKADPALLKQVLSYHVVSGQLNAAGLTASPLTTLAG
FT                   SPITVTNGASGLSFGGMGMALDGGTPITAGTSTVYVIDTVLLPPSLR"
FT   gene            complement(401573..404515)
FT                   /locus_tag="DR_0400"
FT   CDS_pept        complement(401573..404515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0400"
FT                   /product="cell division protein FtsK, putative"
FT                   /note="similar to SP:P46889 PID:1004225 GB:U00096
FT                   PID:1651412 PID:1651418 percent identity: 56.73; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09980"
FT                   /db_xref="GOA:Q9RXB5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXB5"
FT                   /protein_id="AAF09980.1"
FT                   /translation="MRRLQREIRTYDEEQLKQVREELTTYDLMTRNALLQTAHDLRAKV
FT                   EQEAVPEGEQATTYLKAVVDDRRHELSVFLPATQASAALENVRRHLVNQILSIGGKAKK
FT                   LETERCAAERHLKRPTVEVVQREHDAHLRRLRQWQEVQSRFQTWHTYEQAYARWPDLAA
FT                   AFDSGPTEAATRVATELHKRTLATMQEQDRWREFLRQATEQEHQRQLTPPEDDLPEDDL
FT                   EEDTWAAAESSEPSGSLFSRLGHTLSRLMAPPGPDEVPSAATAPRETDGWDDVQPQIAP
FT                   DPRSTVPGLWDDADDLTPVSPVAPARPAPSPPVYDAAAVPALDIDFSAAPRRSRTPAEQ
FT                   MPDPFARAARVRSARRTTTPLVPVPQQLDAAEMPAPRPARTPPGRPATAGNVAPPSAPR
FT                   TARPPSPTLADFDLWDDEEDMPFGPPATPAPAAASVPQMVPTPRAAARPTPRPVSSPGP
FT                   SPVPVSPASASVSHAAPWEEPAAGRPAPAPSGVSRRGATRLALPSEQLLDPLPNGARNT
FT                   VQMDLDAERRGDMINETLRQFGLQAKVVDLARGPTVTRYEIEPAPGEKISRIASLSNDL
FT                   ARALAVGGVRVEAPVPGKSVIGLEVPNAEREPVTFHQATANPAFKNTRAKLPIILGKSI
FT                   DGSMMVGDLAKMPHLLVAGSTGSGKSVCVNTLITSLLYRYLPTELRFVMIDPKMVELTP
FT                   YDGIPHLVRPVVTNPADAAGVLLGAVAHMERRYKMMSQVGAKNLEQFNAKMRAVGEVEL
FT                   PHLVIIIDELADLMITSPKEVESAIMRLAQMARATGMHLILATQRPSVDILTSLIKVNI
FT                   PARIAFAVSSSHDSRTILDTTGAERLTGMGDMLFYQPGLVKPLRLQGPYISEAESARIT
FT                   DELRRMMFDDDFIEAYGADFEGMISSSGPGGDRSQLDFSDPLLRQAALVCIEEGQGSVS
FT                   RLQRRLSVGHARAGKLMDLLEAMNIVGPHQGSKPREVLIHEADLPEYFGK"
FT   gene            complement(404533..405204)
FT                   /locus_tag="DR_0401"
FT   CDS_pept        complement(404533..405204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09984"
FT                   /db_xref="GOA:Q9RXB4"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB4"
FT                   /protein_id="AAF09984.1"
FT                   /translation="MSANSHQDQPPRARIDGEVVGLLLLVVAFLLGLVLLLPFLGHQGG
FT                   ALVGARRALLDWAGWLAWLLPVAALAYGVATFINASLRELTRWVLGGLLAVFAVLCLQA
FT                   FFLPGQPGHPSTAGLLADGLAGKLRPVLGPATPLLLLFAALIGLKIMLGVSLLGVTRRL
FT                   VHGLIGLLTGVGHNVQGAIEARLPGNGTVVAHNRTDVRGQLSELRGHLDAYGASTPKTS
FT                   G"
FT   gene            405291..405701
FT                   /locus_tag="DR_0402"
FT   CDS_pept        405291..405701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:Q10645 PID:1340100 GB:AL123456 percent
FT                   identity: 49.61; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09981"
FT                   /db_xref="GOA:Q9RXB3"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB3"
FT                   /protein_id="AAF09981.1"
FT                   /translation="MLLTLPAPLRRALWAQVRRELPRECVGALGGWVRGEQVQAHALYP
FT                   LPNVAADPEREYLADPGDLLRVVRAMQREGLDLVALYHSHPHGPAAPSASDRRLAAYPV
FT                   PYLIADPAAEVLRAYLLPGGEEVEVRSADESN"
FT   gene            complement(405795..406739)
FT                   /locus_tag="DR_0403"
FT   CDS_pept        complement(405795..406739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0403"
FT                   /product="inosine-uridine preferring nucleoside hydrolase"
FT                   /note="similar to SP:Q27546 PID:1151248 percent identity:
FT                   59.28; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09982"
FT                   /db_xref="GOA:Q9RXB2"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB2"
FT                   /protein_id="AAF09982.1"
FT                   /translation="MVSSLPVLLDGDPGLDDAVAWLLAFASPETQVLGVTAVHGNVPLQ
FT                   QGVRNTGVVLALAGERAAGVPYFAGADRPLLREGMTATQVHGATGLPAAHLPEPVRGPE
FT                   AEHAVDFIIRTVRANPGQITLVASGPLTNVALAFRLAPDLPGLLREVVWMGGSTAQGNR
FT                   TPAAEFNALADPHAAHIVLHSPVPVRMVGLNVTMQCIATPERLEQLRALGNRAGAVSAE
FT                   MLEFYAGVYRERYGLSGGALHDPLAVAAALSPELLTWQAMNVEVELSEGLNVGRTVCDL
FT                   YGVTDREKNVQVAVGVDDAAFFKLLLERLGTLP"
FT   gene            406761..407105
FT                   /locus_tag="DR_0404"
FT   CDS_pept        406761..407105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09985"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB1"
FT                   /protein_id="AAF09985.1"
FT                   /translation="MSAGEHSAAPRSPQTAAMNMQAVQAAFDAAYTKDPRDGLTITHTT
FT                   EDGKLCIEVRHVNVEGDVHGFDVVAQPTEAEGKTAEEVGRDMAEVVERELAYAQLPAQD
FT                   ENGDFRRIVV"
FT   gene            complement(407319..410051)
FT                   /locus_tag="DR_0405"
FT   CDS_pept        complement(407319..410051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0405"
FT                   /product="alpha-dextran endo-1,6-alpha-glucosidase"
FT                   /note="similar to PID:2304776 PID:634093 percent identity:
FT                   63.45; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09983"
FT                   /db_xref="GOA:Q9RXB0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB0"
FT                   /protein_id="AAF09983.1"
FT                   /translation="MKTDWKKLGFIVHKGDDKDPGPDGTLTREQGNQLWIVSGNPTPST
FT                   TRPDTRVRTVGDLKQQQAIMLSRDLIVVKPALAQPGAWLTLHVSPTATLKLGADGVSGG
FT                   DTLALEEVEGGLTPALQAKAPYLAGYKLLQIRAADRAKLPTALSGQLAVSSVLPGGKVL
FT                   DATGVQTAWALDDLYAYAGPLGVTWQGNKPTVRLWAPTAQDVKLHVSRPDGTQERTLPM
FT                   TRDTQGVWTASGDQSWKGLAYRFEVRVFAPSTGNIETNLVTDPYSVALTRNSTHSVFAD
FT                   LSDNSQKPAGWNALKKPALRSFADLSFYELHLRDFSAADASVPAAERGTYLAFTRPGSD
FT                   GMTHLRALAGAGLKAVHLLPTFDIATINEDKGQWQTPGDLTQFGPNSEEQQKAVNAVKD
FT                   ADAYNWGYDPYHSMVPEGSYAVNPAERTKEYRQMVMSLNAAGLRVVQDVVFNHTAASGQ
FT                   AERSVLDKIVPGYYHRLNVNGGVENSTCCSNTATEHTMMRRLMVDTLVLMAREYKVDGF
FT                   RFDLMGHHMVADMQAARRALDALTPAKDGVDGKQIYLYGEGWDFGEVQGNRRGANATQL
FT                   NLYGAGIGTFNDRVRDALRGGSPFGGLQEQGVATGLATVPNGQAGNDSAEKWGQLADLV
FT                   KLGLAGNLRDYRFTDHSGKPVTGGQLRYGDAPAGYAASPRETINYASAHDNQTLWDAVL
FT                   LKTPANMNSAARVRFQNLAHSYLLLGQGLPFVPAGDELLRSKSFDTDSYNSGDWFNALD
FT                   WTGHTNGFGKGLPPAEKNEANWALYRTLLGDAALKVTPADITRASDHFRELLRVRSSSS
FT                   LFRLDTAAQVQQSLSFLPAPTGVIAMKLSGGVSATNPYRDLLVIFNGSADAVTLNDASA
FT                   SGMKLHPVLAASSDPIVRTSKVSGTQASVPALTTAVFVR"
FT   gene            410748..411389
FT                   /locus_tag="DR_0406"
FT   CDS_pept        410748..411389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0406"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to SP:P19844 PID:45849 percent identity:
FT                   56.31; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09986"
FT                   /db_xref="GOA:Q9RXA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA9"
FT                   /protein_id="AAF09986.1"
FT                   /translation="MAAPAPDFALQLAHVARKFGAQFVLRDVTLDLRPGEVAALFGGNG
FT                   AGKTTLLRVVAGLLSASRGEGRVFGYDLKDKRSVREHVFFMTEGGGLYGDLTATENLDF
FT                   TARMYGLTAPSAELLERVGLGAAANKRARDLSSGMRKRLQLARMLLAPSPLLLLDEPFA
FT                   NLDAGGKDAVLTHLRAAQDAGKTILFSSHEPELAGQVATRTLTLEQGVLG"
FT   gene            411386..412051
FT                   /locus_tag="DR_0407"
FT   CDS_pept        411386..412051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0407"
FT                   /product="cytochrome c-type biogenesis protein, heme
FT                   exporter protein B"
FT                   /note="similar to GP:2865530 percent identity: 56.48;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09987"
FT                   /db_xref="GOA:Q9RXA8"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA8"
FT                   /protein_id="AAF09987.1"
FT                   /translation="MRAALSVFLKDLRLEGRSKDVLSTTLFFAGLVVLIMGFAFGPDTA
FT                   KMRDAAAGVLWCALAFASVLAANRAWAGEQESGALESLLLYPVAHEWLYLGKAAANALL
FT                   MLILGVVTAALTAIFFDVHFASLGLLALTLALGVLGLSLVTTFYSAITVNLRAKEALLP
FT                   VLSFPIIIPVMIGAVKSTVLLSGGFNPDDYWAWTRLLLGFDVVTLLVATFAFPHAVES"
FT   gene            complement(412061..412561)
FT                   /locus_tag="DR_0408"
FT   CDS_pept        complement(412061..412561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0408"
FT                   /product="response regulator"
FT                   /note="similar to GB:AE000666 percent identity: 65.00;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09988"
FT                   /db_xref="GOA:Q9RXA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA7"
FT                   /protein_id="AAF09988.1"
FT                   /translation="MSNMNAQQQLRHYGTPEQPGILPIQFLLVEDSEPDVLLTQEVFEE
FT                   EGLAGQLHVVRDGVEALDFLLRKPPYEQVPRPDVILLDINMPRMNGLELLTKLKTDPHL
FT                   MTIPVFMLTTSQAEEDVLRSYQAHAASYVVKPIEFTEFQRAVQAMSRFMRSMALPGGRH
FT                   HQL"
FT   gene            412718..413137
FT                   /locus_tag="DR_0409"
FT   CDS_pept        412718..413137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0409"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09997"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA6"
FT                   /protein_id="AAF09997.1"
FT                   /translation="MNLLQASLTGGAAFREVDALLGDLTYDEARHPAVPHTLAELIAHL
FT                   RVTTRASLDLVTGQAQEWPDDLDVWPAPPATEAEFDALLTDLRLMLAEASALARDPSSR
FT                   ARDVLTDLAVHNAYHWGQVALLRRQAGTEFEEVFE"
FT   gene            413118..413501
FT                   /locus_tag="DR_0410"
FT   CDS_pept        413118..413501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0410"
FT                   /product="inorganic pyrophosphatase-related protein"
FT                   /note="similar to GB:AE000511 SP:P56153 PID:2313741 percent
FT                   identity: 71.43; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09989"
FT                   /db_xref="GOA:Q9RXA5"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA5"
FT                   /protein_id="AAF09989.1"
FT                   /translation="MKKCLNKPDLTPYLGQRVRVVVDRPLGSVHPRHPDLIYPVNYGEI
FT                   PGTLSGDGHPIDADLFGWEEPTEGGRRRSDCRRAGRGRRRRQAKLVVAREGTCWTDEAI
FT                   WQAAEFQERLFRTRLLRSDTLPT"
FT   gene            413498..414181
FT                   /locus_tag="DR_0411"
FT   CDS_pept        413498..414181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0411"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to GB:AL123456 percent identity: 52.14;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09990"
FT                   /db_xref="GOA:Q9RXA4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA4"
FT                   /protein_id="AAF09990.1"
FT                   /translation="MTRPVTLITGASGGIGSALARQLAPTHDLILTGRGGAELDALCAE
FT                   VGATPLTLDLIRPEAFAAALAGVGRVTNVVHNAGVVELGRVAEQGHEVWTHTLAVNTVA
FT                   PAELTRLLLPRVREERGTVLFVNSGAGLRANPEWGSYAASKFALKALADALRDEEAPHG
FT                   VRVSTVYPGRTATPMQQKVREQEGANYDPAAFIDPATVAATIAFILQAPRDAQLPDVSV
FT                   RPGPR"
FT   gene            414190..415164
FT                   /locus_tag="DR_0412"
FT   CDS_pept        414190..415164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0412"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase,
FT                   class II"
FT                   /note="similar to GB:AE000666 percent identity: 45.97;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09991"
FT                   /db_xref="GOA:Q9RXA3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA3"
FT                   /protein_id="AAF09991.1"
FT                   /translation="MAGAMDMGAYEYDAVIVGAGPAGLNAALVLGGARRRVLLLDGGPP
FT                   RNVTAQAAHGVFTRDGTPPADLKTVGLEQLAPYDVTVLGTPAREIRPEDDGTFSVRYEQ
FT                   RWVRARRLLFATGVRDVLPRIPGLRERWGRTVHHCPYCDGWPNRAARLAVLGSHQEGHH
FT                   LALSVRSWSDHISLLTNGPDELTPAQRRDLRELDIERCDRPIRHFSGRDTVRVTFEDGE
FT                   VREYDAIFLNPAQVQRSRLPELLGCELDEKSRVIVNENGMTSRRGVWAAGDMTGAPQYV
FT                   MSAAASGMVAAVSLNSTLIHEDVRRGGAAFHPSPDEEKGVGEA"
FT   gene            415136..415366
FT                   /locus_tag="DR_0413"
FT   CDS_pept        415136..415366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09998"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA2"
FT                   /protein_id="AAF09998.1"
FT                   /translation="MKKREWEKPERACHTAGMKIDERMDLQELATQMGSEDTAEAARLR
FT                   DLLLGTGRERTEDFSGEEWAELLIRAGEQNK"
FT   gene            415529..415996
FT                   /locus_tag="DR_0414"
FT   CDS_pept        415529..415996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0414"
FT                   /product="hydrolase, CbbY/CbbZ/GpH/YieH family"
FT                   /note="similar to GB:AL123456 percent identity: 49.66;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09992"
FT                   /db_xref="GOA:Q9RXA1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA1"
FT                   /protein_id="AAF09992.1"
FT                   /translation="MMPLLVEELGLSCFAADLLTHYDTALDHAQAMPHAAEVLTELRRR
FT                   GVNIGVVTNGWEDAQTRCLAGCDLSDLADDVVISEAVGLSKPDPCIYHLALKRLGVTTA
FT                   HSWFVGDSPRNDVWGPQQVGMRAAYLPTGHPLNGERPDVTLTDLRDVLNLP"
FT   gene            complement(416044..417564)
FT                   /locus_tag="DR_0415"
FT   CDS_pept        complement(416044..417564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0415"
FT                   /product="carboxylesterase, putative"
FT                   /note="similar to GP:2641986 percent identity: 52.63;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09993"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA0"
FT                   /protein_id="AAF09993.1"
FT                   /translation="MKRWLAWTALTLGGLAQAAAPQLRVEQGTLNGKAVNSVQQFLGVP
FT                   FAAPPVGPLRWQPPQPPVWSGQRDATQFGPACAQGDGGSEDCLTLNIYRPPNAKNAPLL
FT                   VWVHGGFFTGGDASLFDGSALARERGVVVATVNYRLGLYGFLAVPGVTDGNAGLYDILG
FT                   AVRWLKQNAASIGADPGNITLAGQSAGAAAICTLLAAPSAAGLFQKAILQSGSCAAPIF
FT                   QTPLGDARRKGELFSRALRCDRGETATCLRGKSRAELDGVRLTGRGPVDPVPLPPVYGD
FT                   ALIPLRPQDAFAQGQSLKVAVMLGINREEGQIFEPYLPDLLRGSRTLYRAGLTLINPLQ
FT                   AWALGGRYPLRSDEQPIRAVTRLLTDQVFACPTSWLAGKLGAGLPTYFYEFSDPRPPLQ
FT                   LAGKVNVPNLGAYHGAELAYVLDTPVVGVSDPAQFSSAQAKLAAQMGEYWTNFARSGQP
FT                   ASLGLTVWPTFNPAFPQVMTLEPGATALKPNFDGRHQCDYWNGAEGRR"
FT   gene            417705..417947
FT                   /locus_tag="DR_0416"
FT   CDS_pept        417705..417947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0416"
FT                   /product="ppGpp-regulated growth inhibitor suppressor
FT                   ChpR/MazE, putative"
FT                   /note="similar to GB:D16450 SP:P18534 PID:416196 PID:506193
FT                   PID:882677 percent identity: 63.29; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09994"
FT                   /db_xref="GOA:Q9RX99"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX99"
FT                   /protein_id="AAF09994.1"
FT                   /translation="MTSQIQKWGNSLALRIPKALAQQVGLTQSSEVELLLQDGQIVIRP
FT                   VPARQYDLAALLAEMTPENLHGETDWGALEGREEW"
FT   gene            417941..418294
FT                   /locus_tag="DR_0417"
FT   CDS_pept        417941..418294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0417"
FT                   /product="ppGpp-regulated growth inhibitor ChpA/MazF,
FT                   putative"
FT                   /note="similar to GB:D16450 SP:P33645 PID:416197 PID:506194
FT                   PID:882676 percent identity: 62.50; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09995"
FT                   /db_xref="GOA:Q9RX98"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX98"
FT                   /protein_id="AAF09995.1"
FT                   /translation="MVSDYVPDAGHLVWLNFTPQAGHEQGGRRPALVLSPAAYNGVTGL
FT                   MQACPVTSRAKGYPFEVTLPAHLGVSGVVLADHCRSLDWRSRRAEQLAEAPADVLAEVR
FT                   GKLGSLLGMSEKA"
FT   gene            418314..418571
FT                   /locus_tag="DR_0418"
FT   CDS_pept        418314..418571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0418"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09999"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX97"
FT                   /protein_id="AAF09999.1"
FT                   /translation="MSDAEGGYTFPMTTLEARIENGKVVLTPEQAAELGLREGEVLPVT
FT                   IAPHEAETEGNPFTRWIGTLPPLPDGEESARFYRRLRDGE"
FT   gene            418568..418981
FT                   /locus_tag="DR_0419"
FT   CDS_pept        418568..418981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0419"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10000"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX96"
FT                   /protein_id="AAF10000.1"
FT                   /translation="MTESTVLDANILSALLRSEANPLSIARQLSALAREGSLVVYAELL
FT                   AGPEVTPDFLKGFLQEVDVQILPPSGLAVWESAGLAYGSYAQRRQRSGGGSPRQILSDF
FT                   VIGAHALYHGAALFTADPQHYRLSFPALTVLTP"
FT   gene            418978..421446
FT                   /locus_tag="DR_0420"
FT   CDS_pept        418978..421446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0420"
FT                   /product="ATP-dependent helicase"
FT                   /note="similar to SP:P37024 PID:473807 PID:473806 GB:U00096
FT                   PID:1488196 percent identity: 62.89; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09996"
FT                   /db_xref="GOA:Q9RX95"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX95"
FT                   /protein_id="AAF09996.1"
FT                   /translation="MTLPIQTVVPEVKAALAQHPLVVLQAPPGAGKSTALPLDLLHEEW
FT                   LAGQSIIMLQPRRVAARAVAARLAEGLGEAVGETVGSRVRFESRVSDRTRLEVVTEGIL
FT                   TRRLQRDPELSGVGLVILDEFHERSLNADLALALLREVQGALRDDLRVLVMSATLDPDL
FT                   PARLGAPLVESAGRAYPVDVRYLPTDPTGRVEDAVVAAVRRALDTDEGDILAFLPGVRE
FT                   IRGAAAQLAGVDAAVLPLYGDLPLAEQRRALMPDPGGRRKVVLATSIAETSLTIQGVRV
FT                   VVDGGQSRRQQFDPATGLTRMVTGRVTQDAATQRAGRAGRTAPGVCYRLWSERTQALLP
FT                   AAQPPELLMADLAPLTLELAGWGTTDPADLPWLDAPPPTRIDTARTLLRSLDALDDAGR
FT                   ITPAGTRLLDFPTHPRLAHLLSEADDAALAADVAALLEERDPLPPGSGADLSERVDALR
FT                   GWRAGGRTRGEVAVLERVERLSKQWRRLLKVQPDNAPPDPYALGELLALAYPERVALAR
FT                   ESVAGLHKGRFLLAGGQGAALPEGDALAGARALAVAHLNMTGAEGRIFLAAPLNPAWLA
FT                   ARATWQDAVRWDARTGTLLAQQELRLGALALDTRPLREVPADLKVKAIADAVRAEGLHL
FT                   LTFSPAASAFRARVQSLREWRGEEWPDLSDAALLATLEDWLGSGLERVRTRDDLARLDL
FT                   LPALQSLLPWNLTRELDELAPTHLSVPSGSRVRLEYRPGEAPILAVKLQELFGLADTPT
FT                   VNGGRTPVLLHLLSPAGRPVQVTQDLRSFWNSSYFEVRKDLRGRYPKHPWPDDPWTHEP
FT                   TRWTKRRAEK"
FT   gene            complement(421627..421935)
FT                   /locus_tag="DR_0421"
FT   CDS_pept        complement(421627..421935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0421"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10010"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX94"
FT                   /protein_id="AAF10010.1"
FT                   /translation="MSDALEFMFQGPLRRRKSAESALRVRSGMATQDNKHHNGTDKNEN
FT                   AGQGDGHQQIGNQQQPNGGAPYRDDSTEPHTPGGPGNEPNQGQGNKANEHDKGNDSK"
FT   gene            complement(422007..422783)
FT                   /locus_tag="DR_0422"
FT   CDS_pept        complement(422007..422783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:U00096 PID:1787798 percent identity:
FT                   55.02; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10001"
FT                   /db_xref="GOA:Q9RX93"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX93"
FT                   /protein_id="AAF10001.1"
FT                   /translation="MTWNPDQYHQFKDARSAPARDLQALIPERPYAQVVDLGCGTGEQT
FT                   AQLAQRFPQATVLGLDSSAAMLAKAGAQQLPNLRFEQGDIQELSGSFDLLYSNAALQWL
FT                   PDHPRLLARLWEHLRPGGVLAVQVPANHDHASHRLLTATANEFETELGGFTRFGTAHGA
FT                   SPVLTPAAYAELLDGLGAVDITALSKVYPVVLPGAEGLIEWTKGTALVPYLSRLDGADA
FT                   ARFLDVYRGKLQAEFPGERVYYAFTRVLFVATRPEL"
FT   gene            complement(423080..423706)
FT                   /locus_tag="DR_0423"
FT   CDS_pept        complement(423080..423706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10011"
FT                   /db_xref="GOA:Q9RX92"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX92"
FT                   /protein_id="AAF10011.1"
FT                   /translation="MKLSDVQKRLQAPFPAHTVSWKPAAFNAERTRALLLAHVDARAVQ
FT                   DRLDAVCPDDWSFEMEVVSGAEVPTVKGRLTVLGVTREDIGEAPEGSMAAYKAAASDAM
FT                   KRCAVQFGIGRYLYDLPKQWADWDDARRGPKHLPELPEWARPDHERTPGGAHLVQAMEQ
FT                   LRYELPEDLDLQREVYKHLKAALGSIHPVPTGPVPTNPVQGGRAA"
FT   gene            423757..424491
FT                   /locus_tag="DR_0424"
FT   CDS_pept        423757..424491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0424"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /note="similar to SP:P48054 PID:1001734 PID:1001734 percent
FT                   identity: 63.50; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10002"
FT                   /db_xref="GOA:Q9RX91"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX91"
FT                   /protein_id="AAF10002.1"
FT                   /translation="MIKGKWRGVRGGPCLLCRPAFGRVGPGSGALTRARPSRAALHRRL
FT                   YLRPMPRTAAVTRTTKETDITVRLDLDAAPYEQPATGHGFFDHMLDALARHSRLGISIS
FT                   GTGDLHIEPHHLIEDTGITLGQALSQALGDRKGIERYGSAFVPMDETLAHVVLDLSGRA
FT                   HLAFEPETLDVYGDAGGMTHYHLREFLRGFCNHAGATLHVRLLAGREAHHVIEAVMKAF
FT                   ARALRDAVAVTSDALPSTKGSL"
FT   gene            424532..425365
FT                   /locus_tag="DR_0425"
FT   CDS_pept        424532..425365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10012"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX90"
FT                   /protein_id="AAF10012.1"
FT                   /translation="MQRMLPLLALLSFASAQAQVSGPSETRVPRAAETDAIIRAVCSGK
FT                   ADLGRLSGCKQTVYEGRLSSEIRSPRTMLLLSSVLSGSFTAPGQKELLATFCTETESCS
FT                   GETVLLRQMRGQWQPVSLVPGFLPFNCLTYPKRNGTQAAVCMGENAKNEPIGDALKIAS
FT                   WTGGKLKVETVALFPLLQFRDFFGTGSQQCAGRWQYEAFGWNDRDRNADRVPDLTVLAS
FT                   VTTYQPTPELCKMGQGFDAQSSASARRDLTFVWTGETLRPTGTTAATLEKYSRGR"
FT   gene            425362..426009
FT                   /locus_tag="DR_0426"
FT   CDS_pept        425362..426009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0426"
FT                   /product="amidotransferase HisH"
FT                   /note="similar to GB:AE000666 percent identity: 61.34;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10003"
FT                   /db_xref="GOA:Q9RX89"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX89"
FT                   /protein_id="AAF10003.1"
FT                   /translation="MSTTPVRAAPEVLLLDYGAGNVRSAARALERAGMTVRVTDNAADV
FT                   PHAPALVVPGQGHFRQVMEAFEHGGFHGPVLDAARAGVPLLGICVGMQLLFDGSEEAPG
FT                   VPGLGLIAGQVRKFAPAPERKVPQMGWNALEARGDSPLLRGLGPDAYAYFVHSYYVPVD
FT                   VPVTDGAVTDYGVPFWSALSRGNLHAAQFHPEKSGAVGLALLANFRRELAPA"
FT   gene            426085..426846
FT                   /locus_tag="DR_0427"
FT   CDS_pept        426085..426846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0427"
FT                   /product="general stress protein Ctc, putative"
FT                   /note="similar to GB:D26185 SP:P14194 GB:X16518 PID:40219
FT                   PID:467441 percent identity: 56.69; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10004"
FT                   /db_xref="GOA:Q9RX88"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="PDB:1NJM"
FT                   /db_xref="PDB:1NJP"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4R"
FT                   /db_xref="PDB:4V4S"
FT                   /db_xref="PDB:4V4T"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX88"
FT                   /protein_id="AAF10004.1"
FT                   /translation="MAHTGQTAKSQGDTATMELTAKPRTPKQKLDESMIAAVAYNKENN
FT                   VSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTY
FT                   GEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHI
FT                   TAGDIKLPEGCTLAADPELTVVSVLPPRLTAEELEAEVQAAQVAGLVAAGELSEEAAEA
FT                   VLEGDASLEEVKAEASEDNAGTDSEDNSDAQ"
FT   gene            426965..427384
FT                   /locus_tag="DR_0428"
FT   CDS_pept        426965..427384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 62.50;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10005"
FT                   /db_xref="GOA:Q9RX87"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX87"
FT                   /protein_id="AAF10005.1"
FT                   /translation="MRARPYPTSTYFVSTADGRLPAMSQPIAAPFRQQLLDLVARIPPG
FT                   RVMTYGQLALLAGQPGAARQAGAVMHSLKDSDLPWQRVINAQGRVSTYKVGLGEVQEGL
FT                   LRAEGIEFDDAGRCDLSRYQWWPDENAANIAQRLL"
FT   gene            427430..428185
FT                   /locus_tag="DR_0429"
FT   CDS_pept        427430..428185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0429"
FT                   /product="cytochrome-related protein"
FT                   /note="similar to PID:575386 PID:1653257 percent identity:
FT                   51.95; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10006"
FT                   /db_xref="GOA:Q9RX86"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX86"
FT                   /protein_id="AAF10006.1"
FT                   /translation="MKMSQNRWTAGNALSWALGVTLGLIVGIALLIAIPRLMSTPTTSA
FT                   ESPEPPAAVAQTDDSSGAATTTEQPGATDPTGMASGQTSGSPDQSAAGAMGNESQTAGT
FT                   QNTGSQGSESDSMDNNTASSTAEQTGGQVAGAGNGEDPTQRSSGAAPTPANTPSDNAPA
FT                   PSESAGVANAGKEVFAGNCAACHGAEGQGAVGPSLQPTVEWDDTQFTAALREGKAPDRE
FT                   LNTIMPRFTEAQLSAQQVADVHAYIKTLY"
FT   gene            428408..429820
FT                   /locus_tag="DR_0430"
FT   CDS_pept        428408..429820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0430"
FT                   /product="rtcB protein"
FT                   /note="similar to SP:P46850 PID:606356 GB:U00096
FT                   PID:2367224 percent identity: 54.01; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10007"
FT                   /db_xref="GOA:Q9RX85"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX85"
FT                   /protein_id="AAF10007.1"
FT                   /translation="MNGKHITKLGFEGKAVGLALSAAGLREDAGVSRGDILDELRSVQN
FT                   YPEQYQGGGVYADLATHLIEQQAAQQTRQSAKLRAAPLPYRTWGEDLIEPGAHRQMDVA
FT                   MQLPISRAGALMPDAHVGYGLPIGGVLATENAVIPYGVGVDIGCSMMLSVFPVAATGLS
FT                   VDEARSLLLKHTRFGAGVGFEKRDRLDHPVLAEATWDEQPLLRHLFDKAAGQIGSSGSG
FT                   NHFVEFGTFTLAQADPQLEGLDPGEYLAVLSHSGSRGFGAQVAGHFTNLAQRLWPALDK
FT                   EAQKLAWLPLDSEAGQAYWQAMNLAGRYALANHEQIHARLARALGEKPLLRAQNSHNLA
FT                   WKQQVNGQELIVHRKGATPAEAGQLGLIPGSMADPGYLVRGRGNPEALASASHGAGRQL
FT                   GRKAAERSLAKKDVQAYLKDRGVTLIGGGIDEAPQAYKRIEDVIARQRDLVDVLGEFRP
FT                   RVVRMDTGSEDV"
FT   gene            complement(429873..430592)
FT                   /locus_tag="DR_0431"
FT   CDS_pept        complement(429873..430592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1001216 PID:1001276 percent identity:
FT                   57.84; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10008"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX84"
FT                   /protein_id="AAF10008.1"
FT                   /translation="MRITTLEELLEALDELFDDGSDLTRRGAQDPWERVFSQPGHPLAS
FT                   DLPDACLVDWTRQGLLPSGDGLTALDLGCGLGRNARWLARQGYAVTGLDLSPYAVGQAR
FT                   ERTPGPDIRYLEGDVLRDPIPGGPFDVVYDSGCFHHLPPHRRLSYLHTLGQVLRPGGWF
FT                   GLCTFAWGRMGSAKSDLELLRQGQLEGGVGYTLDDLREMFGGLDFVTGSLLSELEPASE
FT                   PVFQMDFLQAALFRRPE"
FT   gene            430655..431299
FT                   /locus_tag="DR_0432"
FT   CDS_pept        430655..431299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0432"
FT                   /product="DNA-binding response regulator"
FT                   /note="similar to GP:1498492 percent identity: 64.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10009"
FT                   /db_xref="GOA:Q9RX83"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX83"
FT                   /protein_id="AAF10009.1"
FT                   /translation="MIRVLLADDHALFRQGLRSLLESEGMRVIGEAANGREAVRYAADT
FT                   QPDVILMDIQMPELDGVKATQSILEINPQARVIMITMYRQDRYVFEAVKAGARGYILKD
FT                   ADAGTLIDAITRVAAGEALLDADMAQNVLDDFRDKREELPSEKHADLNERETMILKLLA
FT                   QGFSNQDIALRLDISEKTVRNRLSEIFTKLQLNNRTQAALYAIREGIANLE"
FT   gene            431543..432376
FT                   /locus_tag="DR_0433"
FT   CDS_pept        431543..432376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0433"
FT                   /product="beta-lactamase, putative"
FT                   /note="similar to GP:1928922 percent identity: 45.18;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10013"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX82"
FT                   /protein_id="AAF10013.1"
FT                   /translation="MMPDFLAELRRAGYAGEVGLLVTDFAGRELYAQAADAVFPAASTI
FT                   KVPLLLFALEQAGRGDLDLIERVTLRAEDRVPGAGVLHELGLGLALTWQDVLTLMIVVS
FT                   DNTATNLLIERLGQDHFNLWLTARGLNSTRLIGPLQLPPERQNEAQRRGERNRTTARDQ
FT                   VALLLSLLRGDGLTPQMQHLALDILSRQHLRDLIGRGVPAGPDGEPLYRVASKSGELRG
FT                   VHHDVGLLWAPRPLVVALLSQGGEDPREHPGNRDVTRLSAALWPLLAELGETETP"
FT   gene            432479..433486
FT                   /locus_tag="DR_0434"
FT   CDS_pept        432479..433486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0434"
FT                   /product="cytochrome C6, putative"
FT                   /note="similar to SP:P00117 percent identity: 51.56;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10014"
FT                   /db_xref="GOA:Q9RX81"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX81"
FT                   /protein_id="AAF10014.1"
FT                   /translation="MPLGARLARAMLAFRLQAGGKKQRNSAESSGQELRPLHEGEGKVE
FT                   RNDAVMPGVAIFCAAVMWIVLLFLFNKETAPKPVVVDPAVAASISKDYPTIGKQIFTQG
FT                   ASGGPACQGCHGANGEGGVGPKLAGDAKILKDPVYVHTILVNGKGGMPAYGDKLDDKQL
FT                   YAVANYVLHSWGNNIEEPLTPAKVAEGQSKVDPAVLKNRSRFVPEDLKLPEIWLTTFII
FT                   VLLTYGIIGLYSHWAEGEELRPGIHKVRSTPVAMLGMVLSLLSTLLFSVLFIRQMNIDY
FT                   AGWAAKEQVMPDVTHEGFYAAMIVLSLAASLALYKKFFMDGEVLVEDASGEFPW"
FT   gene            433679..434185
FT                   /locus_tag="DR_0435"
FT   CDS_pept        433679..434185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0435"
FT                   /product="cytochrome complex iron-sulfur subunit, putative"
FT                   /note="similar to GP:2695699 percent identity: 51.26;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10015"
FT                   /db_xref="GOA:Q9RX80"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX80"
FT                   /protein_id="AAF10015.1"
FT                   /translation="MKGDILVHAEGPNSGQPVTVADLSDKITRAWPQGKDPKTGDMVTR
FT                   NGDPTSILAIYKFPKGQMEEPTKLDATIDGEIVAYGDRCQHAGCNVEDGQNGIMNCPCH
FT                   SGQYDPKRGCKVVGGPPPAPLPQLPIKLDGDKLVADGFFMTRPYGYNSDEDWETYTKKV
FT                   EELLS"
FT   gene            434182..435519
FT                   /locus_tag="DR_0436"
FT   CDS_pept        434182..435519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0436"
FT                   /product="cytochrome B6"
FT                   /note="similar to SP:P28056 PID:38963 percent identity:
FT                   54.09; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10016"
FT                   /db_xref="GOA:Q9RX79"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX79"
FT                   /protein_id="AAF10016.1"
FT                   /translation="MNQWLDERLHLSRLNDKFLRKAFPVHHSFFLGEITLFSLIILILT
FT                   GILLALSYEPSNSLIVNSFDPGTAAKANMVPAAYHSALKINAMPFGDMLRRIHHWSANI
FT                   MVAAAIIHMMRIYFTGAFKKPREINWWIGLLLLIFSALTAVTGYILPYDNYAYQTLGVI
FT                   YGITKSVPWVGDWLAQAAFAGNFPGEQVIPRIYGYHIMLLPMILVATTGAHMLIMIKQK
FT                   HTQPQYAKRIAYKKIVGVPLITQQTPIMLLLTLIFAGLVILFAAFIPVHPVEYFGPPSS
FT                   TPISNIKPDWYLLWIFGALAIIPGFEVSFLGGHITAEFVGALLFPIIPIGLLFLVPLLD
FT                   KSEENVYYAENPTNHPVRLGAGVAFLVFMLVMSLAGYKPELIASGLLTSGNANAILWIM
FT                   ALLLPAVAYFLTLAIVRGIRSLREADERDRLAHGGHGGVTPGHSHD"
FT   gene            435588..435806
FT                   /locus_tag="DR_0437"
FT   CDS_pept        435588..435806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10023"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX78"
FT                   /protein_id="AAF10023.1"
FT                   /translation="MEQAYSDPVDHFTLELAREAKRLELTAGGEDNDPERLLAFATFVL
FT                   SELAARGLIPDERPAIGCWAAPRSTGN"
FT   gene            435905..436201
FT                   /locus_tag="DR_0438"
FT   CDS_pept        435905..436201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0438"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX77"
FT                   /protein_id="AAF10024.1"
FT                   /translation="MHVLAAAAGGVPDLGAELPGEPDHKLNGVLVALLDQVSQVLGQTV
FT                   GQGHGAELVAVFAAELLEPLGVRVRRGLARDGRLRHGLNLTQAHSRNVSQKAV"
FT   gene            436299..436718
FT                   /locus_tag="DR_0439"
FT   CDS_pept        436299..436718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0439"
FT                   /product="HesB/YadR/YfhF family protein"
FT                   /note="similar to GB:AL009126 percent identity: 68.87;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10017"
FT                   /db_xref="GOA:Q9RX76"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX76"
FT                   /protein_id="AAF10017.1"
FT                   /translation="MTAIHTPERQDTPRVPDITISEFGASKAQTILAGSGKENAGVRVF
FT                   IKSGGCSGYQYGMAIDDRELEGDTIVVDRGVKLLVDRMSIELLRGSEVDFVENMMGGGF
FT                   TVHNPNATSSCGCGHSFRTDGAQSPDGEGSGGCGG"
FT   gene            436818..437357
FT                   /locus_tag="DR_0440"
FT   CDS_pept        436818..437357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0440"
FT                   /product="Holliday junction resolvase"
FT                   /note="similar to GB:D10165 SP:P24239 PID:216653 PID:42175
FT                   GB:U00096 percent identity: 58.33; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10018"
FT                   /db_xref="GOA:Q9RX75"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX75"
FT                   /protein_id="AAF10018.1"
FT                   /translation="MRVLGIDPGLANLGLGLVEGDVRRAKHLYHVCLTTESAWLMPRRL
FT                   QYLHEELTRLLTEYRPDAVAIEDQILRRQADVAFKVGQAFGVVQLACAQAGVPIHAYGP
FT                   MQVKKSLVGTGRADKEQVIYMVKASLGIRELFNNHAADALALALTHLAHAPMQERSERL
FT                   AAAGRAARTGDAPLRR"
FT   gene            437368..437868
FT                   /locus_tag="DR_0441"
FT   CDS_pept        437368..437868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:Pyro_h percent identity: 54.07;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10019"
FT                   /db_xref="GOA:Q9RX74"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX74"
FT                   /protein_id="AAF10019.1"
FT                   /translation="MLLSLLGSIVITLGWLWFFVRRDRHPEPLWLLARTFAWGMFAWFV
FT                   AASFEASLGRMLSSSAPLTLLLVALLTAVIEEVSKFLATSTAADEPSFDEPMDGLVYAV
FT                   TAALGFALVENLTYALTFGAGTATGHALLATLGHALFSAPQATRSGGTGRASGAGGGGE
FT                   GWR"
FT   gene            complement(438093..439172)
FT                   /locus_tag="DR_0442"
FT   CDS_pept        complement(438093..439172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0442"
FT                   /product="twitching motility protein"
FT                   /note="similar to GB:AE000657 percent identity: 69.83;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10020"
FT                   /db_xref="GOA:Q9RX73"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX73"
FT                   /protein_id="AAF10020.1"
FT                   /translation="MSVLNQLLAALVKEGASDIHLRAGTAPAARINGVIRRFGESRLSP
FT                   QHLQQFTQEMLPSTALWESFNARREADFAYGLAGVGRFRVNAYFQRGSIGLIMRVIEDK
FT                   PIPTFEELGLPTAVFNELAEQERGLVLVTGPTGSGKTTTLASLIDYINSHQPVNIVTLE
FT                   DPIEVLHRDKMAMVNQRELGLDTLSFSNGLRAAMRQDPDIILIGEMRDKETVEAALSAA
FT                   QTGHLVLSTLHTQDAIRSVNRIIDFFAPHERTQIRQGLSESMVGIVSQRLLPRSGGGRV
FT                   MGMEVMLGTPTVRECIKDPERTEEIKQALMEGGMRGMRTFDQHLVQLVLDGQMTQEDAM
FT                   SAATSPHELKLMLMKSQYA"
FT   gene            complement(439386..440822)
FT                   /locus_tag="DR_0443"
FT   CDS_pept        complement(439386..440822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0443"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /note="similar to SP:P77836 PID:1620901 PID:1638805 percent
FT                   identity: 69.97; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10021"
FT                   /db_xref="GOA:Q9RX72"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX72"
FT                   /protein_id="AAF10021.1"
FT                   /translation="MAVTIPIRTVRWSVNGQGEGVIGRPLSVMPVLWHTRAMTHTAPLS
FT                   PPLAVPDLIAKKRDGGAHTHAELEALVLGFTRGEVPDYQLSAWLMAVFLRGMTPQETAD
FT                   LTLVMAASGEQLDLGALPDTVDKHSTGGVGDKTSLVLTPMLAALGLTVAKMSGRGLAHT
FT                   GGTIDKLESIPGWTPELPEDRFLAQARDIGLALVGQSKDLAPADGKLYALRDVTATVPC
FT                   LPLIASSIMSKKLASGARTIVLDVKVGAGAFMTTPEAGRELAQAMVDIGTRAGRRVRAV
FT                   LTEMDTPLGHLAGNSLEVQEALATLRGAGPSDLTDLCVALAVEALVAHGEDAGQAEARA
FT                   RQTLHDGSALAKFRAFVAAQGGDPSYVDDPERLDVAPGRAEMLAAQSGFVTRVDALSVG
FT                   RAVLALGGGRERKGEAIDHGVGVELLKKPGEAVGAGEAVLRLYHRGGRGLERAQALLRA
FT                   GLETGPQAPAAAPLILGHIG"
FT   gene            440797..441984
FT                   /locus_tag="DR_0444"
FT   CDS_pept        440797..441984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0444"
FT                   /product="lipopolysaccharide biosynthesis protein,
FT                   putative"
FT                   /note="similar to PID:1001414 PID:1001478 percent identity:
FT                   51.61; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10022"
FT                   /db_xref="GOA:Q9RX71"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX71"
FT                   /protein_id="AAF10022.1"
FT                   /translation="MRIGIVTATYLPSRNGVATSTALFVQGLRERGHEVRVFAPRHPQA
FT                   SGDAEPGVYRLNASFAGAQALGAPADYPVMLAPGPLLSARLPLRGVDVWHTMHPFLAGQ
FT                   LALRWGRLSHAPVVYTAHTQYDEYIHYAPLPSKVSRAMIHPHVSALARRMDAVLAPGRA
FT                   MVDMLRRYGYGGEIELLPNPVKLASFLGVSGDAFRAEFGIPQDAPLVVYLGRLAPEKNL
FT                   DTMLAAFAQARTRRPELRMLVVGDGPGREDAEAGAPEGVTFTGAVPYVRVPEALAAADA
FT                   FLTASTSEVLPMSMIEALAAGAPLVAAHSPAALDLIAEGHNGTVREPTPEALATGLLQV
FT                   LAPATLPRMQHEARESARQYDLPVRAQALEEVYERVIAARRGKGAPSRFFRSASR"
FT   gene            442103..442678
FT                   /locus_tag="DR_0445"
FT   CDS_pept        442103..442678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10034"
FT                   /db_xref="InterPro:IPR018728"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX70"
FT                   /protein_id="AAF10034.1"
FT                   /translation="MVEKALARFATELDLDGVDVVLMSSTFTLPETGVHGYAPNAHQVD
FT                   LSVTPGSPAFQRLWLTEVPATLAHELHHVRRWRGPGYGKTLLEALVSEGLAQHFEAGYR
FT                   GESPIYAQPTMDLAALWERAQPQLSAPHDHAAWFFGSPAQDFPRWGGYALGYELVRRFF
FT                   AAQGGDAVSHANTPASAFEGAWWVSCLT"
FT   gene            complement(442679..442990)
FT                   /locus_tag="DR_0446"
FT   CDS_pept        complement(442679..442990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 56.41;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10025"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX69"
FT                   /protein_id="AAF10025.1"
FT                   /translation="MITVMNRIGVKPEFAAQFEESFRNRAGLVDGMPGFIRNEVLKPTK
FT                   PGDPYIVLTYWQDEPSFRAWTESDEFKQGHARSGSLPHDAFTGRPVLEVHDVLLSSDN"
FT   gene            complement(443030..443614)
FT                   /locus_tag="DR_0447"
FT   CDS_pept        complement(443030..443614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0447"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="similar to PID:882414 PID:1754506 percent identity:
FT                   62.70; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10026"
FT                   /db_xref="GOA:Q9RX68"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX68"
FT                   /protein_id="AAF10026.1"
FT                   /translation="MSQTDVLDLYKQAGAFHEGRFLLASGRQSPYFMQSTTLLQHPRAL
FT                   MELGGLMSQKILDAGLKPDFIVGPAMGGVTLAYEVARQLSETLPDVRAIFAEKDGSGGM
FT                   KLREAFAVRPGETFVAVEDVLTTGGSLLRAVRAVEGQGGQCIGLCCIIDRRQQTGPLSG
FT                   YPLMSLKELYFDTYASHEVPGWLAERPLQEI"
FT   gene            443662..443871
FT                   /locus_tag="DR_0448"
FT   CDS_pept        443662..443871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0448"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10035"
FT                   /db_xref="GOA:Q9RX67"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX67"
FT                   /protein_id="AAF10035.1"
FT                   /translation="MDTPRRPADPAPHATRVRRRLLGIPLTELAQAAQVTPELLAAIER
FT                   GEASPENLHLYGRQTLSKLLDLDL"
FT   gene            443926..444657
FT                   /locus_tag="DR_0449"
FT   CDS_pept        443926..444657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10036"
FT                   /db_xref="GOA:Q9RX66"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX66"
FT                   /protein_id="AAF10036.1"
FT                   /translation="MNHAFVDASWQEQPDGRGLGGWGLVLLTPGKLPARHQGQLDAPDN
FT                   NAAELRAVLEAVRAAPAGEALTVHTDNQTVIACVARGRGPFLLSELTQEVQAEAGQRGV
FT                   ALRAVYAPRTRRHMLTAHDLANDARKGSTTPGQLLPHADVLIEQRPALPEARVSLRRSG
FT                   ERVSALVPLDPLSETPPSAQALLAAVTLAQPGERLLVRRASKIAQALWQRPERALLPAA
FT                   HARLAQARAQAEASGVEVEFL"
FT   gene            444716..445561
FT                   /locus_tag="DR_0450"
FT   CDS_pept        444716..445561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:2792327 percent identity: 45.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10027"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX65"
FT                   /protein_id="AAF10027.1"
FT                   /translation="MTSSSTPAPRATLLVIFAHPDDEAFSVGGTLTHYARQGVRVVLAC
FT                   ATRGEAGKITVPGMTVDDLGAQREQELREACRALEIEPPVFLDYHDSGRYERTRHDDPT
FT                   ALMNVNPLDAEVKLRALIEDVQPQVIVTFDPHGAYGHVDHLQMHRATVAAFFSTGHLPS
FT                   GGPQRLYYTAMTHQAAAQISRLGHDQSLDPLVYGVSDSTLAVTMDVGAYAENKKAALAA
FT                   HGTQMGETSLMGRLSPDERAALEERMLGKESFSIGGTRTAIREYPLRGLFDGVGVEGLV
FT                   "
FT   gene            complement(445936..447285)
FT                   /locus_tag="DR_0451"
FT   CDS_pept        complement(445936..447285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0451"
FT                   /product="glutamine synthase"
FT                   /note="similar to SP:P10656 PID:144818 percent identity:
FT                   73.52; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10028"
FT                   /db_xref="GOA:Q9RX64"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX64"
FT                   /protein_id="AAF10028.1"
FT                   /translation="MTSVSPTPDGILRQLQDAEVSFLRLQFTDILGHTKNVEVPRTQFA
FT                   KALSGDVTFDGSAVQGFTRVEESDMLLSPDLSTFLVYPQFARDDRERGRVARLICDVTL
FT                   PDGTPFEGDPRRVLRAQVERAQALGLEMYVGTEPEFFLFERGPNGAATTVTHDRAGYFD
FT                   LAPIDRGERIRREIASRLVEMGFEIEASHHEVAPGQHEIDFRYAPALETADRIATFKFV
FT                   VKRIALEHGLLASFLPKPIAGVSGSGMHCHLSLFKDGQNVFDDPGGEHGLSDTAHQFVA
FT                   GLLDHAEGMTAITNPLVNSYKRLVPGFEAPVNIAWSTSNRSALVRIPAKRGPSTRAELR
FT                   MPDPSCNPYLALAAMLAAGLDGIERQLEPPPAIQRNIFRMTVREKRHHRVKELPGDLRE
FT                   AVDELAKDEVIAAALGEHVMEHYVTAKRAEWREYSSAVHAWELERYLDLV"
FT   gene            complement(447362..447760)
FT                   /locus_tag="DR_0452"
FT   CDS_pept        complement(447362..447760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10037"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX63"
FT                   /protein_id="AAF10037.1"
FT                   /translation="MMNVFAHPPAGLQQAPHEIRMLAAGHQVSVREVVLTGVRDKEALM
FT                   LAFLSGLGLTHSFGRNWDALYDVLTDPEQRPPRFALVLCDYDVFRRRNRQLSAQLESAL
FT                   LDAQQNVGEQGRMLWLLAEEPDSDTRHW"
FT   gene            complement(447757..448332)
FT                   /locus_tag="DR_0453"
FT   CDS_pept        complement(447757..448332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0453"
FT                   /product="guanyl-specific ribonuclease SA"
FT                   /note="similar to SP:P30289 percent identity: 60.51;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10029"
FT                   /db_xref="GOA:Q9RX62"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX62"
FT                   /protein_id="AAF10029.1"
FT                   /translation="MTLPTMPQDPSASFHLPQAALPTLRRMTSPLRMPLLLLAVFLPSC
FT                   SAQSGQTQTGQTQTGQPRTQSSASVSSIPATPPASRPSASRRPARDPLSGLAFVNVAQL
FT                   PPEGQQLLTLIARGGPFRYSKDGVTFGNREGILPQQARGYYREYTVRTPGESDRGARRV
FT                   VCGGQPVTNTAECYYTADHYASFRRIRP"
FT   gene            complement(448361..449185)
FT                   /locus_tag="DR_0454"
FT   CDS_pept        complement(448361..449185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0454"
FT                   /product="bacitracin resistance protein"
FT                   /note="similar to PID:882579 GB:U00096 PID:1789437 percent
FT                   identity: 65.92; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10030"
FT                   /db_xref="GOA:Q9RX61"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX61"
FT                   /protein_id="AAF10030.1"
FT                   /translation="MDWLYSLIYGIVEGITEFLPISSTGHLILTGNLLHVPWPKEVKDT
FT                   FEVVIQGGAILAVLVYYWRDFLKIRHIGHDRGQQRLWLGVVLACIPAVILGVLFGDTIK
FT                   AYLFRPSVVAWALIVGGVLMWLLESRKATPDTHDIENISAGKALAIGAAQCLALLWPGF
FT                   SRSASSILGGMLLGLDRPTATKFSFYLGVPTLGGAALLDFIKSREILAQIGVVNVAIGA
FT                   VTSFVVAYFAIGWLLRFVSTNNFKGFAVYRVVVGVLILVLIARGVLQNGSLA"
FT   gene            449222..450073
FT                   /locus_tag="DR_0455"
FT   CDS_pept        449222..450073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0455"
FT                   /product="streptomycin 3-kinase"
FT                   /note="similar to SP:P13082 percent identity: 67.79;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10031"
FT                   /db_xref="GOA:Q9RX60"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX60"
FT                   /protein_id="AAF10031.1"
FT                   /translation="MEGTLWPVLPFTPWLTRWHLTPDGEPLRTHGSDLLPVLWHGQGEG
FT                   QAAMLKLARSEEERRGAGLMQFWQGDGAARVLAVSEDGAALLLERVSGCRSLTALVHAG
FT                   HDDEATRLLCAAAARLHRPRPGPLPPLLPLADWFRGLFAGEKQDTRLHFPAAVARQLLA
FT                   SPQEVGPLHGDLHHANVLDGGDPGQGGRGWLAIDPKGLHGERGYDHANLLCNPDPATAL
FT                   RPGRLERQLAVAAHAARLDPARLARWVMAYTGLSAAWWLEDGREAEAAQMLALGERARR
FT                   LF"
FT   gene            450152..450844
FT                   /locus_tag="DR_0456"
FT   CDS_pept        450152..450844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0456"
FT                   /product="biopolymer transport protein, putative"
FT                   /note="similar to GB:AE000666 percent identity: 51.48;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10032"
FT                   /db_xref="GOA:Q9RX59"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX59"
FT                   /protein_id="AAF10032.1"
FT                   /translation="MNVLDLARAAGPLLWVLLALSLYVVYLTVARLLALMRMGQDASAL
FT                   IERARALTAESGPQAALREVDLSGLDIPAAQVLRAGLNRADRGPEAAQAAMNAALIQED
FT                   GRMYAGLSALGTAAQIAPLLGLLGTVVGMVRSFLVFSATNNPTPTELAQGISEALINTA
FT                   AGLIVAIVAYVARNALRNKANAVAAQAERVREELPSWLLRPVAVPAAPVRPAPAPERPV
FT                   MAPTGARL"
FT   gene            450847..451269
FT                   /locus_tag="DR_0457"
FT   CDS_pept        450847..451269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0457"
FT                   /product="biopolymer transport protein, putative"
FT                   /note="similar to PID:1652034 percent identity: 61.54;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10033"
FT                   /db_xref="GOA:Q9RX58"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX58"
FT                   /protein_id="AAF10033.1"
FT                   /translation="MSVPRRRLRDDVEGVTFDFAPMVDIVLLLLIFFFLTSNLGARQNV
FT                   LPLDLPRASTTVQATPDIPIVTVHKTGRIYLNGYATNLEQLEQKLPALVKKSGGVVGVR
FT                   ADERGNYGTVVQVMDAVKKAGGERLALGTRNADSDK"
FT   gene            451333..453852
FT                   /locus_tag="DR_0458"
FT   CDS_pept        451333..453852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10038"
FT                   /db_xref="GOA:Q9RX57"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX57"
FT                   /protein_id="AAF10038.1"
FT                   /translation="MTSYSRPSRFDLQRPEVRERLWSAAATFTLHAALIAGLALARPQP
FT                   QASVAAVPDTRHAPLEVVALAPEVPNSNAAAPLSTSPLAASPNKPAPATKPTPTPAKPA
FT                   TPAPEPPKPPEPTPPEPKPETPPEPPKPAPEPPKPDPTPAEPLKPPVQDTPPPVTPKPV
FT                   TPEPVTPKPAPTPPEVLQPPVAQTPPVAKPPVPAPTSQTPTPPVQPAPTRTPPPQAARP
FT                   TPNAPAQTPAPATQAPAAQTPTAQAPATQTPATPAPAAQRPAGGAPSPAPAPAQANAPA
FT                   GSVVPEATVPESSTPAAPSAQTPPTPTRETAQTEASPAAPNSSAAAPNEPASEPVAGRP
FT                   GTAASSPESASPVTVTPRGETPDTAASAGTPSAGRVTPAPAPSASEGASAARTPGAGSQ
FT                   TPPIPATPIPATPAGRSSGESAGTAAARPNAAPAPVSEDRSDVSGLPRREDAPAESSPV
FT                   AASPARGASSAPSSAPAAAVPSRAPVSGGSVSAPRTAPTAPVAEQGEVPVSPSAAAPRG
FT                   GASSAAAPSAPAAARGGSGAAGGAAGGASAPAAARPAQTPGASAGGASGGGEGVSARPS
FT                   QGGTPSGTPASAPVAAGRPAGGEGSGSGTSGSGSGAPAAARPGQGGSGDAPVDLGLTSG
FT                   RGGSGAGNGGAGTGETGAGTPSASRPGSGGTGNGSGTGEGSGTVPASGRGTGGSGTGTG
FT                   NGGGAGEGAGVGAVARGGGGAGQGAGNETRPLTCTVVVDVRGLGKLESAMTSFVMDSAG
FT                   NQVWPDAELIKGVATQLVQEGNLQEYTRSEAGLAQLKNVTRVKASRLLRPKQSPGAPYF
FT                   ADVELSADAAQTFRSAGKACKVVYLRD"
FT   gene            453926..454636
FT                   /locus_tag="DR_0459"
FT   CDS_pept        453926..454636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10043"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX56"
FT                   /protein_id="AAF10043.1"
FT                   /translation="MRLLDFRKPLLLSLTALLSAPAFAWVPKLDDATAKNVIDGAYGRR
FT                   DLPSTYLTVDLGVKDGQFVSGPESVKVFDGGAQCVTDWLAAPGDFSKGSRLGSVTASGQ
FT                   ADQLYFQATDARDNFRNLSAADALGADLSKARLADGELRVDIAVRGLPSEKARDAYLVR
FT                   MRSADGKLVAPVRRSYVNDFKQGEDGKWSGTLVYYFKPLDAGVGASDRVDLLVRTEADT
FT                   NCAYNVALNLASFQ"
FT   gene            complement(454915..456843)
FT                   /locus_tag="DR_0460"
FT   CDS_pept        complement(454915..456843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0460"
FT                   /product="acetyl-CoA synthase"
FT                   /note="similar to PID:1001216 PID:1001254 percent identity:
FT                   62.90; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10039"
FT                   /db_xref="GOA:Q9RX55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX55"
FT                   /protein_id="AAF10039.1"
FT                   /translation="MDPALLTTPLVSPTDALKKTAPVTPERAQQLRDMPAGDYWLSVAS
FT                   ELTWDVPPTTALEGTFGDFQYFPGAKGNVSVNCLDRHPKNRVALYYEREDGLKETWSYG
FT                   DLTDATARFAAALQDLGVDKGDRVAIYLSNVPEAFIAIHACYRIGAIYSVIFAGFSASA
FT                   VRDRLTDAQPKVVVCTDGTLRRGRNIPLKATLDEALEGLEKPTVIVARRLDPFLPLGEN
FT                   ELDFAELLEKTTRRAAPVSLDANDPGFIIYTSGTTSKPKGLVHSGIGFLTGTYANVKWA
FT                   LNLQPDDVYWCTADVGWLTFPIFALVGGLAHGATHVIYEGSIDTPTPERPYQIIERYRA
FT                   DKVFTAPTALRMLRRSGDEALARYDLSPLQLVALVGEPLDPETWHWTHDVLGGGRLFVN
FT                   NTYGQTETGTAWASSMVGLTEGRPGSCGHPLPGYRAAVVHEDGTPCGPNELGSLTLTEP
FT                   FPCLARTVWGDHDRYVETYLSEFPGKYAAADAALLDSDGQLWVTGRLDDVMNVAGHRLG
FT                   TMEMEAALLTHPAVSEAAVVAMPDDIKGAVPVAFVVPRAGIRLDTDLTWLENELADAVV
FT                   SGVGAIARPGRVVVTPTVPRTRSGKIMRRLLRDLLLTGEVKGDLTSLENPDALETVRER
FT                   LGGAAAG"
FT   gene            456979..457767
FT                   /locus_tag="DR_0461"
FT   CDS_pept        456979..457767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 57.14;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10040"
FT                   /db_xref="GOA:Q9RX54"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX54"
FT                   /protein_id="AAF10040.1"
FT                   /translation="MPAFPLLAVDIGNTTTVLGLADASGALTHTWRIRTNREMLPDDLA
FT                   LQLHGLFTLAGAPIPRAAVLSSVAPPVGENYALALKRHFMIDAFAVSAENLPDVTVELD
FT                   TPGSVGADRLCNLFGAEKYLGGLDYAVVVDFGTSTNFDVVGRGRRFLGGILATGAQVSA
FT                   DALFARAAKLPRITLQAPETAIGKNTVHALQSGLVFGYAEMVDGLLRRIRAELPGEAVA
FT                   VATGGFSRTVQGICQEIDYYDETLTLRGLVELWASRSEVR"
FT   gene            457740..458669
FT                   /locus_tag="DR_0462"
FT   CDS_pept        457740..458669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0462"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10044"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX53"
FT                   /protein_id="AAF10044.1"
FT                   /translation="MGEPFGGPLMGRLVSLLPSATDLIFELGLGEQLLGVSHCCDHPGA
FT                   ASLPVLTRSIIGSDLPQAEIDRAVSEAVRAGRALYTVDGPLLDRLRPDLVVTQGVCEVC
FT                   AVTPGTVAEAVRFLPGCLPAEQVLSLEGKTFAGILADLRALARAAGVRERGEALAAESE
FT                   RRWNAIRPVGVQVPEPPRVLTLEWVDPPFYGGHWVPEQVAQAGGKDVLGHAGRDSGRTS
FT                   WEDVVQLDPDVIVVMCCGYGLSDNAEFARQVLSHPELRAVRAGQVWGVDANAHFSRPSL
FT                   GVVRGAEVLAALLRGEESAGESVRVRAE"
FT   gene            complement(458743..461679)
FT                   /locus_tag="DR_0463"
FT   CDS_pept        complement(458743..461679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0463"
FT                   /product="maltooligosyltrehalose synthase"
FT                   /note="similar to PID:1040696 percent identity: 58.07;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10041"
FT                   /db_xref="GOA:Q9RX52"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX52"
FT                   /protein_id="AAF10041.1"
FT                   /translation="MRGYRLALLHPKGPPMTTPPPTETPLHTPPVTLPTSTYRLQLHAG
FT                   FPFAAARRQLPYLARLGVSTVYLSPIWASTPGSTHGYDVTDHARINPELGGLAGLRRFS
FT                   AAAKELGLSVIVDFVPNHMGIQGGHNPYWEDVLRHGQGSRYAHFFDISWHPLKRALEGK
FT                   VLLPTLGDQYGRVLERGELQLTWEEEGEAGRFFLRYWDRRLPMSPRSVALLLGWVVDAL
FT                   GSRVPGEAQAELGSITRSIQTLPRSSDPDLSDVDRLSRAQEVEVGARRLFALRHRAPGV
FT                   RQAMDDVLASVNADPQRLDQLVSEQNYRLAWWQVAAEEINYRRFFDINDLAALRMEDPR
FT                   VFAWAHTLLFELLREDLIQGVRLDHTDGLYDPAGYFRALQAGAGEVLGRPVDENGQGQP
FT                   IMQTPLYVVAEKILEPGEELPGDWAVHGTTGYDFLAELNGVFVDTAHEDDLSALYRRFT
FT                   GDRDSYPEHLYRGKQLIQRVSLPGEVNVLAEHLEGLAEADLTSRDFTLSAIRGAIREVI
FT                   ACFPVYRTYVRENGERESGDNAKIEQAVREAKAHNRREGQPVPPSVFDYLQQVLTISVP
FT                   GEGEQAEATRAAYADFALKFQQLTGPVTAKGAEDTAFYRYARLLSLNEVGGDPAHFGTP
FT                   LRDFHAAAARRAQSWPHAMLSGSTHDTKRGEDTRARINVLSEIPQVWGDFLREQSSLML
FT                   SLLHETDLGLAPTTRDLYVLLQNALGAYPLDGKLDGFVDRLNAYLQKAAREAKLRTSWA
FT                   SPDEEYEAALADVVGQLFADPEFNLGLEALHRRISPYGAQNGLSAALVRLTAPGVPDTY
FT                   QGCEGWNQSLVDPDNRRPVDYARLGRVLTRLERGHDLALARKLLGSYEDGAVKVMTTWA
FT                   ALQARKEHADLFGQGSYRPIDAGKYLIAFARELNGQSAITVAPRLTLSLTREQSPWALA
FT                   ERWGNRTLTLPTGSYTNVLTGEKLRVRTAKVPLAKVLEEFPLALLVRG"
FT   gene            complement(461814..463616)
FT                   /locus_tag="DR_0464"
FT   CDS_pept        complement(461814..463616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0464"
FT                   /product="maltooligosyltrehalose trehalohydrolase,
FT                   putative"
FT                   /note="similar to PID:1040697 percent identity: 56.74;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10042"
FT                   /db_xref="GOA:Q9RX51"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="PDB:2BHU"
FT                   /db_xref="PDB:2BHY"
FT                   /db_xref="PDB:2BHZ"
FT                   /db_xref="PDB:2BXY"
FT                   /db_xref="PDB:2BXZ"
FT                   /db_xref="PDB:2BY0"
FT                   /db_xref="PDB:2BY1"
FT                   /db_xref="PDB:2BY2"
FT                   /db_xref="PDB:2BY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX51"
FT                   /protein_id="AAF10042.1"
FT                   /translation="MTQTQPVTPTPPASFQTQHDPRTRLGATPLPGGAGTRFRLWTSTA
FT                   RTVAVRVNGTEHVMTSLGGGIYELELPVGPGARYLFVLDGVPTPDPYARFLPDGVHGEA
FT                   EVVDFGTFDWTDADWHGIKLADCVFYEVHVGTFTPEGTYRAAAEKLPYLKELGVTAIQV
FT                   MPLAAFDGQRGWGYDGAAFYAPYAPYGRPEDLMALVDAAHRLGLGVFLDVVYNHFGPSG
FT                   NYLSSYAPSYFTDRFSSAWGMGLDYAEPHMRRYVTGNARMWLRDYHFDGLRLDATPYMT
FT                   DDSETHILTELAQEIHELGGTHLLLAEDHRNLPDLVTVNHLDGIWTDDFHHETRVTLTG
FT                   EQEGYYAGYRGGAEALAYTIRRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNH
FT                   DQIGNRPLGERLHQSDGVTLHEYRGAAALLLPMTPLLFQGQEWAASTPFQFFSDHAGEL
FT                   GQAVSEGRKKEFGGFSGFSGEDVPDPQAEQTFLNSKLNWAEREGGEHARTLRLYRDLLR
FT                   LRREDPVLHNRQRENLTTGHDGDVLWVRTVTGAGERVLLWNLGQDTRAVAEVKLPFTVP
FT                   RRLLLHTEGREDLTLGAGEAVLVG"
FT   gene            complement(464102..464686)
FT                   /locus_tag="DR_0465"
FT   CDS_pept        complement(464102..464686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 50.31;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10045"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX50"
FT                   /protein_id="AAF10045.1"
FT                   /translation="MSLMTHKFLPLLLGPVLLLASCGGGPSTPSAPSAGGSTSATSNAP
FT                   RSAHDSGDQSRSTEEQSVFEQLNATRAQGRSCGGKYMPAAPAVTWNGYLAAAAEGHAND
FT                   MADKGYFAHTSPSGATMKQRAEQAGYSGWQELGENIAAGYTVRDVIQGWLDSPSHCETL
FT                   MDPALKEVGMSYLYKPGSKFGTYWVQDFGTR"
FT   gene            complement(465081..467498)
FT                   /locus_tag="DR_0466"
FT   CDS_pept        complement(465081..467498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0466"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="similar to PID:1001414 PID:1001455 percent identity:
FT                   61.20; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10046"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX49"
FT                   /protein_id="AAF10046.1"
FT                   /translation="MTLCSGRPRPPGRDEAPTSMPSSVPNLDQLLQQAGLSTEVPPSLG
FT                   EWQNLLWRVRAALDRGRDAAQATGWAQHLLDKLSLPVLVLDRQGTVIHASEACGALGWS
FT                   HDLRGRPLAELLSSPLEDLRLSNLLKRVWQGERLHQVPLSLRHTEGRLQLAEASLLPLH
FT                   AASGESTAAYVAMSITTTELHGQSDDNARTDRQYFYESLLAALPASLAVLGPDQRYRFC
FT                   NPAAIGNPQIREWIMGHTDAEYVAERGFPPELATERGRHMDEAARERKTVQFEERMLRP
FT                   DGEPVYQLRNYTPLFDENGELLLYLGHGVDVTELRRTQEALRELNAQLEERVEARTAEL
FT                   EALSRQLQHDALHDSLTGLPNRALFSDRLSQAIARSKLPGGPQYAVLFLDVDRFKGIND
FT                   TLGHPTGDAMLVEMARRLRACLRATDTVARLGGDEFTILLEPLQSTEQAAQVAARIQDA
FT                   LRRPMQMPAAGPGGLPGGWHQVTMSASLGIVHSQPDYDSAMAVLRDADIAMYRAKDGGR
FT                   AKYRVFTPEMREHILHVNRMEHELRRALAADELRVRYQPVLDLDRGRIEGFEALVRWQH
FT                   PERGLLGPDDFTPIAEESGLLPDIDRWVLARACRELVQWQRLYPHDPPLHLSVNFCSQH
FT                   LAAPDVHERVKELLQRTGFDPGRLNLEITESSLLSQTGDVQRNMERLRQLGVRLHLDDF
FT                   GTGYSSLSYLQLYPIDVLKIDRSFVQGMLDNDSNAELVRTIVAMAKNLNLKVVAEGIED
FT                   PRQLAALRGLGCDAGQGFLFSPALDVHAARTLVAEGQHHRRPGWRYDDLPPA"
FT   gene            complement(467498..469216)
FT                   /locus_tag="DR_0467"
FT   CDS_pept        complement(467498..469216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 54.32;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10047"
FT                   /db_xref="GOA:Q9RX48"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="PDB:2W9M"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX48"
FT                   /protein_id="AAF10047.1"
FT                   /translation="MTLPPDAPSRHRLVHALERTADLLDILGGEDFKSRAYRSAARSLE
FT                   ELNEETPELLAREFTGIPKVGKGIAAELSDFARSGTFAPLEAAAGQLPPGLLDLLGVRG
FT                   LGPKKIRSLWLAGIDSLERLREAAESGELAGLKGFGAKSAATILENVVFLFEARQRQSL
FT                   RAGLAVAEELAGALTDLSPAPAGDVRRGLETVRAAELTVTGTPDDVLARLPELTVQGDG
FT                   VLSGDYEGVPVEIACAPAEARGALDLLRSGEHFAGQVQAAAQARGFTLTAGGLSRGDEV
FT                   LPTPTEAVVFHALDLPFRPAEYREPEHDDLWQTLPDPAELVTVGDLRGMIHTHSTWSDG
FT                   GASIREMAEATLTLGHEFLGTADHSRAAYYANGLTIERLREQLKEIRELQRAGLPIVAG
FT                   SEVDILDDGSLDFPDDVLGELDYVVVSVHSNFTLDAARQTERLIRAVSHPLVTVLGHAT
FT                   GRLLLRRPGYALDLDAVLGACEANGTVVEINANAARLDLDWREALRWRERLKFAINTDA
FT                   HVPGGLRDARYGVMQARKAGLTPAHVVNSLGRAEFLDFVARQRAARGAPGPADRA"
FT   gene            complement(469213..469884)
FT                   /locus_tag="DR_0468"
FT   CDS_pept        complement(469213..469884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0468"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10054"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:3M33"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX47"
FT                   /protein_id="AAF10054.1"
FT                   /translation="MNHSRESYDRLARELGGYRHPWARVLSGPDPELTFDLWLSRLLTP
FT                   QTRVLEAGCGHGPDAARFGPQAARWAAYDFSPELLKLARANAPHADVYEWNGKGELPAG
FT                   LGAPFGLIVSRRGPTSVILRLPELAAPDAHFLYVGPRLNVPEVPERLAAVGWDIVAEDH
FT                   VSVLAHAPTWEDWQMRGEFMGKLARRADWDAEATVRGMPYREERHLVLARQLGVARKLG
FT                   A"
FT   gene            complement(469881..470441)
FT                   /locus_tag="DR_0469"
FT   CDS_pept        complement(469881..470441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1651963 percent identity: 56.00;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10048"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX46"
FT                   /protein_id="AAF10048.1"
FT                   /translation="MTGPAFKAMSVEEYLRSEENSPVKHEYVAGFIYPLHAQAGVSRTH
FT                   SAISVNIVATLHPHARKQGCRLHLADMRLRIEERNTFYYPDVMLVCDTDTGSDLAETAP
FT                   CLLVEILSPSTAQIDRVGKWAMYTALPSLQSYLIVHQDERRVVEYRREGTEWQMREVVQ
FT                   DGELWIDCLEMSLSLEDIFGGVL"
FT   gene            complement(470438..471220)
FT                   /locus_tag="DR_0470"
FT   CDS_pept        complement(470438..471220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0470"
FT                   /product="histidinol phosphatase, putative"
FT                   /note="similar to GB:AL009126 percent identity: 56.36;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10049"
FT                   /db_xref="GOA:Q9RX45"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX45"
FT                   /protein_id="AAF10049.1"
FT                   /translation="MTGLCDSHLHTPLCGHATGTPREYAQAALDAGLSGLCFTDHMPMP
FT                   RWYDAPWRMKLEQLPEYIAEIQAVQQEFAGRLDVRLGLEADFHPGTEKFVEKVLGMFDW
FT                   DYVIGSVHYLGAWGFDNPEFVAEYEERDLGGLYRDYYALVEGAARSGLFDAIGHLDLPK
FT                   KFGHLDPDPVYALHALDVVAGQGLALDFNTAGWRKPVAEAYPAPDLVRAAAERGIPFVL
FT                   GSDAHQPGEVGFRFADAVKEIRDVGGRTVTFRHRKMQP"
FT   gene            471240..472010
FT                   /locus_tag="DR_0471"
FT   CDS_pept        471240..472010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 67.69;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10050"
FT                   /db_xref="GOA:Q9RX44"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX44"
FT                   /protein_id="AAF10050.1"
FT                   /translation="MPPCVPAPRSAPCGMDNGIPHYQLEHMTEDAWRMFRILGEFSIGF
FT                   DRMAHLSVPLVTVYGSARTALTDRYYGLAQTLGRELVGAGFGVVTGGGPGIMQAANQGA
FT                   YEAGGVSVGLNIVLPHEQRHNPYQTLSLEFEYFHARKVMLARYAHAFVAFPGGFGTLDE
FT                   MMEILTLVQTRKMRPVPIYFVGEAHWRGLVEWFRTSLVENGAIAADDLKLFKLVDDVSQ
FT                   IPADVRAYHDPGAGDGFKRPTAEDTEKAQGEQPT"
FT   gene            472040..473263
FT                   /locus_tag="DR_0472"
FT   CDS_pept        472040..473263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0472"
FT                   /product="tetracycline-efflux transporter"
FT                   /note="similar to SP:P02982 percent identity: 62.82;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10051"
FT                   /db_xref="GOA:Q9RX43"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX43"
FT                   /protein_id="AAF10051.1"
FT                   /translation="MGQMPRRPPALLFILLTALIDVMGIGLIIPVLPGLVKELAGSEAG
FT                   GARFIGVLTAAYAAMQFIFAPILGTLSDRFGRRPVLLLSLAGMVLDYLLLFFSPNLWWL
FT                   LVGRLIAGVTGASLTVANAYIADVTAPEDRAKNFGRLGATWGVGFILGPMLGGWLGEHG
FT                   LRAPFLFAAGLTALNFLYGLLVLPESLPPEKRGAAGGGTLNPFTPLRALTEYPLLRGLT
FT                   LTFVLLGLAGQVIVSTWVLYTEGVLRWSPLQNGIAFAVYGLLTAGVQAGLISPFIARFG
FT                   ERRTIMTGLVASTLEFVVLSVARSAPVLYLSLVVGALGGLAQPAMQGLISRQVGEQEQG
FT                   RVMGAITSLNSLVGVFGPLLATSVFAAGQGAGFPGAAFVLGAVLSILGTVLILSVLRGI
FT                   PGTGRAMK"
FT   gene            complement(473316..474002)
FT                   /locus_tag="DR_0473"
FT   CDS_pept        complement(473316..474002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0473"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to GB:AL009126 percent identity: 66.51;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10052"
FT                   /db_xref="GOA:Q9RX42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX42"
FT                   /protein_id="AAF10052.1"
FT                   /translation="MTGAGDLQLQTVDLSRIYPSGEGQVVALRPFTHTFPAGLTAVVGP
FT                   SGSGKSTLLNLLAGFDQPSSGHVQVGDTVLTTLSEAQRADFRLANYGFVFQNHNLVSIL
FT                   TAQENVEFPLTLSGVPPRERRDRARALLAQVGLEQRAGHLPHQLSGGEAQRVSLARALV
FT                   RDPAIVLADEPTGNLDSHSGQRVLELLTAPARPGRTVVLITHDRDIAALAEHRLEVHDG
FT                   EVTVLS"
FT   gene            complement(473999..475159)
FT                   /locus_tag="DR_0474"
FT   CDS_pept        complement(473999..475159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000666 percent identity: 53.19;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10053"
FT                   /db_xref="GOA:Q9RX41"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX41"
FT                   /protein_id="AAF10053.1"
FT                   /translation="MKTADLWQLAWRGLTRRRVRTALTTLGITVAVASMVVFLSLGEGI
FT                   RKVFAEQLSGIGPDIQVSLTGLTQGMSLTPNVPQSLTGDLEKLAPELGIKTVTPVMMTV
FT                   RGGFDPSQSVILYSLPPAQGIGAVFPTVQGAQGRLLRPGDEQANVAVVGAKASQNLHLG
FT                   LGSTLNLNRRASVKVVGVLKGDTGLADNMIFLPLEVQQKAEGVPGRVSMIAVKLKDPTQ
FT                   AKATAKVIAERLNVEAQTQADFLSFMEKTMRISDAVRFGISLIALIVGGLAVANTVMMG
FT                   VFERTREFGTLRALGARPSFVRSLVLTESLLLSLLGGVGGVLLGLLGIAAVNAYTQQLA
FT                   DISAAALTPRLTLLALAISLLLGLLSGLLPARNAGRIAITDALGRV"
FT   gene            complement(475346..477295)
FT                   /locus_tag="DR_0475"
FT   CDS_pept        complement(475346..477295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0475"
FT                   /product="ABC transporter, ATP-binding protein, EF-3
FT                   family"
FT                   /note="similar to GB:AL009126 percent identity: 54.39;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10056"
FT                   /db_xref="GOA:Q9RX40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX40"
FT                   /protein_id="AAF10056.1"
FT                   /translation="MGRRGNRHESPPGKKRRGGQAAKAPRARRRNCVDFLRLDFSLHKF
FT                   NGPGVRTSFPLPEQRVGYAAADSGLPGALAFAHSKDFLSCASDPVLTVDAACRLLRAAG
FT                   LTLLGENMLRAREVARRYGDQTIFAGVTLDLAAGERLALIGENGSGKSTLLRVLAGLDA
FT                   PDAGHVTRTGRVSLLTQHTDLGAGHVLNAVTPPELRGARTAFEQATERLSEGSDAALTA
FT                   FADAEERYRLAGGYDFGARANGVLAGLHLDAGADAGQLSGGQLRRVMLARLLLSPADLY
FT                   LLDEPTNHLDADGAAWLEGWILAAAAAGAAFILASHDRAFLDAVATHTAELERGALTVY
FT                   PGNYSAAMELKATLREAQQRDYAAYKRKRAALEQEKSRLKSAGRSADKFSHQRAGNVPL
FT                   LTAKNKAQDVANTLAGRARSMERQLERLDAGAVAKPFDDRRVLTLDLPPLPPGPQEVLT
FT                   VRDLGVTREGQEVLSSVNLHVRRGDRVALTGPNGGGKSTLLRAVLSELPHTGTVTWGAG
FT                   LTRSVAGQHGEELRGLGTVGGALLDANPALTPHQLHEIAAQVGLPGPLAALATLSGGQR
FT                   TRLSLARLSVTRAQVLLLDEPTNHLDLPMIEALEALLLAFPGTVLLASHDRRLLERTAT
FT                   RVWAVGGGGVTEQE"
FT   gene            477272..477583
FT                   /locus_tag="DR_0476"
FT   CDS_pept        477272..477583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:X73124 SP:P39600 PID:413956
FT                   GB:AL009126 percent identity: 61.25; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10055"
FT                   /db_xref="GOA:Q9RX39"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX39"
FT                   /protein_id="AAF10055.1"
FT                   /translation="MTVAPTTHVPPARPAAYRELVRQRNSFTVAMTLTFLVLYFLLPLL
FT                   AGYNKPLMATKVFGNVTFGYVLAFLEFLMGWVMAAIYVRKARTFDRLALEAQVPGGGA"
FT   gene            477580..479166
FT                   /locus_tag="DR_0477"
FT   CDS_pept        477580..479166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0477"
FT                   /product="sodium:solute symporter protein"
FT                   /note="similar to GB:X73124 SP:P39599 PID:580869
FT                   GB:AL009126 percent identity: 77.28; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10057"
FT                   /db_xref="GOA:Q9RX38"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX38"
FT                   /protein_id="AAF10057.1"
FT                   /translation="MTFLLAALIVLITLGVTFWASSRNTSAGDFYVAGGKISATQNGIA
FT                   IAGDYMSAASFLGITGLIALNGYDGFMYSVGWFIAYLTVLFIVAEPLRNLGKYTLADML
FT                   VYRLKDQRVRFYAAFSTITVSTFYMIAQVVGAGSLISLLSGGLLKPTLAIPLVGLLMIV
FT                   YVVVGGMLATTWVQIIKAMLLMFATIVMSVLILARFGFSFSDLLGAATDKNGAAFLEPG
FT                   LKYKNPLDLISLCLALVLGTAGLPHILVRFFTVPTAQDARKSVVVAMGLIGAFYIMTAL
FT                   MGNAANVLVGKDTIVAANPAGNMAAPLLAQALGGGAGTLGGEFGLAFVTAVAFATILAV
FT                   VAGLTISASTSFTHDIYNGVMKGGKANEQEQFKVARMATVAVGLLSIVLGLLAKDQNVA
FT                   FLVALAFAIAASANLPVILYTLFWRGFNANGAVWGIVGGLAVTLVLIALSPNIMSVDPP
FT                   EKTTGRHPVQRTAIFPLENPGIVSIPAGFALAALGALLGKRRPEDERNFEEMQYRAYTG
FT                   AGMDGTVAAHD"
FT   gene            479741..480679
FT                   /locus_tag="DR_0478"
FT   CDS_pept        479741..480679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0478"
FT                   /product="peptidase-related protein"
FT                   /note="similar to SP:P46545 PID:1150454 PID:609078 percent
FT                   identity: 57.72; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10058"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="PDB:5XEV"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX37"
FT                   /protein_id="AAF10058.1"
FT                   /translation="MEYSPNGAVPYVSRVDAGTLERVRGAGAAEVASSADLLQAFLVWT
FT                   PDDLAAHRRAAALLMRAKDDAFRLIHDRLRAGQSVTEWEVQQLIMDQIRAAGMQAGHDV
FT                   NVSFGVNAADSHYEPSEQRSATLHPGECVLIDLWAQEPGRPFADVTWVGFAGEPGTEYL
FT                   DAWQAVRAAREAALELLRSRFVAEGYGRLQGWELDRAARDAMGERWAPHFLHRTGHDLG
FT                   VQIHGAGANLDDYETRDTRTLTPGLSVTVEPGTYPAAASPSGQGGFGIRSEVDVYLAPD
FT                   GPEVTTDLQQAPFILGVGDWDAVRAAGYGEQ"
FT   gene            complement(480753..483374)
FT                   /locus_tag="DR_0479"
FT   CDS_pept        complement(480753..483374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0479"
FT                   /product="penicillin-binding protein 1"
FT                   /note="similar to PID:1916074 percent identity: 53.65;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10059"
FT                   /db_xref="GOA:Q9RX36"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX36"
FT                   /protein_id="AAF10059.1"
FT                   /translation="MSRSSQGQPPAPTPVPAPNPPAPTPPAPGPGQGTPRRRPPPQTAR
FT                   GCGCLPTLIGVVLLAGGLTFGGMWLMWGRDLPEVSDLDVINFSGQTRVFDRRGELIGTL
FT                   TPSLASGTNVNRELLGPKQISSWLQKAVVASEDRRFYTHKGVDVIGVTRGLLKGLLRND
FT                   LEGGSSITQQVVKNTLLSDLGGARTAERKFKEAVLAYQVDRRFNKDQILNAYLNVIYWG
FT                   DGGPQDIIGAGAAARAYFKKEPWDLNLAESVYLATIIPAPNRRYKDFIAYRPLMKSVLS
FT                   RMVEDGQITKQQAEQAWITPIYPAGWRLGWKTDGTLRSAVLERPERLAENLASMTPQGQ
FT                   QYRYLSYLQEVERELAGKVGKGTLYRGGKIFTGMDLQAQQAAERASQQAQLPDGATLGL
FT                   AQVNPQNGEVLALVGQKLSSGRPNEWNNATQSRRQVGSSIKPLLYTLALEKGWKQSDTV
FT                   LDAPIAGDYQPKNYSGTWTGVYVSMRYALNHSLNLPTVRMAQELGIPTFETKLRELGLT
FT                   PPSDGGLSLSIGTLEASPLQMAAAYAPFANGGLYYAPSAVRRMEDPQGKVLYKRPDPVG
FT                   KRVWDKRVAWLGLDMIRGVVNDLSAYQGGLATRARIDGWQVGGKTGTTNDVKDLWFAGV
FT                   TPLTSGAVWVGKQEGGTLPSWAYSGEVPTPVWQAATAGALAGRETATFIPPGGIVYRTY
FT                   YRLNMAFLTENADQDPVRHDGSRRATXXATPPAVTAPEPPQPATTTPAGRSPAPLRRRT
FT                   RRTLPRQTSPRRALPSRTCRPRRPLSPPPRRPRPGATRRANRRRTSPPSATRCPTCPRR
FT                   RLSRCPATPRPLSRRPVTPPGRPFQARRRIPRLRIPPTRPRLPSPPPRPRRTAPTPGYR
FT                   PS"
FT   gene            483549..484448
FT                   /locus_tag="DR_0480"
FT   CDS_pept        483549..484448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:D21139 PID:415267 GB:U00096 SP:P76055
FT                   PID:1787606 percent identity: 76.90; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10060"
FT                   /db_xref="GOA:Q9RX35"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX35"
FT                   /protein_id="AAF10060.1"
FT                   /translation="MTQALTPTVSNTAQPDPARLLAPIVRQVGQAIGDYRMIEQGDRVM
FT                   VCLSGGKDSYTLLDVLLHLQKKAPIDFEVVAVNLDQGQPGFPKDVLPRYLTALGVRHDI
FT                   LTEDTYSVVKEKTPEGKTTCSLCSRLRRGILYQHAREIGATKIALGHHREDILETLFMN
FT                   MFFGARLKAMPPKLQSDDGTNVVIRPLAYVAEADIIRYAQAREFPVIPCNLCGAQPNLQ
FT                   RKVVGDMLEGWEREHPGRLNNILRSLTRVTPSHLLDRELYDFASLSVTPAQGDTGFDAE
FT                   SFPEREFMAGLSELSLLQ"
FT   gene            complement(484534..485061)
FT                   /locus_tag="DR_0481"
FT   CDS_pept        complement(484534..485061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10064"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX34"
FT                   /protein_id="AAF10064.1"
FT                   /translation="MGAVLILLVVFGVIGFVTYRDQQRQRQQPPLPGPAASPMLPDPVA
FT                   PAEPVSESLLLALPEPARRHAWELLCLVHDGLSEGSSADTRTRFLLAQTRQSYLPDTLR
FT                   AYLHLTDGARRQLTAQGQSPEQLLDEQLALMTDGVHEALRRDHAAADRLLTQGRFLRER
FT                   FGAGAEELRVRK"
FT   gene            complement(485078..486064)
FT                   /locus_tag="DR_0482"
FT   CDS_pept        complement(485078..486064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0482"
FT                   /product="B-cell receptor associated protein-related
FT                   protein"
FT                   /note="similar to GP:1922935 percent identity: 54.32;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10061"
FT                   /db_xref="GOA:Q9RX33"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX33"
FT                   /protein_id="AAF10061.1"
FT                   /translation="MTQRPDNTTPDNANPKRQRVPGVRPSGPGLTTNRALLLGGLALAA
FT                   VLLFQSVRVVPAGFVGVGFNKLSGQLSTLQEGVHFVVPGIQQLNLYDARLQEVTLSNTA
FT                   RDGDEGAINARSKEGLGITAEVTVQYRIDRNQAAALHKQLGHDYQRTVIRPQVRSKVRD
FT                   AIGQFGAAELISTERKQVEESVTKALREEFSRNNLMLDSVLLRELKIPDSVAKAIEEKQ
FT                   TAEQQVAVQKNRLQQAQISAQQAVVDAEGKAKAAVATARGEAEALSLRGKALRENPQLI
FT                   QLTVAEKLSPGIQTVMLPADGNFLLNLQDLGRAANANGQNGNGAGQP"
FT   gene            complement(486101..486562)
FT                   /locus_tag="DR_0483"
FT   CDS_pept        complement(486101..486562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:L20251 SP:P37052 PID:410154 GB:U00096
FT                   PID:1787484 percent identity: 60.83; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10062"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX32"
FT                   /protein_id="AAF10062.1"
FT                   /translation="MERSPAPPGQPFALSRSPHYHPPMSRPTGPQFWPPFKPCPCGSGR
FT                   SYAACCQPFHTGERDAPTPEALMRSRYAAYALADADYVRRTWHPDTVPAELDLNDGVKY
FT                   TGLRIHRAEGDEVEFTASMKGPDGQPHNMRERSRFVQLDGRWVYLDAAE"
FT   gene            complement(486588..487526)
FT                   /locus_tag="DR_0484"
FT   CDS_pept        complement(486588..487526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10065"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX31"
FT                   /protein_id="AAF10065.1"
FT                   /translation="MKRLLLALCLSGFASAQTTFPLPGQAAKYPLTTRITPAEAQAFAR
FT                   VLDVGLGKVEVQRLPGWRTKLAARAKAGDPLAQFMYARTYDLFTTGQGTPQDARVAMQW
FT                   YTKAADQKFASAELFLFNVYEYSLLGQPKNPRLAARYLQRAYQHSGGSVRAEAALELAR
FT                   QTNPEREDFRLPGFQPSAKQTRAYLEEILKLEPKDTTALDWLMGIYLDSHDYSRALEMA
FT                   RRTDNSAMWVQMALVLADDHPGFPAQPKLAATFLKRRLAAVKNDKGEAESTLYLLMQLE
FT                   CEKKISRADYQNVFDPAVYQRYLTWRVGCRV"
FT   gene            487540..489117
FT                   /locus_tag="DR_0485"
FT   CDS_pept        487540..489117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0485"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="similar to SP:P27000 PID:48242 percent identity:
FT                   73.39; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10063"
FT                   /db_xref="GOA:Q9RX30"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX30"
FT                   /protein_id="AAF10063.1"
FT                   /translation="MKTDRRGLTVGRGLEQRQSGTLFSNHPRASPLTPLSGLMLSLMSA
FT                   PSSPRVTRIAPSPTGDPHVGTAYIGLFNHTLARQSGGRFILRVEDTDRNRYVPDSEKRI
FT                   FQMMQWLNLTPDESPLQGGPNGPYRQSERFDLYGDYARQLVQSGHAYYAFETSDELAAL
FT                   REEAQKAGHVIAIPSRDLGAAQAQARVDAGEPAVIRLKVDRDGETVVNDLLRDPIHFAN
FT                   KEIDDKVLLKADGFPTYHLANVVDDRLMQVTHVVRAEEWITSTPIHVLLYRAFGWPEPV
FT                   FAHMPLLRNADKSKISKRKNPTSVEWYQNQGFLPEAMLNFLATMGWTHPDGQEIFDLAE
FT                   FERVFRLEDVTLGGPVFDLAKLRWYNGKYLREVLSEDDVARRLHAFLMQNKVTLPSVDG
FT                   PQDPYFRAVTHLMIPRLEVFADFMDKTLYFWSEDYPVNEKAQKAIDAGKELLPELAARL
FT                   KNLPTFDAASIKEMFHAYAEEKGLKMGKVMPPIRAAVAGTMESPDLPEMLEALGRERVL
FT                   ARVEKAAR"
FT   gene            complement(489195..489716)
FT                   /locus_tag="DR_0486"
FT   CDS_pept        complement(489195..489716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10076"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX29"
FT                   /protein_id="AAF10076.1"
FT                   /translation="MEMALRHLLIRSPGGWATVRPMNKLLPLLACAALLPSCAPTFNAL
FT                   SRADRTPVPAPSAPLAAGQTWDVEGGSLAVGSRMTFRLTEIFETAPGVYSNLDAAGLLA
FT                   AQRGRAPEGTTLFPAVSLNRLGQRLDFYWSENGTDYDCRLENATPNATRLTGRLLLSGS
FT                   EFGGCTAQLR"
FT   gene            complement(489733..490920)
FT                   /locus_tag="DR_0487"
FT   CDS_pept        complement(489733..490920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:L42023 SP:P44250 PID:1007751
FT                   PID:1221695 PID:1205783 percent identity: 51.76; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10066"
FT                   /db_xref="GOA:Q9RX28"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX28"
FT                   /protein_id="AAF10066.1"
FT                   /translation="MSAPPPASRPAAFSWLLARAHLGRRRTQNLLTVLGIAVGVMVLIA
FT                   ALSLTNGFSGALVDATLRASPHLSLNSYTARPPSPDLERLIRSDRRVEAFTPFLADKGL
FT                   LTRPAEQGRDAGVDFATLFGVTPAAAQVLQLPPAESRTLAALGPGQVLLGAALARSVGA
FT                   FTGDTVRLLNSQQRRTELKVAGVFTTGNYLIDSAYAFTSLGTLQGLQQTGNVTGYQLRL
FT                   HDPEQAREVGMALTGSQPYAALPWQDIYGTLLDQLALQKRVIAFVVFLIVIVAAFGIAN
FT                   VLTLAVFEKTQEIAILRAIGATQGVIVRTFVTEGMVLGLTGLALGNLLGLGIAAYFTVR
FT                   PFQLPGDLYFITALPVQVRWQDLLWVNAVGLVTTLLAALIPARRAAGIEPARVLR"
FT   gene            complement(491029..491529)
FT                   /locus_tag="DR_0488"
FT   CDS_pept        complement(491029..491529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10077"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX27"
FT                   /protein_id="AAF10077.1"
FT                   /translation="MSNPLKFVLSAAALSLLSLTTATAQFATPEGQSTFTPAVTAEIPA
FT                   ATPVVSDLLGASRGAGRSLVIKATAYNSLSSQTDGTPHITATGTRTRPGVVALSRDLLR
FT                   VFPYGTRVTIQDLSGRYNFAGRVFIVEDTMHPRKTNQVDIWMPTYRDAISFGTSTVRIT
FT                   ALR"
FT   gene            complement(491552..491899)
FT                   /locus_tag="DR_0489"
FT   CDS_pept        complement(491552..491899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0489"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX26"
FT                   /protein_id="AAF10078.1"
FT                   /translation="MRKGAAGLSSSSSQGVSRRRTFHSILRKRGKGTLAKVSQQATFLR
FT                   KPLFGLFTLIWCSSLPEGPQVVMAGRPEKEFRFRPTNRAKRSERRRSNTARRLPGTLNQ
FT                   ENQGRLAGAPC"
FT   gene            complement(492064..492720)
FT                   /locus_tag="DR_0490"
FT   CDS_pept        complement(492064..492720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0490"
FT                   /product="pyrrolidone carboxyl peptidase"
FT                   /note="similar to SP:Q01328 GB:X65717 PID:47394 PID:1247679
FT                   percent identity: 59.02; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10067"
FT                   /db_xref="GOA:Q9RX25"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="PDB:5Z40"
FT                   /db_xref="PDB:5Z47"
FT                   /db_xref="PDB:5Z48"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX25"
FT                   /protein_id="AAF10067.1"
FT                   /translation="MPTLLLTGFEPFHTHPDNPSAQAAQELHGLELPGGWGVHSALLPV
FT                   EPHAAGAALTRLLSEQDPGAVLLTGLAAGRPQVTLERVGVGVMDFQIPDNAGQTYRDQP
FT                   IEPDAPAAYLATLPLRAILAAWREAEIPGDISNSAGLYVCNFVLYHALHWLREHGRGAV
FT                   PCGFLHVPANAAVALAVPADRPPLPYLPQSEITRAVRVAAEAITAQSSVLQMGKM"
FT   gene            492824..493609
FT                   /locus_tag="DR_0491"
FT   CDS_pept        492824..493609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:U00096 PID:1736636 PID:1788278 percent
FT                   identity: 45.22; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10068"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX24"
FT                   /protein_id="AAF10068.1"
FT                   /translation="MTTSTPSNRILVVMSSAAQIPLQDGKNHNTGYFLNEFGVPAKRLT
FT                   DAGYELVIATPRGSVPGMDHNSDHDMFFKNKEEHNEIKAFVGDVLSNTTIQTTEAVAAE
FT                   GTQAYAALFLPGGHAPMADLMADPALGEILRQFHAAAKPTALICHAPTALLAAQADPVA
FT                   FQKGMEAGEQPSAQDFTYQGYRVTVFANDEEEATEKTFEAPMLYYPADALTQGGAQVEN
FT                   GEAMKPNVVRDRELLTGQNPFSDEPFVAQLLEMLGGAKA"
FT   gene            493606..493911
FT                   /locus_tag="DR_0492"
FT   CDS_pept        493606..493911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 53.00;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10069"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX23"
FT                   /protein_id="AAF10069.1"
FT                   /translation="MSPVSVHAVLTPKPEHLTEVEAELRTMARASRQEEGNLRYDLARE
FT                   RTESGVRLHISERYRDEAAVQAHRDSAHYQAYRAKAGAWLAEPPQVSVLEEVDVAG"
FT   gene            493975..494850
FT                   /locus_tag="DR_0493"
FT   CDS_pept        493975..494850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0493"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /note="similar to SP:P05523 GB:M60670 GB:M86305 GB:X06036
FT                   PID:146545 percent identity: 58.49; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10070"
FT                   /db_xref="GOA:Q9RX22"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX22"
FT                   /protein_id="AAF10070.1"
FT                   /translation="MFAPALAYPRPMPELPEVETTRRKIEPLLRGKTIERIVHDAPHRY
FT                   RNTERAHGRQVRGLTRRGKYLLLHLAAADAAEDEPHDLELIVHLGMTGGFRLEEGPHTR
FT                   VTFELGSGEKLYFNDPRRFGKVVAVAPGDYASMPTLAAMGPEPLSDDFTEAEFVALAAR
FT                   CGPVKPWLLSQKPVSGVGNIYADESLWHARLHPAQTRLNADEAGRLYRAIREVMAAAVD
FT                   KGGSSLGNGVGNYRQHDGEGGGFQHSHHVYGRAGQPCDRCGTPIEKIVLGQRGTHFCPV
FT                   CQPLRTDRSA"
FT   gene            494847..495359
FT                   /locus_tag="DR_0494"
FT   CDS_pept        494847..495359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0494"
FT                   /product="DNA topology modulation protein FlaR-related
FT                   protein"
FT                   /note="similar to PID:1036788 percent identity: 57.58;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10071"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX21"
FT                   /protein_id="AAF10071.1"
FT                   /translation="MKRVLIVGSPGAGKSTLAKTLAAQTGLPLTHLDDLSWEPGWVRVE
FT                   QTVWHARLGRAIAADDWILDGNILTTLLRVAYRADTVVYLLPPRWLCLWRIYQRAAIGQ
FT                   FPHGERWQGWPTRELLRSLWQFPAQADWQLAQLRTVPGLRLVVLRSDAEARAFLARLPG
FT                   GWATLHP"
FT   gene            495356..496000
FT                   /locus_tag="DR_0495"
FT   CDS_pept        495356..496000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0495"
FT                   /product="pyridoxamine 5-phosphate oxidase"
FT                   /note="similar to GB:M92351 SP:P28225 PID:148097 GB:U00096
FT                   PID:1742704 percent identity: 63.08; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10072"
FT                   /db_xref="GOA:Q9RX20"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX20"
FT                   /protein_id="AAF10072.1"
FT                   /translation="MTDLTSLRLSYTRAELRREDLNPDPLRQFQGWFEEAQQADLTEPY
FT                   ALQLATADAQGRPSVRTVLLRGADERGLTFYTNYESHKGHDLAANPQAEVLFYWAELER
FT                   QVRAFGTVSRVPEAESNDYFHKRPRESQLAAHASTPQSAPVENRAALEAKFAALHEQFP
FT                   EGTTIPRPAFWGGYRVQVQEWEFWQGRPNRMHDRFRYARDGDGWRLDRLMP"
FT   gene            496083..497522
FT                   /locus_tag="DR_0496"
FT   CDS_pept        496083..497522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0496"
FT                   /product="ferredoxin/ferredoxin--NADP reductase, putative"
FT                   /note="similar to GB:AL123456 percent identity: 64.27;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10073"
FT                   /db_xref="GOA:Q9RX19"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX19"
FT                   /protein_id="AAF10073.1"
FT                   /translation="MRGLAITPPRSLSQFRAPFLGTHYTFPMTSYTPERPLRVAVIGSG
FT                   PSGIYAAEALLKQTEFPVEVDVYDRLPTPYGLVRYGVAPDHLTIKSVTKGFEKTLSDPR
FT                   VRFLGNVEFGRELSAEDARAHYDAVMYTVGASSDRRLNIPGEDLQGSMSATEFVAWYNG
FT                   HPDAATREMLLSAEGVAVIGVGNVALDVSRILAKTVNELRGSDIAPHALPVLERSSVKD
FT                   IYILGRRGPAQAAFTTKELREFGELAGAEPVVKPAEVQLREEEEAQVTDNVKKKNIEVL
FT                   RDFAVRTQEGKERRVHLRFLVSPVEILDDGEGRVAGLKVERNRLDEQGNAVGTGEYETL
FT                   PVQLVLRSVGYRGVALPGVPFDDRRGVIPNEEGRVQGRPGEYTAGWIKRGPSGVVGTNR
FT                   KDATDTVAHLLSDAREGKLLTPAHTTRAEVDALLAQKGADVFTFEDWQTLDAHELTQGQ
FT                   AQGRPRHKVARREDMLGLRKR"
FT   gene            497548..498264
FT                   /locus_tag="DR_0497"
FT   CDS_pept        497548..498264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0497"
FT                   /product="L-serine dehydratase, beta subunit"
FT                   /note="similar to GP:2315865 percent identity: 60.00;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10074"
FT                   /db_xref="GOA:Q9RX18"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX18"
FT                   /protein_id="AAF10074.1"
FT                   /translation="MGRQARFPLLLTDYTAPMSLLDMIGPVMIGPSSSHTAGACRLGLV
FT                   AHHLLGEAPKDAKIGLHASFAKTGRGHGTHLALVAGLLGYSPDDPRLPQAFEQAQAAGL
FT                   HFEFADVDLGDVHPNTAHIVLKGETQEVTVQGSSTGGGVILVTQVQGLGVNFSGASPTL
FT                   LLRYTDAVGMIARIASSIAAAGVNIAALTCTRAARGGQALLAIELDAPPSPEALSFIAS
FT                   WQDVNWVRLLPKLMDG"
FT   gene            complement(498343..498414)
FT                   /locus_tag="DR_t10"
FT                   /note="tRNA-Val-1"
FT   tRNA            complement(498343..498414)
FT                   /locus_tag="DR_t10"
FT                   /product="tRNA-Val"
FT   gene            complement(498435..498507)
FT                   /locus_tag="DR_t11"
FT                   /note="tRNA-Met-2"
FT   tRNA            complement(498435..498507)
FT                   /locus_tag="DR_t11"
FT                   /product="tRNA-Met"
FT   gene            498568..500235
FT                   /locus_tag="DR_0498"
FT   CDS_pept        498568..500235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0498"
FT                   /product="virulence factor-related protein"
FT                   /note="similar to GB:U00096 SP:P75932 PID:1787309 percent
FT                   identity: 55.48; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10075"
FT                   /db_xref="GOA:Q9RX17"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX17"
FT                   /protein_id="AAF10075.1"
FT                   /translation="MSNAPPGRAKPDSGRSGRGARGTVGRVTVPPAAPDPNAPPQGPAS
FT                   PAPAPSPVPKKSLQANTLIVMAGTLGSRLSGIVRQQVINLFDTTLTDAFNVAIKVPNLM
FT                   RELLAEGALVNSFIPVYKTLDAAERRKLAQSFSGFLIAINLLLMALGIFAAPWVVGLLT
FT                   STHANIDRAIAIYMTQLVMPFLTLISLSAVAMGLLNADEHFRESSFAPVAFNIASIIAL
FT                   LLLPNNATWLAFGWLIGGVAQLLVQLPALRRFGLLPEPRLGGHPALGRVLKQMAPFTLT
FT                   AGARQFLNLYVTRLLTDASQFKPGTQTGYANAEALFTMANGLFVVSPALAVFPRFSQHA
FT                   AEGNWNEFRSLTAQTIRTSTFLAAPVSALLLVLAPYAVSVYNLKSGFDPNRFEAGSGIL
FT                   AGWALALIPWALVTILLRTFYARERTREAVTVSAIGFVLEVGLYRLLVPAFGLFGFGLS
FT                   TTLSGILMAFALMLMYQRALGFPWQAVGDHLARVVPLALLSGIVAWLISRVMPAPGFFL
FT                   PGLFGLAVAGGAGLLVYLLGATLLKMPEMAGLLRRLKR"
FT   gene            500329..501261
FT                   /locus_tag="DR_0499"
FT   CDS_pept        500329..501261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0499"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /note="similar to GB:D90212 SP:P23523 PID:216632 PID:606065
FT                   GB:U00096 percent identity: 47.95; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10079"
FT                   /db_xref="GOA:Q9RX16"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX16"
FT                   /protein_id="AAF10079.1"
FT                   /translation="MGTSSAASAAEPRAGSGITTAFLGLGAMGFPMAAHLAAQAASGGG
FT                   RALVWNRTEAKAQDHAARAGSEAVSLADTAQADVLFTCLPTSAEVDEIIAALSPHLRPG
FT                   TVWVDCTSGHPDAARRQRETLDALGVKFLDAPVSGGTSGAEAGTLTVMLGGPADEIDAA
FT                   SPHLAFAGKVVRVGETGAGFAVKAVNNMLLAVNLWAAGEGLAALGRSGVDLGAALSVIN
FT                   ASSGRSNASENLIPQRVLTREFPVTFALGLLAKDTGIALDVVQSAKASAPTLAQVAGLI
FT                   RAAAHVVGPQEDHTAALKLLEQMNAQEIR"
FT   gene            501258..502121
FT                   /locus_tag="DR_0500"
FT   CDS_pept        501258..502121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:671632 percent identity: 49.82;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10080"
FT                   /db_xref="GOA:Q9RX15"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX15"
FT                   /protein_id="AAF10080.1"
FT                   /translation="MTAMPSFAVVTDGGLDAYPTLLNDVPVAPFSVAFGERSYPMNEVS
FT                   RQWLYDELGRNPAHPTSSQPSPQQWLDAYAAVPSGTDILAVTISSGLSGSRNAAAQARD
FT                   LAGRQVTLHDSMTLSAAQAFQVHAANVAAQRGESMETAIAWMNAVQAETELQFTIETLE
FT                   YLRRGGRIGTVAAALGGLLNLKPVVMVDKKTGTYVNAGRARSYRGGIEAVTSQVTRKYG
FT                   EGTPLRVGLLYGTHPEDADQALEQLAARHPIVWSDRTGVNPVLSVHVGPRALGVAAAPG
FT                   AWPWER"
FT   gene            complement(502484..503593)
FT                   /locus_tag="DR_0501"
FT   CDS_pept        complement(502484..503593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0501"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /note="similar to SP:Q63707 percent identity: 65.71;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10081"
FT                   /db_xref="GOA:Q9RX14"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX14"
FT                   /protein_id="AAF10081.1"
FT                   /translation="MYQTVRPLLFRLDAEDAHHLTLRGLELASGVPLLPRLARTLTVPG
FT                   TQGPGDAALRRTLWGQTPSEQTFESPLGLAAGLDKNAQAVPAFTAFGFGFVEVGTVTPL
FT                   AQSGNERPRLFRLPEDEALINRMGFNNGGTAAMHARLAVLTDRAAPVWVNIGKNKVTPN
FT                   EDAAEDYRKCVRALGDLADAFVVNVSSPNTPGLRALQAADDLAALVRAVLDEVEAGRVR
FT                   TLRRPPVLVKLAPDLHPADFEASVGAVLDAGASGLIISNTTLSRGGLSHPNREQAGGLS
FT                   GRPLTDRSTELVRDAYRLTRGQVPIVGVGGVFSAEDAYAKLLAGADLVEVYSALIYRGP
FT                   GLVREINAGLVKLLERDGVRNIADVVGQG"
FT   gene            503614..504843
FT                   /locus_tag="DR_0502"
FT   CDS_pept        503614..504843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0502"
FT                   /product="alanyl-tRNA synthetase-related protein"
FT                   /note="similar to GB:AE000782 percent identity: 47.11;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10082"
FT                   /db_xref="GOA:Q9RX13"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX13"
FT                   /protein_id="AAF10082.1"
FT                   /translation="MGKAAPGCLPGARSPILPPMTRPLYHDPYQPLTFAASVVDVQGQE
FT                   VALAATAFYPESGGQSSDVGLLRWPGSEARVTHARKDKATGTVWHRVDGELPPVGAEVT
FT                   GEVDPGPRWRHTQRHSAEHLLAQAFRRVNPAFEVASVNMTGPECTIDFLGDPGEADIRA
FT                   AEALLRETLGRDELTLETPIVPEAELVNYPLRRESKVGGQVRLVMFRGSDGDFFDVSAC
FT                   GGTHVPGAAMCAPVVILRTERVRGGQVRVVFMAGEEASEYLSGVYQSARTLAQEFSAPV
FT                   DKLPERVAALRADLSAARADADALRARLAAQLVAAASAEGTPPLRLLTLDNAALLAPVL
FT                   TAVPAGEVLAAVGPGGRCGVASAHPDVKAGDVLRAALAVTGGKGGGKPDLAQGSTADEG
FT                   GFLEAVRQVL"
FT   gene            complement(504840..506021)
FT                   /locus_tag="DR_0503"
FT   CDS_pept        complement(504840..506021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10086"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX12"
FT                   /protein_id="AAF10086.1"
FT                   /translation="MRPLSSLLSAEVSMRRYLLLLSLALTACTSQNAPTPGEDALAQLP
FT                   ALTLQWSFPDHKVTGYTTLLGTLLLGGRQVTAIDTRTHQLAFKLPLDTENLRTNYATLD
FT                   DKLIALNGKNADVLTVFDRSGQILNTVAVPGGTRQSLGQLGPFVAGSSLYVVSGARLYR
FT                   YRTADLLRPDAQPVWVRNYPGFRLASLIVRDEDRLFVSTSAETSHQLIALNSQGETRWA
FT                   VDVSPKTLQNTGAFALSLYKNLIIAQAGVAGLQAYDADTGEKAWKKFPDINVCPGGQAN
FT                   TAFRMSIADDKVFIGPWGGTCILAYHAATGELAWVFDAPNHVTFDTTPLDVNGVVYASN
FT                   SRLWALDAETGKALAVGRENLSDNLGAPLSYDPAGRQVLHWGAAGVHAYQPLR"
FT   gene            complement(506031..506795)
FT                   /locus_tag="DR_0504"
FT   CDS_pept        complement(506031..506795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:3192028 percent identity: 48.81;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10083"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX11"
FT                   /protein_id="AAF10083.1"
FT                   /translation="MMTDAWNAEQYRDRHAFVFQSSEDLAAEWLRPQPGERILDLGCGS
FT                   GELTARIAQSGAQVVGVDASPAMIAAAQSSFPAVPFEVQDAHALTFGSEFEAVFSNAAL
FT                   HWMKPLPPVFGRVAAALKPGGRFVLEMGGAGNVQTTLDAVAHATHKLGLPELPPPWVFP
FT                   TAGELCTGLEAAGMRVERLHWFERPSRLPGEDGFRAWLEGFGQVWLAPLGAEEREAVIR
FT                   EAAEFARPRLWDGEAWVSDYRRLRALAVKTGN"
FT   gene            507060..508766
FT                   /locus_tag="DR_0505"
FT   CDS_pept        507060..508766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0505"
FT                   /product="5`-nucleotidase family protein"
FT                   /note="similar to PID:1239994 SP:P54602 GB:AL009126 percent
FT                   identity: 53.23; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10084"
FT                   /db_xref="GOA:Q9RX10"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041831"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX10"
FT                   /protein_id="AAF10084.1"
FT                   /translation="MKKNLLLIGASLLLGACSTTPEPSKPEQEKPATTKVTVVGLNDFH
FT                   GNLEPTSFAGVMVPDPKDPTKQVKLTTGGIEVIGGYLDQERAKNANLTFVGAGDLIGAS
FT                   PVTSSLLRDEPSVIGLSKLGMQYSSLGNHEFDQGYKELLRMQNGGCDSNAPDKACKFQN
FT                   PYPRATFSWLGANVEVKATGKPALPAYGIQEIGGARIAFIGAVTKTTPTIVSPDGVADL
FT                   KFLDEAESINKYVPELKAKGVDAIIVLIHEGGVSKDGFDKPACGTLTGPIVNIVNKLDP
FT                   AVDAVISGHTHQGYNCVVNGRTVIQGDYYGHLLQRLDMTIDLQKHKVTDIRAANVVMDP
FT                   NTITKNAEMTALVGRAKSLTDAVKQRAIGSLAAPTISRTTNAAGESALGDLIADSQLAA
FT                   TADRGAVIAFMNPGGIRADLNATGGGTTVTFGDAYAVQPFGNTLVVMDLTGAQIKALLE
FT                   QQFDNPSAGQNRVLQVSKNFTYSYDSTAAAGNRVDPASIKLGGVTLDPAKTYRVTLNSF
FT                   LSTGGDNFTTFASGTNVLQLPNVSDLDALTAYIVAHPGVAGGAQDRIVKLK"
FT   gene            complement(509003..509479)
FT                   /locus_tag="DR_0506"
FT   CDS_pept        complement(509003..509479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10087"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX09"
FT                   /protein_id="AAF10087.1"
FT                   /translation="MSETLQQLYDEAAERLEAFHKDLLTWVDVVASADAWILQLPQSPE
FT                   ALIEVSLSQSRLRDGIDALGQLSCQSDEATVLPFLKALWREKYQAGQIDELSLTEQARS
FT                   LLGVYIPYISDEYVQVRGLEHLMDEATGTYLLTDEQKQKALLTLERELRKWLNS"
FT   gene            complement(509476..513483)
FT                   /locus_tag="DR_0507"
FT   CDS_pept        complement(509476..513483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0507"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /note="similar to GB:AE000783 percent identity: 63.30;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10085"
FT                   /db_xref="GOA:Q9RX08"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX08"
FT                   /protein_id="AAF10085.1"
FT                   /translation="MTVSDAPTPHIHLPDGSCCQPKKFAHLHQHTQYSLLDGAAKLKDL
FT                   LKWAKEVTPEGQTPALAMTDHGNMHGAVHFYNYAMGMEVKPIIGYEAYVVPGFGTRRDR
FT                   SRAQDGEKGIFHLTLLARDFEGYQNLCRLSSRGYTEGYYYKPRIDHELLQEHHKGIIAF
FT                   SGCLGSEVQQLLMQGREDDARARLLWYRELFGDNYFIEIQDHGLPEQKKNNPILKAWAQ
FT                   ELGIGMVATNDGHYVKKSDATAHETLLAIQTKATLADENRFKFPCDEFYVKNLEEMQRA
FT                   LPVSEWGEEPFDNTAHIAELCNVELPVGKKRQYQMPQLPIPEGRSMAEELRVQTYAGAV
FT                   KRYPAHLTEGLLRDYAARSLAELGEADAARVLKRTGGCDSASCDLDTLYTLLAFLGSEW
FT                   EARGKEAGEKYTPYPALEKMEQDGESGTLPAYAHADCRAARRQDSDTSIELDPDTDDEE
FT                   TTRSHHRYALKLLRRAEYELSVINNMGFPDYFLIVADYINWAKDHDISVGPGRGSGAGS
FT                   LVAYAIRITNLDPLEFELLFERFLNPDRISMPDFDIDFNDARRTEVIGYVQEKYGTDKV
FT                   AQIATFGTMASKACLKDVARVMGLEYAKVDKVSKLIPIKFGKSYSLEQAREAVPDIQQM
FT                   LAEDAQLLEAYEFAQKLEGLTRHASVHAAGVVIGREELTNLVPVMRDTSGEGQVCQYDM
FT                   KSVEDIGLIKMDFLGLRTLSFLDEAKRILRESGTDFEEKYGDFDHIPFDDEKTYELMSR
FT                   GDTKGVFQLEGAGIADASRRLKPRRLADIIALSALYRPGPMENIPTYVRRHHGIEEVDY
FT                   DKDGFPNSKQWLEKILQETYGIPVYQEQIMQIASEVAGYSLGGADLLRRAMGKKDAEEM
FT                   KRQRQLFVVGAKEKGVPEDEGNKLFDMLDAFANYGFNKSHSAAYGVITYQTAWLKANYP
FT                   VQFMAALLTVERRDSDKVAEYVSDARKMDLHVLPPDINRSSSDFAVAGEEILFGLYAIK
FT                   GLGESAVLRILEEREKAGAFKSLADFCSRLGNKVCNRKALESLIKSGAFDAFGERHQLI
FT                   ESLEDALEDAAGTAEINARAQSGMSMMFGMEEVKKERPLRSSIAPYSDLERLAIEKEAL
FT                   GLYISGHPLEQHEGLREAASCRVSDLDAWFALQNVAPGKRQKAVLAGMIEGVVKKPTKS
FT                   GGMMARFILADESGQMELVAFSRAYDRIEPKLVNDTPALVIVELEAEDGGLRAIAEEIV
FT                   SIEQLSEVPKVMYVTIDLETASPDALGDFQSVLDEYAGSMPTYLRLETPEQFVVYQLDH
FT                   GMGSPEAIRALNQTFAWADAHLAYDQQTILGRFAPKPPAWMNRQQGGGMRA"
FT   gene            complement(513563..514573)
FT                   /locus_tag="DR_0508"
FT   CDS_pept        complement(513563..514573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0508"
FT                   /product="mrr restriction system protein"
FT                   /note="similar to GB:AL123456 percent identity: 57.00;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10088"
FT                   /db_xref="GOA:Q9RX07"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX07"
FT                   /protein_id="AAF10088.1"
FT                   /translation="MRGRDESRKSRQSVNLKNMRDTMPSFDEFNALTLKFMGDGQARQV
FT                   NQIKDAVTALAQLSPQALAETIPSGESKVRHRIAWACSNLYRAGFLVKPQRGIYQISDT
FT                   GRQILPTVGDTLTEREFETQPRWQQYLAERNQRQGDRAGAVVQATSVPALVEEQDLESV
FT                   AIGAVDKLNDDLAIELLRRLREGSPAFFERAVIRVLRAMGYGGNDERELRTLLIESHTG
FT                   RSGDGGIDGIIKLDPLGVQNIYIQAKRYGAGNPVGRPEVQGFVGALYGKRATRGVFMTT
FT                   SRYTPDARAYAEGEAQDRLVLVDGVQLTTLMLNYGVGVQPKQTLTLLEIDEDFFE"
FT   gene            complement(514548..515156)
FT                   /locus_tag="DR_0509"
FT   CDS_pept        complement(514548..515156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0509"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10093"
FT                   /db_xref="GOA:Q9RX06"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX06"
FT                   /protein_id="AAF10093.1"
FT                   /translation="MTSKATVSEPRSGPLLYSGPAGKVWADGLELYGLTARGVTVQGVM
FT                   PGGPSTQPTPAELAAVQDAAKNAYSPLRPWMAVAALFLLLIVLNLLRAPLWLTLLPGLA
FT                   ATVVLVALPVSRQYRAFAGLFERRGELTIVLSDVPTQAVSNLVDIGPDTPAQTLDAARQ
FT                   PVAVVVRGLPGPERVKLGAAIMRRASLGQALGARKGRKP"
FT   gene            515265..515846
FT                   /locus_tag="DR_0510"
FT   CDS_pept        515265..515846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0510"
FT                   /product="sensory box protein"
FT                   /note="similar to GB:AE000782 percent identity: 49.17;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10089"
FT                   /db_xref="GOA:Q9RX05"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX05"
FT                   /protein_id="AAF10089.1"
FT                   /translation="MKSGSIELRWAYVAFGLLAGIDVLAGIRILRRMVWHLEPSAPDAP
FT                   LFILLFLLLHVVLLWLFHRLRNLVRYDQRLRAMYEQELGFAQQLLDASTEGLLMFGPEG
FT                   TITYANRRAGEVMGYAPEALLGQRAQLLVTPEDQAALQEQWVQVWAQPQQVYHLRVYDA
FT                   QGQVRRVQVTASPRWHQGRVVGSFGVVHPE"
FT   gene            complement(515856..517352)
FT                   /locus_tag="DR_0511"
FT   CDS_pept        complement(515856..517352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0511"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to GB:L77117 SP:Q57855 PID:1591118 percent
FT                   identity: 67.17; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10090"
FT                   /db_xref="GOA:Q9RX04"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX04"
FT                   /protein_id="AAF10090.1"
FT                   /translation="MSGPGHPGNTDPIRLEHVSVQLGGVPVLRDVTLNVERGEFLAIIG
FT                   ASGGGKSTLLRVIAGLQLPHAGRVEVASPPALVFQDYRLLPWRSALRNVQLPADLGAAA
FT                   GGNGGLDAKEALRLVGLEATPTIFRRISGGMRARVALARALAQSGDILLLDEPFAALDA
FT                   LVRERFNEELRHLHEKTGRTTVLVTHSIREAALLADRVAVLRGGQLVEVLDTRGAGRVS
FT                   AYTDGIEARLRDLLGAGDSTRLQVAPRRRPSASALLPLLALLLAGIAWQVAAVRLAQPF
FT                   LLPAPAAVWAKLTGNAPTLFASLWVTARTALLGTLLGGLGGLLLGYPIAKSRALERFLS
FT                   PFIVASQSTPIVVLAPLLVSWLGFGSLPAVLVSALSALYPVLVSTLIGVREVDHAYHEL
FT                   FHSLRATPWQRLTRLELPGALPVMLGGLRLAASLALIGAVVWEFTDPNQKGLGFRVQEA
FT                   GIYQDKAGQFAAIALLIVFGVLLYGAVTALERWAARRRGQ"
FT   gene            complement(517349..518254)
FT                   /locus_tag="DR_0512"
FT   CDS_pept        complement(517349..518254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 67.30;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10091"
FT                   /db_xref="GOA:Q9RX03"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX03"
FT                   /protein_id="AAF10091.1"
FT                   /translation="MLTPMTSAAPVQGRLDPLSLGAIVVTLVFWASAFTGIRIGLEHFS
FT                   PGHLALYRFLVASVTLLLVMAVTRLPVPAPRDLWQIGVLSVAGISLYHVLLNMGERSVP
FT                   AGTASLIIAAGPVITALLAARFLGESLNPLGWLGTAVSLGGVALIVLGQGQGLGFSAGA
FT                   LLVLGAAFFTSLYFVFQKGVLARVGSLRFTVWSLILGTVPLLVFLPGFGTELRAAPLPA
FT                   HLAVLYLGVFPSALAYLTWTFAISRVGAGVTSSFLYVSPVFALLMAWALLGEVPGAVTL
FT                   LGGVIALAGVLLVNTRGRPQ"
FT   gene            518331..518404
FT                   /locus_tag="DR_t12"
FT                   /note="tRNA-Arg-3"
FT   tRNA            518331..518404
FT                   /locus_tag="DR_t12"
FT                   /product="tRNA-Arg"
FT   gene            complement(518499..519833)
FT                   /locus_tag="DR_0513"
FT   CDS_pept        complement(518499..519833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0513"
FT                   /product="integrase, putative"
FT                   /note="similar to GB:L11597 PID:404802 percent identity:
FT                   43.40; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10092"
FT                   /db_xref="GOA:Q9RX02"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX02"
FT                   /protein_id="AAF10092.1"
FT                   /translation="MADGAEGRRVKRGQGEGSYTKTPAGRVRWRVMTTTPAGERRHVTG
FT                   TARNMTAAREAVREALRAAERDTLPPRERVTVEQLVSAYIEHRAPSLKGRTVENYRALL
FT                   RRNISPSLGQLKAQGVTPQRLRAFYDAQREAGQGDSVRRQTHNLLNAAYLLGLTDGVVT
FT                   VNPAARARPVYVERGAARVKAFTPDEAARFYAAARADRWGWPLAFMLATGLRPGEALGL
FT                   TWADVTMRGSAEGGTLAAVVHIERTRSVSGGRVYEDTPKTERGRRSLTVTGDAARLLLD
FT                   ARAQAEREAGARLRHNGREYQSTGYVFVTRAGTPYRPDNLRRPMARLCQAVGVPVLTPH
FT                   KLRHTWASVQAAAGVPVEVLSAELGHAAPSFTRDTYRHVYESERASLTYDPLTPAAAPA
FT                   PEPEPQGRKRVTVRARLAQAEAGSAEGEAGELPPSAAPGSKRARA"
FT   gene            complement(520225..520413)
FT                   /locus_tag="DR_0514"
FT   CDS_pept        complement(520225..520413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10094"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX01"
FT                   /protein_id="AAF10094.1"
FT                   /translation="MSRLPQVFTVWARRFRFPQNRRKPQRRGLSVLSQKKESGGPFERS
FT                   KHRHFSSFDRLAQHVSG"
FT   gene            complement(521319..521735)
FT                   /locus_tag="DR_0515"
FT   CDS_pept        complement(521319..521735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0515"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10095"
FT                   /db_xref="GOA:Q9RX00"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX00"
FT                   /protein_id="AAF10095.1"
FT                   /translation="MYTRDDKVLAMNDAVRAVINARLHEKKMSRADLARATGVSPTSIT
FT                   RALNGSEGGGTVPPLWAAMLDALGLTLTAVPVEHTGTAQPVTVPSSPQELDALTARITA
FT                   AVREALGAAGSSTPSPAAPAEPGADEPGSAGGAG"
FT   gene            521966..522415
FT                   /locus_tag="DR_0516"
FT   CDS_pept        521966..522415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0516"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10096"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ9"
FT                   /protein_id="AAF10096.1"
FT                   /translation="MKDTARNTPAPALAPGRYAVTAGYTSQVWDVTAQGVTRTTAQSGT
FT                   YAPSPLAPLTHAEAAQVLAQAAAYLGRPAAQPLAPQPVSTPSGAPVGKATGRALHVELS
FT                   RLGYREHYTAAADALGRPVPSLAALTAAEVKTVYAYAYGSLGMTA"
FT   gene            522471..522743
FT                   /locus_tag="DR_0517"
FT   CDS_pept        522471..522743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10097"
FT                   /db_xref="GOA:Q9RWZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ8"
FT                   /protein_id="AAF10097.1"
FT                   /translation="MTTKKTGTKTKAAPARKTASTKTAPARKTASTKTAASSNTAPAPQ
FT                   PQHAPSGSRAPLILGLALAVLGFITLTPADVRASVDAALSGPVAR"
FT   gene            522751..523011
FT                   /locus_tag="DR_0518"
FT   CDS_pept        522751..523011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ7"
FT                   /protein_id="AAF10098.1"
FT                   /translation="MPELTAYTVTAPGVKSYTTRAPSPALAVLPAARALYGRRARYVIT
FT                   AQGQPVSGGPFVFALGVEGNPARLGVTVSEAPSRPPSEASA"
FT   gene            523008..523247
FT                   /locus_tag="DR_0519"
FT   CDS_pept        523008..523247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ6"
FT                   /protein_id="AAF10099.1"
FT                   /translation="MSAYRLGHGSELTDAQAAQLLARTAQGEALNWAPVKTGHRWALAH
FT                   LATLTAAQLDEHRERVSRCAQVLDGLPVPAALTA"
FT   gene            523310..524083
FT                   /locus_tag="DR_0520"
FT   CDS_pept        523310..524083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10100"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ5"
FT                   /protein_id="AAF10100.1"
FT                   /translation="MTKPHYTAAVTDREAPAPWGECQGCGAAAALPASMLPGRTFNYCP
FT                   ACTALELLRAAATQALSDMLAPHLGAWGNFWAASGLSLDDLQGITGQLSASWADEEYST
FT                   RYQTAAIYRAMRAHPAPLNVERAAPDRREVNALTLPRVTAAYRYDRAAPAAQGGGPERG
FT                   WAFTLTYPDGSTDEGVTLPPGRDVLLTYPSGPQGDAVLYYTGIHGSTADRRPISRGDVP
FT                   LYVPAQFVKYARASLGYWGEAQAPTAQAAAAEGAQ"
FT   gene            524080..524475
FT                   /locus_tag="DR_0521"
FT   CDS_pept        524080..524475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0521"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10101"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ4"
FT                   /protein_id="AAF10101.1"
FT                   /translation="MTGAGTPGRRSPRALIPGAVSLAAVQVVPASLTADGRPALALACY
FT                   TTRHRVTLAHLPSGAAWSLARPPALPNERDEREGLTLARLGGARLTLEHEGRRAVLDVP
FT                   AVRLLRELCEALGTYDRSPVEGLGRPA"
FT   gene            524472..524975
FT                   /locus_tag="DR_0522"
FT   CDS_pept        524472..524975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10102"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ3"
FT                   /protein_id="AAF10102.1"
FT                   /translation="MTPGADPVLCNLAPAQVLARMLDVLAGELGGPGARHTSEAREHVR
FT                   AALAAPELSPAYFDALAQAEGALTRAVSERPPSGHLSAREVLGVTRTPSGARLTLADGE
FT                   RVELPATSPYHLTPTAPARLSRLDVPALYTLPAALARPAALALGFDPQQLAALLDTPEV
FT                   PRHD"
FT   gene            524968..525552
FT                   /locus_tag="DR_0523"
FT   CDS_pept        524968..525552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10103"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ2"
FT                   /protein_id="AAF10103.1"
FT                   /translation="MTEPNTAARTPAALAEHLGLSVPQLAQQLARVTQTEGLSAQGLTV
FT                   YEGAASLGLSAAEVLGVLAMCPGTAEREAAPLLDFPASLNGANMPAALCDALSGVYAVL
FT                   SDAPPQGVSREHLGRALAEVTGAAQVLAQLDGTPAALSAAQVMTARALAAGAGAELYPA
FT                   DTLAQFRAAGERRAAEHRHPVTGQPLAGGRF"
FT   gene            525552..525950
FT                   /locus_tag="DR_0524"
FT   CDS_pept        525552..525950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10104"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ1"
FT                   /protein_id="AAF10104.1"
FT                   /translation="MLPLELLSAQPHGAGVRLTLAGRAEALDVVRGQVQVRAWGRVPGQ
FT                   PSVLDVHTLWGRQPVRVPAALLAQVCGALGLSPRLPCPACEGEGVTDTAAPGVPPRCPA
FT                   CLGRGTLTPAQLARHEAAQAEQLAGGVS"
FT   gene            525947..526501
FT                   /locus_tag="DR_0525"
FT   CDS_pept        525947..526501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10105"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ0"
FT                   /protein_id="AAF10105.1"
FT                   /translation="MNLDRRALSAQVRALRDALDALGLLSPPADVPQVREGEAQINAQR
FT                   LASALSDAAGVLAPYGSSPALSSFHGVLTLAGVVLAEVQAIEPRPLAALGVLMVWASDH
FT                   ARETLGAEAAEQLAQLDTWQIRAAAAPLGESDRGVFLGADAVLRVSSWAAADPDVTAPD
FT                   LTRALLAEAQMLSRPPSAAQA"
FT   gene            complement(526959..527306)
FT                   /locus_tag="DR_0526"
FT   CDS_pept        complement(526959..527306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10108"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY9"
FT                   /protein_id="AAF10108.1"
FT                   /translation="MRGVLAALGERVRLNTRELTAEIYGASLWGYSDEVSTRRALRRLH
FT                   AQGRVFCLGFDSYGSRVWCLPENAGILTPPWKTKRDALAPPESVMLGELLASSFAAGMA
FT                   RAWNTQRLELE"
FT   gene            complement(527390..528247)
FT                   /locus_tag="DR_0527"
FT   CDS_pept        complement(527390..528247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10109"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY8"
FT                   /protein_id="AAF10109.1"
FT                   /translation="MPGQRAPYPDPMAAGRKYERRGDPFTLKVQRGEGPPTVQNWAHRG
FT                   TGRRWFTRVPVHLCQRLDAAQLGEAVRGYAQQLAQAGTPAELPRLAALLAFDWHPIERT
FT                   VSTRRADTAPALGAVRVSVTTSHTGPRGQGVRFWLTCPRCSRRCGVLYASRWGAQGEHL
FT                   PQPLTGCRECLGLTDASRQRHGCPDWAGHVLAQRVDTRKPYRARAWGAAHDRALYVSRA
FT                   SAARALPGYFPKPSRPERWGLGPCPWGKAAGGRRAYERGSAGGRDLGEPQPVPLPSVEH
FT                   LGAV"
FT   gene            complement(528994..529986)
FT                   /locus_tag="DR_0528"
FT   CDS_pept        complement(528994..529986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0528"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10110"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY7"
FT                   /protein_id="AAF10110.1"
FT                   /translation="MNGENYETNAAGVLDMPQGQTVERDPRGANAQRHGILSEHVSEGE
FT                   REAYAQHVEQIRASTGAASYLEQRLADRAALALWRLDRVARYEAAQIREAQRSTRAAIA
FT                   EGEGYRGTGNVKRARARLADAAGTSPHLLAAVPGLPEHKAAQHDRAAAHLSRWAGGGSA
FT                   EGLGERDAAHLGAALAGELLDADPPARAGDMVRAMLGRAPRRGEAASVEGHKWTYEPGE
FT                   LPGLLAFYREFWGDEAGEMLGESAEFERGEAAKIRAAQREALSAEADALALAALPGEAE
FT                   AQKVTRYEAHLERVLYRALHDLEAARREREGRDTPGPLRGVLGEQHPSE"
FT   gene            complement(530455..530718)
FT                   /locus_tag="DR_0529"
FT   CDS_pept        complement(530455..530718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10111"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY6"
FT                   /protein_id="AAF10111.1"
FT                   /translation="MTRAKMNAVTWAALDVYAGTVEGQAVPGLGELLSREAPRLGRLKN
FT                   AARSTAEGLGVLTPGGQLTAQGLAAVRAHVERLGLGSAGGER"
FT   gene            complement(531188..533863)
FT                   /locus_tag="DR_0530"
FT   CDS_pept        complement(531188..533863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10112"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY5"
FT                   /protein_id="AAF10112.1"
FT                   /translation="MTAPFADRIAQAEALASWAALVPVPQGTKGPRAKGWDSDPAQWIT
FT                   TPSAAREYLTAHPGAGVGLLHSESQTAALDIDHDGAALALAAVGVDLAAVLASNPYRVR
FT                   GKKGEKPIFRVPDGLSLNRHALSWPDPSGKKGPGGRPAPLTIFELRGGAGVQDVMPPSV
FT                   HPDTGRPYEWTGPVPASLGELPELPPELLSLWQRWAALLPVMRAACPWAPAELPAPAER
FT                   DLNRLGGGSSRGGEGEGASVIDTFNASRSLAEVLGEHGYKGGPHGPWLYPGSSSGQAGV
FT                   RLRPERTPRGAQVVMSWHAADPLGDGLPRDAFGVWALLAEGVDVYTADPAQRRELVKRA
FT                   ARVLGLPEPERGSAGGGAPRPAAADLPPVAWGEVAPLPPVTEPVPPLPVELLPAPLAQW
FT                   IQAEARAAGLPLEVLAGPVLVGAGGMLSAAVKLKNAPNTPAVPANLWGAVCGRPGLKKT
FT                   YAVNRGAAVLTRAQKAEFDRLDAQRSELETARGKAAAQLEALEARVKRAFKGGGKPVEM
FT                   PSDDELTEAREALREAEAALTARWYVVNDPNAETLGEILRDSPQGVTVVRDELTGWLAG
FT                   FERSGRETERAFYLEAANGTESFTLKRVSRGVVHIPLMCAGVLGGIQPGPLADVLDAQR
FT                   GAGDGLLQRFQVFIWPDIFPEFDQAAQREPVSEALREAAAAVLDGLGTLTPESLGSVYP
FT                   SGGPAPLLYTPEAQAVYDAWERQHAQALKDLSRGEAYRAHISKQPATFARLALIFHALD
FT                   VVTLGSAHPQPARVGAEAAALAAVWCEYLAAHARKLWREGRRADVLDAQTVLGYVERGR
FT                   VCDGHKVADVRRVLAEGKAGMTGPRLDAALKVLSECGAARVEVSTPPGGKAGGRPVKTL
FT                   RVHPDALAALDGAEGEGVSA"
FT   gene            complement(533860..534480)
FT                   /locus_tag="DR_0531"
FT   CDS_pept        complement(533860..534480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0531"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10114"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY4"
FT                   /protein_id="AAF10114.1"
FT                   /translation="MKPPHMAGTGRGQAGGLAQSLPESTASGAACIFVCVKAPQKPLKP
FT                   VFYSGAEAKTPAQTGKTVENGAGGLSRIVSPPTAPITSRPTPTHTGTAQGEREKPAPSA
FT                   QKLFTLPPLGGEGSPGGFRGEVFSTPTPQVLAFTPSPRVLYRELCEQHASLSEYIEREA
FT                   PEMRARGEYDALGELEKIAGRLLDRLSELQASGAHLGSAGGAR"
FT   gene            complement(534477..534773)
FT                   /locus_tag="DR_0532"
FT   CDS_pept        complement(534477..534773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0532"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10113"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY3"
FT                   /protein_id="AAF10113.1"
FT                   /translation="MTTPNPSTHAENLTRSPRVTNGRKRTTLTPEQLATLPVLDVVETA
FT                   ALLRVGQDLIRNEIKAGRLLAENYGTPARPVYRIHRAQLDAWRAERSTAQGQK"
FT   gene            complement(534930..535760)
FT                   /locus_tag="DR_0533"
FT   CDS_pept        complement(534930..535760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0533"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10115"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY2"
FT                   /protein_id="AAF10115.1"
FT                   /translation="MSAPVTLPTPKRVNVWGAYVIRVNGGCVYLPVQIVTGGWLGEPRR
FT                   VEVELMAHDVPTLGNVTPDGSLSVHPDPWTARHYRRAVMRGAGVYRWGLWAMLAPGRPA
FT                   AKPDAQAGAALGGEPVNGAEQLAGFAAWAAPVEKMSLGLPRTYIAAPQPAYLTEKLTTA
FT                   AQYGYHWGNILLSLAKHLPGGPQAVVKQLMHGFEPLGAQLRASLYSFVLQLPKGREHRN
FT                   ERRQFWRTVRVLLRVLRRMAPRKPKRRPPVRRAPRPLYSRAIPPAAPLAPPALA"
FT   gene            complement(536164..538266)
FT                   /locus_tag="DR_0534"
FT   CDS_pept        complement(536164..538266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0534"
FT                   /product="serine/threonine protein kinase-related protein"
FT                   /note="similar to PID:666024 SP:P54739 percent identity:
FT                   46.38; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10106"
FT                   /db_xref="GOA:Q9RWY1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY1"
FT                   /protein_id="AAF10106.1"
FT                   /translation="MRRVRRPTMAEWPEQGARRAGRYLLDEQLHSTPHEALYRAHTEWN
FT                   EQVLVSFYAVADPGTPRGQRARQTWLRYARSLLQVHSPHVLPVRDLIDEGEWLSLVFEP
FT                   RRTITLRELLSAGPVSPELLQPLTTALFEGLSAAHQGALLHTQISPEAVWFDTQKRPLL
FT                   AEFGLARRTAQELRDHWPHDPRYAAPELLSGGPYTPQTDLYALAATLLEAATGTALSPV
FT                   SARQQGVRLPSWPAGIPPQVAHALESCLQLDPAVRAVSAAEVLEELRRAQPTQAILSQQ
FT                   EPPAPPPSVPSPPAAPQSPDPGPTQSRAGFPWWIPLVIGLVVLGGYKLASTPRSSTVTA
FT                   VSESTSENDVSAPTETPEEVQVPVAEQSQTEEQPPEPEPSPPAEPVPTDPEPPAAIIPP
FT                   PEATPVEALPPSEDPITDDEVVTFVDDYLAAGSGHDLTAAINHYADRVTYFDQGLQAKA
FT                   ALRKDKAGYFKRWPERSYQRVSEVQTLSEGANTRQVRFNYSYDLTRPGKQLTGQAYTDL
FT                   GLIKTGGQLFITSETGKIFKELQHSVTTELPTEPSADTVAESSETRQGAPKFLNWTFGG
FT                   CVDDAGGTEQAYLTPGQIQHCAVVIETIPNGTSPIRAVFNYELEYEEDGTTQKFPIDAP
FT                   DVWPSQTAGVLATDFLQDGSTLIFTLPLTVRERSDRSYTQINAIGTVTFDNGSEKNVYV
FT                   KIPIYR"
FT   gene            complement(538235..540712)
FT                   /locus_tag="DR_0535"
FT   CDS_pept        complement(538235..540712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:1575691 percent identity: 55.08;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10107"
FT                   /db_xref="InterPro:IPR004830"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY0"
FT                   /protein_id="AAF10107.1"
FT                   /translation="MSFPPELAQVIDLAERTPQLLTPEQLALLGILGTYTAAIAAQHPA
FT                   TTDETVIELILNGHIKQLLDYRPSRGETWIIAQAQENPGLCEYLKTNASVPMRIRKAAA
FT                   KLSPSAPAAPLAEPPAVPEAAAPQDTATVSQCAAQVLRPLRERLLDRRTDPEITADETA
FT                   EIQATRRLWSLAARHPLLPLDLLLWLDEQRPYGEARETLLRRLEEGPLEESLLLNFAWK
FT                   GTWEERAAVARNPALPREARLGLTVDPDWWVRSAAAENPNAEPEELAALAQDPDHVTIR
FT                   EHVASHPHASGPTLLALAGDGDHAVRLQVARNPSSPPEALSLLAGDARYAIREAVAAHP
FT                   YTPSEVLDALAQDANERVQFVANLRRAPLSQAQAQQALETRRRNAKLAVAAQQAPAEML
FT                   VRLSRDRSPRVRAQVGLNPHTPSAARALLLGDQVPEVQRVAQAASPSTPGQELAALPLF
FT                   DARVREGLSSNVSTPDDLLVALSDDPLRDVRLNVLLNPAAPGGALERRLPEQPMRPVIR
FT                   QHPRYGQVQAKLNDLEWEEVGQPDVSAEALASLGQSDALRVRCKVASHPRTPQETLEVL
FT                   VNDPEEEVRSGIISRSEELAFGLQVVLAQDASAQLRQKLLRRKDVDPNVLSVVLKASLN
FT                   DGDILLSLVRHPLATPELLAELADVTRTEIREAVARDPRTPPPTLEKLTMDSQASVQRS
FT                   ILRNPACTPALLRQLANHRHLRLEVAHHSNTDGGTLEHLAYDAAYERFLRLERWTRRLP
FT                   FGEHVLLRRWRRWSKQRASARALSDVLILSAVIVHPAATPRAVRMASRLDHPNIEQARQ
FT                   DRQHAARQEAHHG"
FT   gene            complement(540833..541438)
FT                   /locus_tag="DR_0536"
FT   CDS_pept        complement(540833..541438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10120"
FT                   /db_xref="GOA:Q9RWX9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX9"
FT                   /protein_id="AAF10120.1"
FT                   /translation="MSTSRLRGDTNPYIAFSDLTLNLIFVLIFFIGGILAVGQAGWDQV
FT                   KYRKAQELVVAAVRRAPLSVRPQLLSPVQRNDPPGAQRWVFRSENMFVGESAVLTPEGE
FT                   TALVDFAQVLRSQKKNWKRIRIEGHTQTSRPNTPERWDLSATRASAVAAAFYLRGGISP
FT                   NRLAVAARGGQTPFNGHKFAPQNERVEIVVEYAQKSTP"
FT   gene            complement(541463..542698)
FT                   /locus_tag="DR_0537"
FT   CDS_pept        complement(541463..542698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0537"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10121"
FT                   /db_xref="GOA:Q9RWX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX8"
FT                   /protein_id="AAF10121.1"
FT                   /translation="MSEFLNTLFQLRPEGWLVLLAVMLPLTLYFMRALAVARQRRQQER
FT                   SFLEQIRQVVLPALDTEDPPESDEVAEDAWRAAQALPATSAVRQAVVAVTRARTLATPD
FT                   LQAATQAVGAAAQAGLSSARNIPNLLMLAGLLGTVMGLAGSIGTLVTPIRNAARATEPG
FT                   ELADALASTMSVMQGAFGASLWGILLSLGTGVAFALAARAQETFEDELNAFVHAELVPA
FT                   TFPRAITSQMERMGRYLRDAGNSFQDIHKRLQDVAVQLESVLGKAGDTLGQSLTQLSDT
FT                   SVQIEQVFGQMDTSVKELTVGLSRGVSDLVQAQESAASSLRTSSTELQQNLAQQATTVS
FT                   RLQDTVQATTSELLKQITRVGDQLGRASNSFEESGQTFRTEQSNYAARLDHSFSELSRA
FT                   LSRSRAEVQSGD"
FT   gene            complement(542702..545914)
FT                   /locus_tag="DR_0538"
FT   CDS_pept        complement(542702..545914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0538"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10122"
FT                   /db_xref="InterPro:IPR025904"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX7"
FT                   /protein_id="AAF10122.1"
FT                   /translation="MAENMRVFKTLVIGLGSTGTEILESLADRIDWEVGGLSRAPWVEF
FT                   LAVETDVAKPNRFNGTDDFKTLGVPATAWRDMLNRPELYDASIALNTWADLETLGQLPA
FT                   QSIDSGAGHIRMVGRLALLYPPNYNEIKNAISQRVARLRNLTEAQAKAALNKDNAGLEM
FT                   SVQFAVNQASGQTGVRVIVVGTLCGGTCSGTASDVGILLRTILSEEEKTLGMFTLPHPD
FT                   LGIAQKPDAEIWKTNAYHALAELNQYHLHNDRERYQSIKYPDKPEGTAILPGDAMPYDL
FT                   VYLLRPNSTETMDLLRLSNAIADRMFLNVFVPETDPMAYMVNAGPVTVQQGRAFAFSTF
FT                   GLSTIEYPMRRILEALKYRTLVHAVDRWKDRKYEGRLEEDLDTMGLTIPNLTESLLLDA
FT                   SGASVRASLDAKKNEVMRAVRNGNVQGARDAVKDLRSAFDRDTGEGLRGLVHRTVNDNR
FT                   RVAAERVMENVRGLVSSRLLDYDQGPNVLLEVMQGVQPRVGELRGWEPSEGKSGAANGV
FT                   LDELDTIRTNTLLGMFFLKGKASQQLYPALSRALDDEIKSRVNQKVREVFADRGSGQKT
FT                   EAGTLSIVEEEAEKLTRRLTMLRRRLTNQADRWRDTRARLENDSASVNGLSLFEPSPNG
FT                   SVDKEQELAVSDKQREAHAARLIRSWDALVKGVLPGVNDPDWLLGAWAVGQDNFERAQL
FT                   NALEQAAVEPFESSLRSSGKDVIRRLYEQRSPSFDPDSQAMHAATQAELFLQLNEPLGQ
FT                   VDPMSPLPRRKLLVGMHMTPDFRRAIQPWVNKSPEAKETEGIDPYRVVMLEEWYRFALR
FT                   GADDVRELSYSKPTRFNTYFTRKRSDIDWTPINDAEIRKLQEAEQLVFLSALHGNLQLT
FT                   GGHLVMEWPQQPGEPTEPEKRARRFAGSFGKAARQLAFEPQDSSRPSKSLTNAATYLRS
FT                   EIEARRKAIVGRYPTPAEGRQAYVKWLHDNMSSSSARAVRDWSDQAAQTALMAYLTQDA
FT                   DLRQALLETFPPDNNLIDGLYKDKGERLPKGRVANTQGYYCRVCGGPVGETFEDVIGQG
FT                   LKCEYHPDDVEHPFGQRYSVFG"
FT   gene            complement(545914..546243)
FT                   /locus_tag="DR_0539"
FT   CDS_pept        complement(545914..546243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10123"
FT                   /db_xref="GOA:Q9RWX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX6"
FT                   /protein_id="AAF10123.1"
FT                   /translation="MDFNDIFKQVVPLYTQMNFWLTILGTVLLWYAVSVAFAHVFFGAG
FT                   NRSAVDAANQGMNIALLLLAVALAAGAYFLFKPTDLIYLGAVTLTFLLLAIILHVIFSK
FT                   MGARA"
FT   gene            complement(546243..547679)
FT                   /locus_tag="DR_0540"
FT   CDS_pept        complement(546243..547679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0540"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10124"
FT                   /db_xref="GOA:Q9RWX5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX5"
FT                   /protein_id="AAF10124.1"
FT                   /translation="MKRHIGPYFSLASTYKAQQCDSSVMRRSYASVKRGYIILMYKTSR
FT                   SLRPHFRSPDLPLIGWLTAALMLSSTVQAQDVRGKTELMRSSLKPGVDRLLSSVNEAVT
FT                   AAGGDLDKQNVHWVMAFSTGHFKSDPLGAQAAREVASQFIAREAMTGDQVTARAWELKP
FT                   WAFRNAQGLTQQIGTDSQADKGGVERLWPTTPAVGSAGGHDTERAAVSFTKEFANSPDT
FT                   VLILLTNTAASVGSAGTKLLGTNAGSYQKMLETWTRVAGTQDGATLNIPYTIKTPGGAV
FT                   PGQMQAVVLLPKTFTATPLGNTTRTQQLDQSAQPVKAEKKNGSAAPFLLGLLGLGLIGG
FT                   LVWMLIKGGGQGGARGSLRVGDSNFSLRDMPNGRPFCVIAGPGYSEEGVAVVPVQGLPA
FT                   ERIAELVRVGKDLKVRGTSEAVTLSSVDGRVAVGNAASFPLRLDQPDHQLELTGEVRGA
FT                   GGVPREITRSLTLSYQQGDH"
FT   gene            complement(547773..548570)
FT                   /locus_tag="DR_0541"
FT   CDS_pept        complement(547773..548570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 51.82;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10116"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX4"
FT                   /protein_id="AAF10116.1"
FT                   /translation="MMKLLEPPQHQKTQHVALGTAGWGLSREQQERFGPGDSVLQRYAT
FT                   RFNAAEINSSFYRPHRPATYARWAASVQQGFRFSVKVPKAVTHTARLRECAAPLAEFVE
FT                   QVSHLGEKLGPLLVQLPPSLSFERDVVEDFFSLLHGMTLARTVCEPRHASWFTPEVDAL
FT                   LRDLNVSRVAADPAKVPAAAHPGGSLSMVYYRWHGSPKMYSSSYLDSQLARLAAQVQAN
FT                   SGDVWVIFDNTAVGAAVENGLILRNLLSSAQSERQTSCQPDPK"
FT   gene            complement(548592..549269)
FT                   /locus_tag="DR_0542"
FT   CDS_pept        complement(548592..549269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0542"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   putative"
FT                   /note="similar to GB:AL009126 percent identity: 52.07;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10117"
FT                   /db_xref="GOA:Q9RWX3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX3"
FT                   /protein_id="AAF10117.1"
FT                   /translation="MPLLLGHRGSPREHTENTLASFQAALDAGLDGIELDVRRLADGTL
FT                   AVHHDAALPDGRQLPHLTRAELPERVPTLPEVLAWAVDCEAYVNLELKWESPLPDDRVV
FT                   RMLDSIRVHGLSRRVIVSSFNPLLLRAARELAPEVERGLLYHRPYRLGPLNLPEAVGRW
FT                   VDCAALHPQHQLIDAPLISMARRRGWRVNAWTVNEVADVQRLAALGVDGLIGDVPAHLL
FT                   PAR"
FT   gene            549374..550057
FT                   /locus_tag="DR_0543"
FT   CDS_pept        549374..550057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0543"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to SP:P54554 PID:1303968 GB:AL009126 percent
FT                   identity: 53.80; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10118"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX2"
FT                   /protein_id="AAF10118.1"
FT                   /translation="MANLSSSTVMLTGAGGSLANAIAQELEDAGAQMVLVGRGEDLAWA
FT                   ADRYPAKDVLDLDLTDPASVEALRKVKVDTLVHTAGHYSVQDIQKAGAEDYADMFDSNM
FT                   LTLFHAVQGVLPAMLKQKDGQVLAVSAGQAARLSGPKAALYTASKAAVAAYILSLHDEL
FT                   KGKGVRGCVLYPMGAVDTPENRDEGMKWDAMIDPRGLAKSVAHILSRPDRAHITELKVY
FT                   PDEEE"
FT   gene            550134..550901
FT                   /locus_tag="DR_0544"
FT   CDS_pept        550134..550901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:Pyro_h percent identity: 56.68;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10119"
FT                   /db_xref="GOA:Q9RWX1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX1"
FT                   /protein_id="AAF10119.1"
FT                   /translation="MISAMMLAVIGVGLLAGVLGAILGLGGGVVVVPALEFVLPRFGHD
FT                   ITISQAVAVSQIGVLAVGLSGAAAYLQQGLVRARTGYLLSPYTIIGGAVGSFLGLVLPA
FT                   RAVATVFALLLFYSAYNLLRGLKRVEVEREPSKLVPPAMTFAGVMSGLLGIGGGTVQVP
FT                   VLNLMQGMPIRQAIATSTFIMGLTAVGNALVYQAGGLLDVKLAAGVALGVLIGAKAGAS
FT                   LQSRIPAAQLKLFFSLLLIFTAGQLLWKYWGHA"
FT   gene            550886..551173
FT                   /locus_tag="DR_0545"
FT   CDS_pept        550886..551173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10125"
FT                   /db_xref="GOA:Q9RWX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX0"
FT                   /protein_id="AAF10125.1"
FT                   /translation="MGARMTGPERTPDTELAGLPSWLYPAGFWVAVVLLAVGVLFPDFA
FT                   VLGVAWVGLVPVLAALWVLVTGWQRDRRLGMAAALALAGLGLVVVVKGFL"
FT   gene            complement(551157..551534)
FT                   /locus_tag="DR_0546"
FT   CDS_pept        complement(551157..551534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10126"
FT                   /db_xref="GOA:Q9RWW9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR041050"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW9"
FT                   /protein_id="AAF10126.1"
FT                   /translation="MQKATEAFTLIELLVVMTIIAILISVLVPSLAGARSKAYDSATTS
FT                   YLRHCASALEISRDDLGVLPSPPPTSCEDPALGVNAQSKPASVKQSQVTVTSSGTAYTI
FT                   SALSQSGKTFTYDQGGFREIP"
FT   gene            551643..553085
FT                   /locus_tag="DR_0547"
FT   CDS_pept        551643..553085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10135"
FT                   /db_xref="GOA:Q9RWW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW8"
FT                   /protein_id="AAF10135.1"
FT                   /translation="MTMMSLAQQDANTFRLAWFARAWAIAVWLHLAAEPRGAWATQPPL
FT                   AVLSVLLALAAARAFLAPRDRRAVLALCVLLPLHAWAEAPVVGNHWVLAALVSLSFCLD
FT                   AVRRFLLPSSSFMPGELVRSARLTLLIAYAFAAFAKLNWDFLNPAVSCAVFYQDQLVRS
FT                   WNLPDLSVASVPVLGRSLAVLTVVIELAVASLLAFSRTRRFGLVLAFGFHWMLALDLEQ
FT                   HFWDFSSVLFAGFLLFLDDGQVAWLRQQFGAWPKWRPRPFFLPLLIGCLGAAIAVLNIL
FT                   PLELGSAATLQQWGHVAWWGYGTAWVGLIAASLFAPKLPSHRAYERHRVPAILLVPPIL
FT                   AAFNGLTPYLEIKTGFGWNMYSNLKTVAGQTNHLLLPGTWDLTGAQRELVQIVSSTDPA
FT                   LQRLHDEDYGLTFSEFKNYAHRFPNSAVTYRWQERVHHAPRLGDDPVVQGSVNVAAQKL
FT                   ISFRAVDLQAAQRCQPNFSPAR"
FT   gene            complement(553128..554072)
FT                   /locus_tag="DR_0548"
FT   CDS_pept        complement(553128..554072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0548"
FT                   /product="pilin, type IV, putative"
FT                   /note="similar to GB:L35847 PID:532491 percent identity:
FT                   47.48; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10127"
FT                   /db_xref="GOA:Q9RWW7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR041050"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW7"
FT                   /protein_id="AAF10127.1"
FT                   /translation="MLCGGTRGVVSKAVGPFPGQGGEQARQRGPQRQGGSEMVWETLPE
FT                   AASLFACSSPGAKAGRTARQHSTLARALAAASPSDRTCTVLSQKAQARPAGQNFRWGPT
FT                   QGNVKPRKRNVRNFRLLYGQAGAGIPVTANAISRQRGTIHTLSAAPNHRRFTMKNTTQG
FT                   FTLIELLIVIAIIGILAAVLIPNLLGARAKANDSATQSYIRNCYTAVEVARGADGRLPA
FT                   AGNCDSTANLGTNAVATPGAITAAGAYSLDGTGSKFAVTATSVTNKTFCFDGAKMGEGT
FT                   GATGACTFSTSTGTGTGTGTGTGTGTGTGTGSN"
FT   gene            554038..555384
FT                   /locus_tag="DR_0549"
FT   CDS_pept        554038..555384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0549"
FT                   /product="replicative DNA helicase"
FT                   /note="similar to GB:D26185 SP:P37469 PID:467330
FT                   GB:AL009126 percent identity: 69.33; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10128"
FT                   /db_xref="GOA:Q9RWW6"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW6"
FT                   /protein_id="AAF10128.1"
FT                   /translation="METTPRVPPHSNDAEISVLGSVLLDNDTLAALGDTVTPEMFYREG
FT                   HRKIFAAMRQLQDHREPVDLVTLSEHLRVAGELDNVGGNAYLIGLSEQVPTAAYAEHYA
FT                   RIVQEKHTLRQLIQASGKAMQLAYEQQLPLEDLLDKAEKMIFEVAEQKKKGEAFQAMNE
FT                   VVSDTFEYITLLHANKGIPDGVSSGFRDLDEQISGLQKGSLNVLAARPSMGKTAFALSI
FT                   AQNVALRGEKTVAVFSLEMPAVQLALRMLCSEARVDMNRIRSGHLNERDFERLAHAAGR
FT                   LAEAPMVIDDEPDLTLNALRSKLRRIAAQHGQLGLVVIDYLQLMSGGKSSGGSDNRQQE
FT                   ISTISRGLKGLARELEVPIVVLSQLSRAVEQRPNHRPMLSDLRESGAIEQDADIVMFIY
FT                   RDEYYNKETDQQGIAEIIIGKQRNGPVGTVKLQFHSAHVRFNDLAPEGM"
FT   gene            555381..556133
FT                   /locus_tag="DR_0550"
FT   CDS_pept        555381..556133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0550"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GB:AE000666 percent identity: 60.20;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10129"
FT                   /db_xref="GOA:Q9RWW5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW5"
FT                   /protein_id="AAF10129.1"
FT                   /translation="MMAEEGKSGPRPRQGEQPQKRQGPPQGQGTQQAQGGQRRRRRRRT
FT                   PPQQPQNPRPGQVTNTTATPTPAPPKKRGQKRPAGEPRIGVGCIVLRGEEILLVRERGR
FT                   WSLPKGGLEAGELIQDGARRETFEETGLVVELRDLAFIVEFQAETWGHHLQFFYTGREV
FT                   SGTLQPRDPDRDVQEARFIPIRQLREFIRFRPRLVALETWLRERRPRHFVFNLDKEPAM
FT                   LRKRRRVGEGGVVVPVPSLDDADGEPDF"
FT   gene            complement(556197..557441)
FT                   /locus_tag="DR_0551"
FT   CDS_pept        complement(556197..557441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0551"
FT                   /product="glutaryl-CoA dehydrogenase, putative"
FT                   /note="similar to GB:AE000782 percent identity: 59.75;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10130"
FT                   /db_xref="GOA:Q9RWW4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW4"
FT                   /protein_id="AAF10130.1"
FT                   /translation="MNDKQLKQLSRALGVGGSGRQRVLPAADGDYYDYLDTLTDSQVEV
FT                   AGRVHDFMRAEVMPIMNEYWSRDEFPRDLIGKMRELNLLRSIWNEDGTRKPDATLIEGV
FT                   VILEACRVDVSTAVFFGVHGGLATASIALGSDEEQKKRWLPDMLDMKKIGAFGLTEPEG
FT                   GSQVSEGMRTTCRRDGDGWVLNGEKKWIGNSTFSDFTVIWARDEETNEVRGFVVEAGTP
FT                   GYDVEKIQGKIALRMVENGHITLKDCRVADANRLQAVQGWETVSQVLKLTRAGVAWQGV
FT                   GCAMGAYELALAYTQTRKQFGKRIGEFQLIQSHLTHMLADVTAMLGMVMRLSHIADEGR
FT                   MDDAHAALAKVHTAARCREVVARAREVFGGNGILLEHGVAKHFCDTEAIYSYEGTNEIN
FT                   TLVVGRAITGLSAFV"
FT   gene            557655..558275
FT                   /locus_tag="DR_0552"
FT   CDS_pept        557655..558275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000520 percent identity: 49.25;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10131"
FT                   /db_xref="GOA:Q9RWW3"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW3"
FT                   /protein_id="AAF10131.1"
FT                   /translation="MLAWILVGGRLTPTFALAGLPTPELVVAADGGARHAAALGVKVDL
FT                   WVGDFDSSDGLELDAPREVHPVAKDQTDAELAVSLARRRGATELVFIGAFGGRFDHAAA
FT                   LLLGGVRLAREGLTVTLTSGDEWGWPLLPGRPLRLGLPAGVTLSVLACTDLGGLSLSGV
FT                   RWPLTGADIPLGSGWTLSNETLGGPVTAHLETGHALVTALWAE"
FT   gene            complement(558279..559697)
FT                   /locus_tag="DR_0553"
FT   CDS_pept        complement(558279..559697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10137"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW2"
FT                   /protein_id="AAF10137.1"
FT                   /translation="MPRSAPSAPRRVTARSPLWLSALLLVPALLTACTSSEPEPAAIPK
FT                   RLQDTRTFNPITPTLTALPGAQLFQGLYPGIQGQAAYVVEVPHNWNGTLVMYAHGYAGM
FT                   GADLKVQTPSLRAEWLAQGYAWGASSYSSNYYDVRAGLEDTNALALEFSRLTGQAAPRK
FT                   TVIMGVSMGGQVASAAVEAETQQTARSRVNYAASMPVCAVLDPVYEFQWLGDYTQAAAQ
FT                   LAGYGGTYPNADFQKNLPAIKAALFTSSSGPLWQENGGAGANLRDLARQLTGGERPVFE
FT                   LGFRTGALQNAVLGTGGSDGTVNGILARNLYDNRTVTYRWTTGPVPTPAEVSFNAALPR
FT                   VAADQGANPRLPGSVRWLPVVEGRVKVPVLTMHTLGDFYVPFKHEQNYRRAVEGQGNGR
FT                   WLAQRAVRAPGHCDFVKAELAEGFRDLMAWEQTGQKPAGDDVLTPSVVADPTYGCTFTR
FT                   ETRPGVAACPAGKP"
FT   gene            559740..560474
FT                   /locus_tag="DR_0554"
FT   CDS_pept        559740..560474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10136"
FT                   /db_xref="GOA:Q9RWW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW1"
FT                   /protein_id="AAF10136.1"
FT                   /translation="MCKERLPLSARRARAFVTEDAFRWNVRHGVRVFSSVMNRRGPGCG
FT                   CLGCGGTTLLVLALLAFAAWTFVVKPARDFVAGWQTPSTQSTAARPPAPQGDVNAPLTQ
FT                   ADVQRFVRVRRQVRSALGPSFGELQKVWQDAQSGQSPSLTQLLAVMRQTADHVGAARQA
FT                   QQAALAKEGMSNERYAVVRAGVNRALGLPSFDLKKIAEGLQNGQLPDLDTSVKPATPEE
FT                   KALVAPFDPELRASAAAGLLGL"
FT   gene            560682..562049
FT                   /locus_tag="DR_0555"
FT   CDS_pept        560682..562049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0555"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /note="similar to GB:D26562 SP:P23893 GB:X53696 PID:41621
FT                   PID:473813 percent identity: 68.94; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10132"
FT                   /db_xref="GOA:Q9RWW0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWW0"
FT                   /protein_id="AAF10132.1"
FT                   /translation="MPSPRFASLRNMTLSETHPTARSEALFVRARAVTPGGVNSPVRAF
FT                   RSVGGVPRFIASAQGAYLTDADGARYLDYIGSWGPMILGHNHPAVRDAVAQALASGTSF
FT                   GAPNEREVELAELIVELTGAERVRFVSSGTEATMSALRLARGYTGRKFIVKFRGNYHGH
FT                   ADGLLVEAGSGLLTNAEGDLGAAAPSSAGVPEEYAGLTLVLDYNDPEALDALMAQRGDE
FT                   IAAVIFEPVVGNAGVLIPTSDFLAALHRVRDFGAVLIADEVMTGFRLSLNGATGLLSLD
FT                   PDLRCWGKIVGGGLPVGAYGGRADIMDFVSPQGPVYQAGTLSGNPLAMAAGIATLRELK
FT                   ANPGLYRQLDEYAARLAAGLRGAAERAGVAVSINHIGSMLTVFFQDAPDGSVRDYAAAA
FT                   RSDTAAFAAWFQGLLARGIYWAPSQFESIFISAAHGEPELAATLEAAAQAFEGVKP"
FT   gene            562046..562474
FT                   /locus_tag="DR_0556"
FT   CDS_pept        562046..562474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 59.85;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10133"
FT                   /db_xref="GOA:Q9RWV9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV9"
FT                   /protein_id="AAF10133.1"
FT                   /translation="MTELRQPSEIAQALSQSKVVAVVGFHHDPMKPAHYVPEYLSRQGY
FT                   TVIPVNPSLAERGQSFFGQKAVSSLAEIATPVDIVEVFRRSDKVPEHLPDILSMSPAPR
FT                   LVWMQQGIRNEAVARTLHEAGIDVVQDRCMLTDHRGLL"
FT   gene            complement(562484..563317)
FT                   /locus_tag="DR_0557"
FT   CDS_pept        complement(562484..563317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10138"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV8"
FT                   /protein_id="AAF10138.1"
FT                   /translation="MIAGKAVTKETTHPGFHVQLPVFEGTLGELAAALRSERLLPGEVP
FT                   LLQLTREVLAWAEGVTGLGVTGLGVTGQSPAAFADAHPDLLPTLAGVIALKARLLLPRP
FT                   EPEDVADDWGADDGFDEVLEGVEALAELGSLVAFLAARRQAREGLLPARPAPVTLPRRE
FT                   RPRNPQGSLAKLVRAAQNAVRQVEVPLLARERLSLADALTALRAFGSRLRVFDFWTVHA
FT                   DDWGERTTYFAALLEGVKEGSFQVEQPEMYGDIRVHAAQAETKEETGGEVPSPVS"
FT   gene            complement(563314..564306)
FT                   /locus_tag="DR_0558"
FT   CDS_pept        complement(563314..564306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0558"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="similar to GB:M14742 SP:P00953 PID:143784 percent
FT                   identity: 64.42; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10134"
FT                   /db_xref="GOA:Q9RWV7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWV7"
FT                   /protein_id="AAF10134.1"
FT                   /translation="MSRVFSGIQPTGDPHIGNYFGAMQNYVRLGEQYGKQSLYCVVDLH
FT                   AITNPGAFDPQTLAQKTFDMAVANFAIGLDPSKVVFFVQSHVPEHQELSWIFTCVTPVG
FT                   ELERMTQYKDKSAQFESVPSGLLMYPALMAADILLYKADIVPVGEDQTQHIELTREIAR
FT                   KFNHNFGETFTEPKAVYNKEALRIPGVDGQGKMSKSKGNTIGILEPFGDIWQKLRVAPT
FT                   DPARVRRTDPGDPDKCLIGDYHKLFSPPETLETVYQGCRTAGIGCVDCKKMLMTHITEH
FT                   LDPIQTRAAQLRADPDYVRDALRQGDQEARAIASEVMDEVRQKVGFLKL"
FT   gene            564388..564459
FT                   /locus_tag="DR_t13"
FT                   /note="tRNA-Ala-3"
FT   tRNA            564388..564459
FT                   /locus_tag="DR_t13"
FT                   /product="tRNA-Ala"
FT   gene            complement(564574..564645)
FT                   /locus_tag="DR_t14"
FT                   /note="tRNA-Val-2"
FT   tRNA            complement(564574..564645)
FT                   /locus_tag="DR_t14"
FT                   /product="tRNA-Val"
FT   gene            complement(564716..566299)
FT                   /locus_tag="DR_0559"
FT   CDS_pept        complement(564716..566299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0559"
FT                   /product="fibronectin/fibrinogen-binding protein, putative"
FT                   /note="similar to GB:L28919 PID:496254 percent identity:
FT                   53.33; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10139"
FT                   /db_xref="GOA:Q9RWV6"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV6"
FT                   /protein_id="AAF10139.1"
FT                   /translation="MPRWRSAVEGLMLNRVVEQLTAQLPARNLGWVFPDETTAALLLDG
FT                   PDGQPLGNLVLGYRPPQPVLFLSRERLRGDPHNPFQRLLATRVRGELLKIEQFKLDRVV
FT                   ALHFGPAEGFIDQPPARLLFEVTGRNANLLVMEEGEGFAGRITLAAREITGSRNRFRTI
FT                   RSGGPYTPPPPYDKFDPRTMTPADAQTLAGVPLSEWRGRVDGLGPMLSAELARRAEMRP
FT                   SQAPGDDWERAYDALKSLVADPSVSEGTLSEGAREAARQEKAGALRKLLREPLEKRVTL
FT                   LENQLGDVTRAEEGVEIAAQDRAEADLLMAYAQTVEPGAASALLPSFDGEGEVPVSLEP
FT                   QLSAVQNAEKRYARARRRDEVYLRLAEREGSIRSELEAARERLHRLDHAELEQLEQLAS
FT                   DLEREKPERSPYGARYVTPGGYEALVGRNNKENATLTHRIGKSLDWWFHAQGYPGSHVL
FT                   VRSGGKDLDLPDILYAAQLAASHSKARGSSNVPVDYTRIKHVWRPRGAPAGQVHYTDQK
FT                   TVFVDGDQPG"
FT   gene            complement(566403..567533)
FT                   /locus_tag="DR_0560"
FT   CDS_pept        complement(566403..567533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 63.37;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10140"
FT                   /db_xref="GOA:Q9RWV5"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV5"
FT                   /protein_id="AAF10140.1"
FT                   /translation="MLGWAWWGGPLLRMCARCFAAEVRKSPAPASMLWAMKRLLAALLG
FT                   ALLLPSAHAQLGQPTDALLKSPLFVGAQTSRAGIITLKSGVNVVLGQRGGRLTTVTITT
FT                   PYTEPQGISGSSDTAVAAGSVEQRVGGSALAAQTVGAVTGYGEGLSAPLLQFLRQPDVV
FT                   KQLPQGVTVDAPPLTIQAQVQGRALVLKLSMTQVPAGQFTATKNLRPAAKPGKDVVLRV
FT                   YSDFQCPYCQKLELETMPALLRALPDDVRVEFHQFPLEQIHPLARPAAEASECAAQQGR
FT                   FWDYKDALFRDRSWLQNNPNETFLRLAGDLKLDPGKFKDCLALRGGKAGVDAGLAEAQQ
FT                   LGLNATPTVFVDGYRVGNPFDTAAVLQLIDVARATR"
FT   gene            567840..569021
FT                   /locus_tag="DR_0561"
FT   CDS_pept        567840..569021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0561"
FT                   /product="maltose ABC transporter, periplasmic
FT                   maltose-binding protein"
FT                   /note="similar to PID:1850900 GB:AE000512 percent identity:
FT                   56.06; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10141"
FT                   /db_xref="GOA:Q9RWV4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV4"
FT                   /protein_id="AAF10141.1"
FT                   /translation="MKKALTLLSLALLGQASAATLTVWTHFGENELVWLRDQAKTFEAK
FT                   TKNKVNIVSVPFDDLTTKFLQSAPKGQGPDLIVTQAHDRIGQMAAAGVIEPMDKYVTSK
FT                   TDLDKTAVQAMTYKGKLFGIPMFAESVALIYNKKLVPQAPTTWNALLSAAQSAQKAGNL
FT                   GFVMPLDNAYLTYGFTSAYGGYVFKNNGGTLNTKDIGLGNAGAVKAASFINDLRYKYNL
FT                   IPEGINGDAVKSAFTQGRAAMMISGPWDIDDIRKAGIDFGIAPFPTPPGASGKWSPFVG
FT                   VQGTVMNAYSKNKAVAAQFAKSITTADAQISFNTAGGRIPVSLAARTKLKSNPVVAGFS
FT                   RTISAGTPMPNIPEMGAVWGPWTNAITQVAQKPGQNYSQLLTKAVGEIKGNIK"
FT   gene            569132..570538
FT                   /locus_tag="DR_0562"
FT   CDS_pept        569132..570538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0562"
FT                   /product="maltose ABC transporter, permease protein"
FT                   /note="similar to SP:P18812 percent identity: 67.25;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10142"
FT                   /db_xref="GOA:Q9RWV3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV3"
FT                   /protein_id="AAF10142.1"
FT                   /translation="MTVTARPRSLRSAVAPQGAGGVLLAVLILLLLLAAAAGIGWLLSS
FT                   ATAAVWPSAPPYMILVWGALALLLLTPLVGRAFPWIRDWFYLFPALVFVLAFTVLPVVL
FT                   TVNYAFTNYSGENSGNPDSAARTAAVLSPDRLSVRLPERGSDTPLSEALKCRTPSCVGD
FT                   TLVLYDEDAATPHEVKIASIGKDRVTLAAPAPAGLDVAYATRINRYQYVGLANFQEIFA
FT                   KASRALWPVFVWTVAFAFFTVILNALAGLILGILLYNKRLKGRNIYRTLLFLPWAIPAV
FT                   ISVQMWKALLDQNFGIVNKTLGLLGLFAVPWLNDPLWAKISILFVNLWLGFPYMMTATI
FT                   SALATINEDLYEAASIDGASRWQQITNITLPLLRQSFTPILLSTFAFNFNNFGIIYLLT
FT                   AGGPAQEGRESTAQSTDILLSWGYNTAFASSGGQNYALASAIALIIFFLTLAISLVNFK
FT                   AAGVFDEART"
FT   gene            570535..571911
FT                   /locus_tag="DR_0563"
FT   CDS_pept        570535..571911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0563"
FT                   /product="maltose ABC transporter, permease protein"
FT                   /note="similar to SP:P07622 PID:396367 PID:41951 GB:U00096
FT                   PID:1790464 percent identity: 61.19; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10143"
FT                   /db_xref="GOA:Q9RWV2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV2"
FT                   /protein_id="AAF10143.1"
FT                   /translation="MTTRPTELSSELPPGGYVHREPSVLRRAAPWLVLIALLAGLGYLI
FT                   FRLEQIPLTKGFSIYFVPGGWKKFLLFLLAASGVLALTSLLGQRLGQLRTGKNISYLAV
FT                   LGDQLTHLFLILVVLVAVYPLFYVLLAAFDPNNSLFAFPNFTNPNIFYRSGLLPQLEKL
FT                   TTENFAKLFEAVTIPGYQIALAVLGGAGLAALLLMVLAQRLGNTSEGMAKARTWVTRIV
FT                   LAAGVLLLILVTPAQFQGATNESKFLLSVRNTLFVSTVTGLLAILLSTTAGYAMARLRF
FT                   PGRFQMLLFFIFIQMFPVFLALVAIYTLLSALGLVNTFTGLILAYSGGAIAFNTWIYKG
FT                   YVESLPESLEEAAMVDGATRWQTFRRVVLPLSGSMLVFIFLNQFIGTYAEFILASVLLT
FT                   GVEQWTVGVMLRSFTSGQFSTKWGVFAAAATLGALPIVALFYSFQNYFVGGATAGGVKE
FT                   "
FT   gene            572140..572925
FT                   /locus_tag="DR_0564"
FT   CDS_pept        572140..572925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0564"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="similar to GB:L42023 PID:1006358 PID:1221197
FT                   PID:1205330 SP:P45024 percent identity: 59.21; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10144"
FT                   /db_xref="GOA:Q9RWV1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV1"
FT                   /protein_id="AAF10144.1"
FT                   /translation="MKKSLLSLKLSGLLVPSVLALSLSACSSPSSTLNQGTLKIAMEGT
FT                   YPPFTSKNEQGELVGFDVDIAKAVAQKLNLKPEFVLTEWSGILAGLQANKYDVIVNQVG
FT                   ITPERQNSIGFSQPYAYSRPEIIVAKNNTFNPQSLADLKGKRVGSTLGSNYEKQLIDTG
FT                   DIKIVTYPGAPEILADLVAGRIDAAYNDRLVVNYIINDQKLPVRGAGQIGDAAPVGIAL
FT                   KKGNSALKDQIDKALTEMRSDGTFEKISQKWFGQDVGQP"
FT   gene            572961..573641
FT                   /locus_tag="DR_0565"
FT   CDS_pept        572961..573641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0565"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="similar to SP:P42399 PID:710628 PID:1805409
FT                   GB:AL009126 percent identity: 72.22; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10145"
FT                   /db_xref="GOA:Q9RWV0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV0"
FT                   /protein_id="AAF10145.1"
FT                   /translation="MNTEQLQSILQSAWHALPTLLAATPVTLGFALAAMVLGLPLGFAV
FT                   ALARLSRLGWLRTLSGLFVSFIRGTPLLVQIFVIYYGLPSLGIQFSPVVGGVIALTLNA
FT                   AAYLSETIRAAILSIPPGQREAATSLGLSGAQTMRLIILPQAARVALPSLSNTLIGLVK
FT                   DTSLVSVITVVELLRSAQLVIARTFEPFGPYLAAALIYWLVSSLLEVVQRALERRFSRG
FT                   AARN"
FT   gene            573714..574205
FT                   /locus_tag="DR_0566"
FT   CDS_pept        573714..574205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653325 percent identity: 60.14;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10146"
FT                   /db_xref="GOA:Q9RWU9"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU9"
FT                   /protein_id="AAF10146.1"
FT                   /translation="MPAFWLLKSEPDVFSYADLMRVGREPWNGVRNYQARNFLRQMEEG
FT                   DLCLFYHSNARPPGLAGVAQVVRVAYPDDLQFDPASEYYDPRSDPENPRWSMVDVAPVL
FT                   ALPRLLPLDELRELPEWHDSPLTRKGTRLSVFPVTPEQWRAALAAVGVELPPLGKFPPA
FT                   "
FT   gene            complement(574443..576149)
FT                   /locus_tag="DR_0567"
FT   CDS_pept        complement(574443..576149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0567"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="similar to PID:1113117 SP:P53607 percent identity:
FT                   75.25; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10147"
FT                   /db_xref="GOA:Q9RWU8"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU8"
FT                   /protein_id="AAF10147.1"
FT                   /translation="MPPGLFSAQDSGAPTPDAGRFLGQPSSPAAGGGCDFCPYVLLSLP
FT                   RFFMSDPRPAPAPAPLPGTLDGMDVLRLALTSQVYGAATETPLSPAPRLSERSGNRVLL
FT                   KREDQQPIFSFKLRGAYNKMSQLSAEERARGVICASAGNHAQGVAFAGEKLGIPAVIVM
FT                   PATTPDIKVQACRARGAEVILHGDSFSDAETFALALQQERGLTFVHPYDDPLVLAGQGT
FT                   IALELLRQVEEDDYAVFVPVGGGGLIAGVASILKALKPGVRVIGVEPDDSDAMYQSLQA
FT                   GERVRLDTVGIFVDGVAVKQVGAYTFDLTRRYVDDWVRVNTDEVCAAIKDVFDDTRAVL
FT                   EPAGALSVAGLKKYAATHGLHDRTLVALTCGANINFDRLRHVAERTEIGEQREAILAVT
FT                   IPERPGAFLEFIELIGSRAITEFNYRYAPREDARIFVGVQLGQPGERQELLTLLRGRGY
FT                   AVLDLTEDELAKVHVRHMVGGRAPEAVNERVYAFTFPERPGALHDFLTQLQGEWNISLF
FT                   HYRNHGSAHGRVLAGVQVPDAALTRFGDFLAGLGYPAHDVTSNPAYRLFLT"
FT   gene            complement(576184..576726)
FT                   /locus_tag="DR_0568"
FT   CDS_pept        complement(576184..576726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0568"
FT                   /product="purine/pyrimidine
FT                   phosphoribosyltransferase-related protein"
FT                   /note="similar to GB:L77117 SP:Q59049 PID:1592237 percent
FT                   identity: 49.68; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10148"
FT                   /db_xref="GOA:Q9RWU7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU7"
FT                   /protein_id="AAF10148.1"
FT                   /translation="MLAGMDNLTITVGDVTRTLPTVRVGNLGRVPLVEFIGDSELTKAA
FT                   AQAMLPLIPDGTELLLSVVTNALPLVHELSDRSGLPYVVARKKRRTYMQDPLIQQVPSM
FT                   TLGVGETLWLDGPHAERLRGKQVAVVQDVVASGGTAQALSRLVDRAGGQVSGYLAAFKQ
FT                   GETELPLHYLQDLPRRL"
FT   gene            576883..576953
FT                   /locus_tag="DR_t15"
FT                   /note="tRNA-Cys-1"
FT   tRNA            576883..576953
FT                   /locus_tag="DR_t15"
FT                   /product="tRNA-Cys"
FT   gene            576983..577054
FT                   /locus_tag="DR_t16"
FT                   /note="tRNA-Val-3"
FT   tRNA            576983..577054
FT                   /locus_tag="DR_t16"
FT                   /product="tRNA-Val"
FT   gene            577274..578302
FT                   /locus_tag="DR_0569"
FT   CDS_pept        577274..578302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0569"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10151"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU6"
FT                   /protein_id="AAF10151.1"
FT                   /translation="MTNRRNKALLLAGFCASLLSTSALAATRVPGTYTYYSVIKDPITD
FT                   LNKSMVSIDEVNDTAGLTALTVRCSDRDNAALWITLNSKNMLLSEDDAYAGNLPALTVR
FT                   LGQDAPVVLRSSEVVSVSDSSDNFKGKAVGFQGAAARSMVSGLLSGKNVVVRVNRPAGG
FT                   QPLTYTFPAQGFSQAWSAVRACAPFGTGSAARTPAPLPSGTRAAEAPKFTRWYFTTCRD
FT                   ASSGAVRTGLLAGRAALCDLVIETIPNGARPVSATFHYELEYREGGRTGKLPLTADDHW
FT                   PPAGGPVTRFRNEGSNLVFTLPLNVRVRSERVYTSINVTAEITFNNGSVKRVYEPLPVR
FT                   PN"
FT   gene            578644..578925
FT                   /locus_tag="DR_0570"
FT   CDS_pept        578644..578925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:3341658 percent identity: 52.78;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10149"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU5"
FT                   /protein_id="AAF10149.1"
FT                   /translation="MSELPAHVIDLRPVGERDAAPLTGARVTALTLAQIEDGQHGLTPA
FT                   AGPLLVVCSRGTQADLAARYLRSDGLDAQAWRGTVAELRAHTESGAQE"
FT   gene            complement(578929..580122)
FT                   /locus_tag="DR_0571"
FT   CDS_pept        complement(578929..580122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10152"
FT                   /db_xref="GOA:Q9RWU4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="PDB:3C4N"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU4"
FT                   /protein_id="AAF10152.1"
FT                   /translation="MTGPEPVPAGPPPDPTPPRRAGSVWAHVGQHFTEEAFDIVVIGAG
FT                   RMGAACAFYLRQLAPGRSLLLVEEGGLPNEEGATILAPGVWTAQDIPAGQEAQAEWTRE
FT                   QLLGALGSGKTLEVEDRPLLHLLPAGEGSGLTPTLDALADFPEALALLDPARLPVARVD
FT                   PRALTYRPGSLALLAAQQAIGQGAGLLLNTRAELVPGGVRLHRLTVTNTHQIVVHETRQ
FT                   IRAGVIIVAAGAAGPALVEQGLGLHTRHGRAYRQFPRLDLLSGAQTPVLRASGLTLRPQ
FT                   NGGYTLVPAIHHRDPHGYHPAGGSLTGVPTGLRRELLEDLVGLMDAVPALAGEGLELGR
FT                   SSADVPGAWLALPGGRPDAPPQAEELAPGLHLLLGGPLADTLGLAAAHELAQRVSAG"
FT   gene            580230..581501
FT                   /locus_tag="DR_0572"
FT   CDS_pept        580230..581501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0572"
FT                   /product="sporulation protein SpoIID-related protein"
FT                   /note="similar to PID:1652296 percent identity: 53.16;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10150"
FT                   /db_xref="GOA:Q9RWU3"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU3"
FT                   /protein_id="AAF10150.1"
FT                   /translation="MRKRVRRRWAASLGSRALTIGALAGWALTGWSGPAQALDVRVLIT
FT                   SGPAVTVAVLPVDPAVAAAPASSALSPAPLAPAASVPLRQSWQVGVAGGNLTLDGRGTG
FT                   SPALYLPPAPGSRVELGGQTYRGGVLLRVQNQGVQAINVVDIEDYLRGVVASEMPASWP
FT                   AAALAAQAVIARTYVAARINPAKPYDTCATEQCQVYRGVRGEQPATDAAVAKTAGQVLA
FT                   YGGQPAQTYFSSDSGGYVASSDEVWNTPLPYLVAQPDPYSVSAGGPGAKWSAEVPLARV
FT                   GQLAAGYGVRVGTLSAVEVTRKSASGRAQQLTFRGTGGSRTLEGAEAGGFLRSLGAKSS
FT                   RVSLSRRGTALQVTGAGNGHGVGLSQYGALGMARAGYDHLRMLGFYYPGTTLDLLAGPP
FT                   GAVGQVDRHSLPALALAPAGEGQP"
FT   gene            581498..584413
FT                   /locus_tag="DR_0573"
FT   CDS_pept        581498..584413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10153"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU2"
FT                   /protein_id="AAF10153.1"
FT                   /translation="MKVWSPRRRSQLKHGEQKQRRSRGLTRLLLAAGFAFSTLGGLAEA
FT                   RTVKIVTAQTLELRNVDGQELVIIASPDAAGVELQVDDDQVRARRVEFNRTRRTLTLIG
FT                   AASYRTAKDGQTLSGDNLVVNLGDESLTGQDVLISDRELEIRGQEVERVPGQLRAKNGY
FT                   FTPCAKCGRTTNDYAFRAERLVVYPGDRLIAYRAQLLLAEVPVLYLPVVVLPLNDEARQ
FT                   PKVQVGRDALDGLTVEADLPFAVGSSVLGTGLVRYYQNRAPSLGGGVDLRAYAPFAAVD
FT                   RADLYLLLLPKPLDAQGNVRGEGGYDTDLNFSVRGRVPLSEATRDLDYAFTMQRRDIGR
FT                   SETDPERGVTRSELKASVEYPLYRAELNVLGRSGPEPETAITQPYRKKEVVLDPKPFSV
FT                   GGLSADFKVTAGEYSAASNPFSPSAVREGVNITTTRLEEAQELRYSRPLWTGATFEFSN
FT                   SFVGRYYGTGARTVQLSLAGQLTQRWGVQSRQSLSLRQEYLRYEGTSPFAFDAVSGRRL
FT                   NAPLSLNLNLVPVPDTTFTVGYVRDPFLKTDTQQPARFGVTVNRRPVNLTAALAYNIGT
FT                   GELDNFTYAVTLGDPESGKLRLVPAVPARPATPTTPAQPAVPAHYTRSSAWPAPRLTLG
FT                   LSGGYSRVTSIGTPGKDAPSGLQPFTVRATVAGDDRSSNFSVAATFNPDLDPQLSSVNT
FT                   EYTLARGFDTVLSPLTVSGRETLGVQYPRLTGNHTVTWRDYTFTQAHDLNLDQSETARE
FT                   SGTVTFSVGNRAGRATNWQLAYGGAYDLRRGGFTRPALTGTLTTSRPGQRLNTSLSYNL
FT                   PGLDQPYSELGRATLDGEWQSGRFSVSGYASYSRVRTGNLTDGNTANDKATDTYTFEPL
FT                   RVGVALGKAEQPSVYLTAALRQRLIYVDGERQGDDPLAPVLGFTLDRCCWAMQGEWDVV
FT                   KGRYRLTVGLPGQFYPLLEGGPDGTRVPLIPSLSRPTTPSR"
FT   gene            584448..585560
FT                   /locus_tag="DR_0574"
FT   CDS_pept        584448..585560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0574"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10154"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU1"
FT                   /protein_id="AAF10154.1"
FT                   /translation="MTSTSTAPRRARPLTAALLAAACLGTLTGCTGTEERAPNLRLAVL
FT                   TDGGQTLSYVDTAPPESANTTTPAAPTLVEAGKVEEGRDLHTADGGRALLLTRRAGAER
FT                   RTAALTPGTAFATLPFPTCLTRSAVDAARTRLLVLSECPNDVQRLALYRLDGTVVWTAA
FT                   LGTAVPPLSTPDAPPVNLAVVGDVAVVSRPALGGGSEVVRAAPRNVGDPVAVASLPERT
FT                   IAVRDLAASVGGTIYAATDSGVYPLLDTGLPDLTRRVAAFGEGRLDRLWSEPLGTRTLL
FT                   FGWHDPALSSGDAYLRVWDGVATTTTTQSVSYVTDLRDLTVAPDGNLYVLSRTALTRFD
FT                   AVLGVQNNNWQSRTLLSTLNDARALTWLVP"
FT   gene            complement(585754..588387)
FT                   /locus_tag="DR_0575"
FT   CDS_pept        complement(585754..588387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0575"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="similar to GB:D10279 SP:P28366 GB:X62035 PID:216334
FT                   PID:48980 percent identity: 67.54; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10155"
FT                   /db_xref="GOA:Q9RWU0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWU0"
FT                   /protein_id="AAF10155.1"
FT                   /translation="MRAGYTYEVMFRVLNKVFDNNKRDVERIIQTVVKPVNALEEETMR
FT                   VENLAEAFMDLRRRVQDGGESLDSLIVPAFALIREAGRRSIGKRHYDTQLIGGAALHQG
FT                   RIAEMRTGEGKTLVATLALAFNALEGKGCHLVTVNDYLARVGMEEMGLLYRTLGLTVGL
FT                   ANRELSPAEKQAAYACDITYVTNSELGFDYLRDNMAQSKEALVLRADTPLHYAIVDEVD
FT                   SILIDEARTPLIISGAAEKATDLYYVFAKLIRRLQKGEPAEPGVRTEPTGDYTIEEKSK
FT                   AVHLTEQGITKIERLLSLKDLYSPENMDKAHMITQAIRARELYHREKDYIVNAEGEVVI
FT                   VDEFTGRSMPGRRYGEGLHQAIEAKEGVKIENENQTLATITYQNFFRLYDKFAGMTGTA
FT                   KTEEKEFLDIYGSDVLVIPTNKPVIRVDSDDLIYRTRMGKYAAVVGEVQEMHATGRPIL
FT                   IGTASIETSEQLSSLLQQAGVQHAVLNAKFEAQEASIIAQAGRSGTVTIATNMAGRGTD
FT                   IMLGGNDEYIIGESIEQQLGVSRYAPEVEAFIKAISREDPAAEQLGMQIPGITLDFIRQ
FT                   AQELHRATVEDRQRVRDLGGLHIVGTERHESRRIDNQLRGRAGRQGDPGSSRFYVSFED
FT                   DLMRLFANDRVVGMMDRLGMDDSQPIEAKMVTGAIEKAQARVEDRNFGIRKQLLEFDNV
FT                   MSKQRDEIYAQRREVLLGPDEDIEETTEGMIGDFVDSQLAAYAPIEVSHEQWDIEQLRS
FT                   AMVEAVPALETFDFESLRVNSPAEAQDRLLSAVADAFDARKEELSPTMMNSLARYVLLQ
FT                   VVDQHWKEHLHGMDVLRQGIGLRGYGQRDPFTEYKFEATNMFNEMIDALKADVTKFIFR
FT                   MQFGGA"
FT   gene            588583..589350
FT                   /locus_tag="DR_0576"
FT   CDS_pept        588583..589350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0576"
FT                   /product="RNA methyltransferase, putative"
FT                   /note="similar to GP:3046324 percent identity: 57.98;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10156"
FT                   /db_xref="GOA:Q9RWT9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT9"
FT                   /protein_id="AAF10156.1"
FT                   /translation="MSSAAPSPTAQSLAVVLVSPKTPGNIGAAARAMLNMGASDLRIVA
FT                   PRCDYLDSQAVAMAVHAGDLLRSAKIYPTLREALADRDLSVGTSARIRADLPAPRHPAQ
FT                   VRGLVREAAAPALVFGPEETGLINSDLEQCQVTVRIPTGDYASLNLAQAVLLVCYEFLQ
FT                   GQDDVPEHSRQTATREDMEAMYGHLQDTMHLIGYTDAVRGRHTMRLWRAMLDRALMSSA
FT                   ESRMFRGLLRQVKWKVEQGSGKASTEIRIESEE"
FT   gene            589404..591176
FT                   /locus_tag="DR_0577"
FT   CDS_pept        589404..591176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0577"
FT                   /product="sensor histidine kinase"
FT                   /note="similar to PID:1916864 percent identity: 50.12;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10157"
FT                   /db_xref="GOA:Q9RWT8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT8"
FT                   /protein_id="AAF10157.1"
FT                   /translation="MPRPMLGVMSPTSAVTPPPAVPPSPAQTLRDVRLSDRVRLVRNVL
FT                   PPLIVLVVIVVELLITQLPNRHAELVAHLLFYGLVGPAVTFFSVEWIAQGTRARERAER
FT                   ELRELYIELSTSNGQLRAVQELMRDLADAPDLAAVVEVAVRGAVRVTGATHATLSVPGG
FT                   LSATARGDTLLSGPSADLHPLRRPIPGGGAMTLHFQGPPTPHTVALVEALAGEIANGVE
FT                   AARQRTLDLMTLFNVDQSIRAERNMRRLLSRVTRNMAERLGADARAAYLFDQDGVLRLE
FT                   YAQDFAGREEVGGSPAPAFALRVAQEGTPLQAEGEEAAGVFSHAASVLGLPMRDDQGPV
FT                   GVLVLGDARADAFEGARVPLLAFMAGQATLAVRNARAYLYSEELAISDERARIAREIHD
FT                   GVAQSLAFAAIKLDLVGRKLRSDPDKSEADVKEASALLREQIREVRRSIFALRPVDLER
FT                   YGLLETVRRYVADFGEQNGVRTNLDLTGDIHLSPGDEAVVFRILQESLNNVAKHARARE
FT                   VTVSLHGGANRVTLRVQDDGQGFDPDAVSGRVSSAGGLGLMQMQERLEARGGSYRILSA
FT                   PGHGTVVEAQLPQL"
FT   gene            complement(591238..591675)
FT                   /locus_tag="DR_0578"
FT   CDS_pept        complement(591238..591675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0578"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10161"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT7"
FT                   /protein_id="AAF10161.1"
FT                   /translation="MKRLLCLALLLVTATASAGSLRGALIVASDGTFLGTCDGKYSATS
FT                   IANDYGKYGNAYSATSMFNTYSQYGSDYGSLSAFNDYSSSAPYLLGADASLLKMFTSFS
FT                   YRPTPGIVKALRSSGGARVSTNRALAKAIDPNVLRVACENP"
FT   gene            complement(591737..593005)
FT                   /locus_tag="DR_0579"
FT   CDS_pept        complement(591737..593005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0579"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /note="similar to GB:L10328 SP:P24285 PID:290489 GB:U00096
FT                   PID:1790070 percent identity: 56.40; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10158"
FT                   /db_xref="GOA:Q9RWT6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT6"
FT                   /protein_id="AAF10158.1"
FT                   /translation="MNRTPTLRAPDLAGVPDCLVIVGGSMAAVKAPTALRRLREGGAST
FT                   AVIATRAALAFITPLSLATAGNCEVATDETWFAPQPIAQHLSLARARVTVVLGASAELL
FT                   AAAAHGHADTLATATLLSAEGQVLWVPAMNERMWLHPAVQANAERLRGWGHLFLGPETG
FT                   AFGTPGEGSGTGRMAEPEAIAARALALLNEQDAEAEAAPQDLAGLKVVVSAGPTREYLD
FT                   PVRFISNPSSGKMGFAVAEEARTRGAEVVLVTGPVNLPDLSGVQTVRIETALEMQAAIM
FT                   EAAGDADMVVMTAAIADYRAAAPKSEKEAKTPGDVTIHLTPNPDILAGLGAEQAAHPGR
FT                   VLVGFAMETHAGVERAALKAQRKNADFILLNYPTREGTAFGGDDNQVTLVRADGTHADW
FT                   PRISKREVARRLLDEARQIRERR"
FT   gene            593206..593973
FT                   /locus_tag="DR_0580"
FT   CDS_pept        593206..593973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0580"
FT                   /product="acetyltransferase, putative"
FT                   /note="similar to SP:P28266 GB:X61083 PID:45786 PID:1326069
FT                   percent identity: 52.38; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10159"
FT                   /db_xref="GOA:Q9RWT5"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT5"
FT                   /protein_id="AAF10159.1"
FT                   /translation="MLAQVMYGRDYAEVLAQMPLAALNLDAHNVTFEAEYYMATDQEKF
FT                   ARVKPLLWLWKNLDLTPFGQNPVTGIPLRRVLAGHIFKRVGRNFKCWQNVEFSVGYNME
FT                   VGDDVVVHRHVLLDDIGGIELHDGASVSDYVNIYSHTHSVLDGPDVTLRKTVIGRGARI
FT                   TYHSTVLAGSVVSDDALLATHALLRSDIPPHGIAMGIPAKVTRFKQRPPQDGYGVDAAL
FT                   WKRTPDRKANPEFPDPTPNQTRKPDELLVAGEG"
FT   gene            complement(593986..594483)
FT                   /locus_tag="DR_0581"
FT   CDS_pept        complement(593986..594483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0581"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT4"
FT                   /protein_id="AAF10162.1"
FT                   /translation="MKKFALPLAFMSLLSLAAASTPGNNLVVLNDGAKLCYDGYAVVDG
FT                   KESKTLNKSAETRMSAMLSGLGIKASEFDAADRCDRVVSLTYEMDNKGAPGIVVARLEL
FT                   LSNLTLDNDQDVALPTLWEGRTWRAQKGIYSAQDAQKVFDTVLSDLFKMFKDDYAQRNP
FT                   KK"
FT   gene            594495..595226
FT                   /locus_tag="DR_0582"
FT   CDS_pept        594495..595226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10163"
FT                   /db_xref="GOA:Q9RWT3"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT3"
FT                   /protein_id="AAF10163.1"
FT                   /translation="MRPRIPSFRRLPAGDAVKSDRAFRRRSRLVPGAAPTIPGMTNRKS
FT                   SGVGTAVLVTVATVGAAAGAALLARRRKGDIKEFVVANVLEKPAGRSSFTDLGQNLERG
FT                   GTFLTGRAERAADTPENREVLAHIIGIERWGQSRIQVALGQREFVRDEYRGYRPEGGAT
FT                   LGQLRSLLSQTRARTVDLARQLHFNPPDDDFVVEHNGLGPLTAKGWLRYLNQHADLESR
FT                   KLRGAGGTAVHEEETQQAPAS"
FT   gene            complement(595289..597145)
FT                   /locus_tag="DR_0583"
FT   CDS_pept        complement(595289..597145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0583"
FT                   /product="cell division protein FtsH"
FT                   /note="similar to GB:M83138 SP:P28691 GB:U01376 PID:146028
FT                   PID:606116 percent identity: 69.22; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10160"
FT                   /db_xref="GOA:Q9RWT2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT2"
FT                   /protein_id="AAF10160.1"
FT                   /translation="MKWWGWALLALTGGLLVLVLSGSPRSQSELNVNDFTQAVRTQQVK
FT                   TADISFQNGTALVTGRLTSGLPYRARTLPADPVLKLGTLEGRGVTVTYLPPPRISVLGA
FT                   LSVLLTLALIGGLIALLVRSRNGGNNDAASSFGKSKAAIISEGQIKLTFADVAGCDEAK
FT                   QDLQEVVEFLRQPEKYHQLGARIPRGVLLVGPPGSGKTLLAKAVAGEAKVPYFSISGSD
FT                   FVEMFVGVGAARVRDLFEQARKASPCIVFIDEIDAVGRKRGMNIQGGNDEREQTLNQLL
FT                   VEMDGFGSGQDVIILAATNRPDVLDAALLRPGRFDRQVVVDAPDVRGREQILRIHSRKK
FT                   PLDVSVDLGVIARRTAGMVGADLENLLNEAALLAAREGRNRITGRDVDEARDRVLMGPE
FT                   RRSMVVREADRKVTAYHEVGHALVAQLLPHSDKAHKLTIVPRGRSLGSALYTPEDRMHH
FT                   TRTALLDRICVALSGHAAEEVIYGEVTTGAQNDFQQATGLARRMVTEWGMSEVGQLALA
FT                   QDNGNYLGFGPQPTNYSDHTAEQIDTAVADILNTQYARAHALLSEHVHVLHRLTDELVA
FT                   RESLSGDELQTVLNGGTLPELPAAVRPEGAPPPEGTLRPEGA"
FT   gene            complement(597451..598347)
FT                   /locus_tag="DR_0584"
FT   CDS_pept        complement(597451..598347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0584"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="similar to PID:560524 SP:Q50453 PID:1694867
FT                   GB:AL123456 percent identity: 67.89; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10164"
FT                   /db_xref="GOA:Q9RWT1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT1"
FT                   /protein_id="AAF10164.1"
FT                   /translation="MTTPDAALPELPDLSQTATLTISCADQPGIVAAVSQFLHNHGANI
FT                   IHSDQHSTDPAGGQFFMRMEFFLGGLDLTREAFERAFEQVVARPLGMDWRLNLASQPKK
FT                   MAVLVSRYDHCFLDLLWRRRRGELNVEIPLILSNHEDLRRDAEMFGIPFHVIPVTKANK
FT                   AEAEAEQVRLMHEAGADFAVLARYMQILSSDFLRGFGRPVINIHHSFLPAFIGANPYRA
FT                   AFNRGVKLIGATSHYVTEELDAGPIIAQDVIPVTHRETPDTLMRMGRDVERQVLARAVK
FT                   AHVEDRVLVYGNKTVVF"
FT   gene            598411..599553
FT                   /locus_tag="DR_0585"
FT   CDS_pept        598411..599553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0585"
FT                   /product="aminopeptidase"
FT                   /note="similar to SP:P24828 GB:D13385 PID:216238 percent
FT                   identity: 51.33; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10165"
FT                   /db_xref="GOA:Q9RWT0"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT0"
FT                   /protein_id="AAF10165.1"
FT                   /translation="MASCRTLSLMTSTSMASLLAYDPERHAELLAHYCLSAQPGERLLV
FT                   GASTAAAPLVAATSRALLRAGARPAVRLSYPGQDEDFAALAADAVLDEVPQGELDDMRG
FT                   MDGSLRILTPEAAQPADAARAARLLASRAELAALRSQKKWSLTLYPTPHAAAQAGMTLA
FT                   EFEDFVMRAMFLDRPDPVAAWGEVRELQARLIERLSRADVVRIEAPGTDLTLRVGGRIW
FT                   SNSDGKRNMPSGEVFTGPLEDSAEGVVTFTVPASYQGQTVRGARLVFRAGQVVEASAEE
FT                   GEAVLHAALDTDPGARRLGELGIGTNFGIQRGIGNILFDEKIGGTVHLAIGKSYPETGG
FT                   LNRSAVHWDLITDLRAASGAGGGRLLLDGEVWQEGGRFLS"
FT   gene            599523..599942
FT                   /locus_tag="DR_0586"
FT   CDS_pept        599523..599942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:U00096 SP:P75832 PID:1787108 percent
FT                   identity: 69.77; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10166"
FT                   /db_xref="GOA:Q9RWS9"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWS9"
FT                   /protein_id="AAF10166.1"
FT                   /translation="MARRGALPVLKSAAPLGGGARPILGAMTRPTIPPGPPGAEGRTQT
FT                   LERTETKKPRLWRVLLLNDDYTPMDYVVQVLEQFFRKTEQEAELIMLAVHHKGQGVAGV
FT                   YTRDVAETKVAQVTAHAQREGHPLRVVAEPESEGE"
FT   gene            599939..600859
FT                   /locus_tag="DR_0587"
FT   CDS_pept        599939..600859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0587"
FT                   /product="mrr restriction system protein"
FT                   /note="similar to SP:P24202 PID:42020 PID:537193 GB:U00096
FT                   PID:1790811 percent identity: 60.91; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10167"
FT                   /db_xref="GOA:Q9RWS8"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS8"
FT                   /protein_id="AAF10167.1"
FT                   /translation="MTVPDFQAFMRPMLEQISSGEPQKIAELYRRLAEFFALTPQDTEE
FT                   LLPSGKQAKYHNRILWAKFHLDRAGVLTTPSRGVVQITPLGREFLSRYPEHIGMRELQT
FT                   IPAYAEFTRRSRSPAQSPAPAAPPQAECSASVPPAEQIDALYAELTANLAEELLAQVKE
FT                   LSPAQFERLVVEVLVAMGYGGSVRDAGQALGRSGDNGIDGLIKQDPLGLDRIYLQAKRW
FT                   KNTVHSPEIRTFSGSLTYHKATKGVFITTSGFSDGAKATAGQIGNIILLDGETLAHLMI
FT                   EYGVGVLTRETYQIRRLDADYFEEL"
FT   gene            600865..603090
FT                   /locus_tag="DR_0588"
FT   CDS_pept        600865..603090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0588"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpA"
FT                   /note="similar to GB:M31045 SP:P15716 PID:145549 PID:499142
FT                   GB:U00096 percent identity: 72.69; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10168"
FT                   /db_xref="GOA:Q9RWS7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS7"
FT                   /protein_id="AAF10168.1"
FT                   /translation="MLSEHLQAALQRAADLAQAAGHEYITQEHLLLALLGDPEAKDALN
FT                   ALGADLNALREALTEQLAELDILDDPDPDFTLGVHRVVQGAVLQLHASGKGKEQADGAR
FT                   VLVELLEEDDSPARAALEAQGVTRLDLLNYLSHGVAKAPGHSRERRVAGVDGELTAEGA
FT                   PAEENPLEAYAQNLTEAAKNGEFDPVIGRGAELERVVHILARRGKNNPVLVGEPGVGKT
FT                   ALAEGLAQRVADGKAPGFLRGASVYALDLGALLAGTRYRGDFEGRLKAVLAALDGQNSV
FT                   LFIDELHTLVGAGATEGGSVDAANLLKPALARGKLRVMGATTPAELRLLEKDRALWRRF
FT                   QTVDVPEPSEADAVQILQGLAPKYAAHHGVTYTPPALEAAVRLSARYLRDRFLPDKAID
FT                   VLDEAGAARSSTGQGGEIDVPDIESTVARMARVPVGAVKAEEVQSLATLEADLNRRVYG
FT                   QEPAVSAVSSAVKLARAGLRNPQKPQGSFLFAGPTGVGKTELARALAERLGVELIRFDM
FT                   SEYQEPHTVARLIGAPPGYVGFDQGGLLTDAVAKNPHAVLLLDEIEKAHPDVYNIFLQL
FT                   MDHGTLTDHAGKKVDGRGLILIFTTNAGAADASRPALGFSREGRAGEQAEAVKRTFTPE
FT                   FRNRLDAVIYFAPLSRTVMTSVVDKFLRELGEQLTERGVTLTVTPAARARLAELGYDPL
FT                   LGARPLARVIEDKLGRPLADELLFGRLKDGGAVKVGVQGGEFSFAVS"
FT   gene            603103..603657
FT                   /locus_tag="DR_0589"
FT   CDS_pept        603103..603657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0589"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS6"
FT                   /protein_id="AAF10171.1"
FT                   /translation="MRFRQGWSGRPLTPCCARPSLRCSSSSPARGEGQKYALSLNALRL
FT                   RRQLCVDPLGKGVQVGLAEAFEGVLTVHFDLTKAEAGRPGHILEFQFAVLDPRRADIAQ
FT                   RHRRVVVQRPLAQVQRAAHQAGQPAAAQLRPRLRHLLGRVVVGGLRQAHHDFARGQVKF
FT                   GLALRGRDAFQHSLVVDVPSA"
FT   gene            603764..604069
FT                   /locus_tag="DR_0590"
FT   CDS_pept        603764..604069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0590"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10172"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS5"
FT                   /protein_id="AAF10172.1"
FT                   /translation="MSATDQGALHAIKFYQRWISPHKGFCCAYAALHGGESCSAAVARI
FT                   IREDGLRAGQPRIAARFAECREAHTALRSGSPLAIGTGGVRGVCCCGPLPIPFRCG"
FT   gene            complement(604076..604822)
FT                   /locus_tag="DR_0591"
FT   CDS_pept        complement(604076..604822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10173"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS4"
FT                   /protein_id="AAF10173.1"
FT                   /translation="MTWLADTLQAAWAVLDEDNAVRGAAGVRPSPAHGLELMGGALAAE
FT                   PEEEQAVQTALAKAAHRDAGQVYAFADGSLFTAQALAQAGFQEVGAYRLLAGPTPEEGP
FT                   PTLEGFTLRPLADVPDLAIRLDALTTYEDRIGHHAVSPTAAEDGAGGYDSTLSLIALDA
FT                   QGRAAGICRAAAEEGYIRIDAPGVRADLRHTPLRQALLLGVCAQARARGIGDISLESWG
FT                   DTPAELAADLALGLEIQFENPIYAAG"
FT   gene            complement(604906..605406)
FT                   /locus_tag="DR_0592"
FT   CDS_pept        complement(604906..605406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0592"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10174"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS3"
FT                   /protein_id="AAF10174.1"
FT                   /translation="MKQDDGAGPGLCHGDRLTAWAQETPSPELCLSMSIPHKDDWTRHF
FT                   EALQRGELSVEDWQEFCRRSGRAVGGLPPLKGAQRQAMEEEFDRLRLACQLFLAQAPDF
FT                   ETLAARQTTVGPDYCLLKMLAASALNLLDLPAPSLPAVNAAEEFEVGLPATTFIVFGNN
FT                   AAL"
FT   gene            605368..606075
FT                   /locus_tag="DR_0593"
FT   CDS_pept        605368..606075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0593"
FT                   /product="beta-ketoadipate enol-lactone hydrolase,
FT                   putative"
FT                   /note="similar to PID:2239060 percent identity: 57.69;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10169"
FT                   /db_xref="GOA:Q9RWS2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS2"
FT                   /protein_id="AAF10169.1"
FT                   /translation="MTESRPRTVVLFHAYPLSADMWREQRAALEGAGLTVITPNLPGLG
FT                   GREGTIVSLPQAVEGFLAELPDGPLSVVGLSMGGYLAQELLRQAPERVGRLVLADTSCR
FT                   ADSPEQAESRRQQASRVVEEGRDFIIAAAREEHSHSTYKKILPMMESASREGIAAALGA
FT                   MAAREEGRTTLQAAQVPLLVLVGREDTLTPIEVAQEIADAGRGELVILDGAAHLSNLDQ
FT                   PEAFNAELLKFLA"
FT   gene            complement(606138..607556)
FT                   /locus_tag="DR_0594"
FT   CDS_pept        complement(606138..607556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0594"
FT                   /product="glycogen synthase"
FT                   /note="similar to GB:U00096 PID:1789836 percent identity:
FT                   62.06; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10170"
FT                   /db_xref="GOA:Q9RWS1"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWS1"
FT                   /protein_id="AAF10170.1"
FT                   /translation="MARGRPCLSAQRLGEEPRVNSTGRYSGPMRVLHLASEVFPFSRSG
FT                   GLGDVLGALPAVQARLGEDAEVTVLSPWYASLQGEPQELWRGEAWGEQAWLGELRQDGV
FT                   RYLFLGLNEFQRPGLYHPDDVERFCAFGRAALPALDAVGVTPDVLHGHDWQAGLVVAHA
FT                   RLRGLRTAFSVHNLQYQGRWNLHEAAGWTGLPDWTFGPDGVEFFGDLNLMKAGLNFAGH
FT                   VTTVSPTYAQEITTPQYGEGLEGLLVRLTHEGRLSGILNGLDQDRWNPRTDPDIAAYSD
FT                   PAGKAGAVKALRQEFGLDDAPILATVSRLADQKGMDLLITALPELVRDWNVVVLGGGDP
FT                   LLEAALTGWANHPRVAFASGMNEPLAHRIYAGAHAFAMPSRFEPCGLSQLIAMRYGTLP
FT                   IVRETGGLADTVPPEVGFRFADATAPAFLQACREAQAAFQDPAQWQTRATRAMSLDFSW
FT                   DGPARQYLELYRGL"
FT   gene            607567..608190
FT                   /locus_tag="DR_0595"
FT   CDS_pept        607567..608190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0595"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10175"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS0"
FT                   /protein_id="AAF10175.1"
FT                   /translation="MCYTPACLFSRVLHSSTRWRGGRVVECVALEKRSTRKGTVGSNPT
FT                   LFAKKEAPRPAQQAGFSFVDSVSQVSGAAIVQPMTRFAWTPETIPWQETAPDGTRYALL
FT                   EGVREAGTFTYAFFLPAGFWDEAHWHSTDARVFVMQGELRLGYGDRLDKEAATSYPAGS
FT                   ALLVPAEHRHHDGAEVDTLILGVASGSWFTRYVNSANQGSAGTV"
FT   gene            607622..607708
FT                   /locus_tag="DR_t0595"
FT                   /note="tRNA-Ser-4"
FT   tRNA            607622..607708
FT                   /locus_tag="DR_t0595"
FT                   /product="tRNA-Ser"
FT   gene            complement(608448..609449)
FT                   /locus_tag="DR_0596"
FT   CDS_pept        complement(608448..609449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0596"
FT                   /product="Holliday junction DNA helicase"
FT                   /note="similar to PID:727373 SP:Q56214 percent identity:
FT                   84.39; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10176"
FT                   /db_xref="GOA:Q9X719"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X719"
FT                   /protein_id="AAF10176.1"
FT                   /translation="MTAPENLDAALRPKTLTEYVGQEKLKDKLGVYLQAARGRREALDH
FT                   TLLFGPPGLGKTTLAHIIAYELGVNIRVTSGPAIEKPGDLAAILTNSLEEGDVLFIDEI
FT                   HRLGRVAEEHLYPAMEDFKLDIVLGQGPAARTIELPLPRFTLVGATTRPGLITAPMRSR
FT                   FGIIEHLEYYTAEEIATNLLRDARLLGFGLDEEAGLEIGARSRGTMRIAKRLLRRVRDY
FT                   ADVAGETTIGLERAQSALDKLGLDSAGLDDRDKKYLETLIHRFAGGPVGVDTLATAISE
FT                   DALTLEDVYEPYLIQLGFIKRTPRGRVATAHAYDHLGLPPGGIDDGNGIFLN"
FT   gene            complement(609507..610175)
FT                   /locus_tag="DR_0597"
FT   CDS_pept        complement(609507..610175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:Z26044 SP:P47206 PID:398393 percent
FT                   identity: 52.86; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10177"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR9"
FT                   /protein_id="AAF10177.1"
FT                   /translation="MKWLTAALLTVAAVLAGLLVYRSAAPGRGGLRGGTALDTPLAVPP
FT                   LPLTDDRGRPTTLAASDGRLRLVFFGYARCPDVCPVTLAGLERSYKTLSDEQRRRVQVQ
FT                   LVTVDPVNDTPKVLRDYLDRFDPAFSGLTGSPDTINAAAKALFVSNVAPAADHSEHMQM
FT                   QSQGDAPAVSAPDAARIHGDELRVINPQGQFVRVYTNGEVMDGTLDHDLPALIRQYGGG
FT                   "
FT   gene            610232..610825
FT                   /locus_tag="DR_0598"
FT   CDS_pept        610232..610825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 56.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10178"
FT                   /db_xref="GOA:Q9RWR8"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR8"
FT                   /protein_id="AAF10178.1"
FT                   /translation="MARLQLLSDSPRPRPRHAERGMRRSFGTLIFLAFLVFLAWLFFWP
FT                   LVKPSVEQAQRSTVLLSSPAPTALPNPLPGRPLTDTWGGARSGGRKHEGIDIFAPRDTP
FT                   IRATTEGIVLNVGPNTLGGRTVMILGPGGQRHYYAHLDRYPDLTAGEWVNSGDVVGYVG
FT                   DSGNAKGTPTHLHYGIYTAAGAINPYPLLAAGRK"
FT   gene            complement(610926..611765)
FT                   /locus_tag="DR_0599"
FT   CDS_pept        complement(610926..611765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0599"
FT                   /product="aminoglycoside N3-acetyltransferase"
FT                   /note="similar to GB:AL009126 percent identity: 68.02;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10179"
FT                   /db_xref="GOA:Q9RWR7"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR7"
FT                   /protein_id="AAF10179.1"
FT                   /translation="MAYAWPMTEDTAIAHADAPRTRASLAADLRSLGVQAGDVLLVHSS
FT                   LSRLGWVAGGAVAVIQALQDVLTPQGTLVMPTHSSDLTDPAGWLSPPVPEAWWEVIRAE
FT                   LPAFDPALTPTRGMGRIPELFRTWPGVRRSDHPHSSFAAWGRHAEFVTAGHALAFSLGE
FT                   GSPLARIYDLNGRVLLLGTERNTNLHLAEVRAGVRPTVAVSGPVMVDGERQWLTFDEPD
FT                   YDAEAFAPVKAAFEAAGGVVRGTVGSAQARLMSQRELVDFAVNVWRVVRVPPHSSPS"
FT   gene            complement(611905..612144)
FT                   /locus_tag="DR_0600"
FT   CDS_pept        complement(611905..612144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10187"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR6"
FT                   /protein_id="AAF10187.1"
FT                   /translation="MNVIRHFSDTRTGEGRVRFLITQGRVRLVAEGPGWSHESTHAGLH
FT                   DAATFLAVLPHLTDTLYQEALDDLERRLSLEQAA"
FT   gene            612425..614140
FT                   /locus_tag="DR_0601"
FT   CDS_pept        612425..614140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0601"
FT                   /product="DNA primase"
FT                   /note="similar to SP:P33655 GB:Z23080 PID:580959 percent
FT                   identity: 61.27; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10180"
FT                   /db_xref="GOA:Q9RWR5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWR5"
FT                   /protein_id="AAF10180.1"
FT                   /translation="MVGEYVRLTPAGKGRLKGLCPFHKEKTPSFQVDTEKGYYHCFGCK
FT                   ASGDVFGFVQQMEHLSFGDALRKLADRAGIQIDAKYGEKVSRDLYEVNAFALDYFRSHL
FT                   PGPALDYLRGRGLSDETIAAFELGYAPDGWDGLLKLARTKGVSEKQLLEAGLLTENPEN
FT                   GRVYDRFRGRVMFPIRDHLGRLVGFGGRVLDDSKPKYLNTPETAAFKKGELLYGLDKAR
FT                   SGLGGGAELVVVEGYMDVISMHQHGFTGAVASLGTALTAEHAQLLERLGAQSIVLMFDQ
FT                   DGAGLKATLAGLDQVIGAKFRVRATSVPSGKDPADALLAGDDAGIREALAGGLDEVKYR
FT                   VQAATEKYGVDTNEGKRRVLMELLPRMQNLDPLDAIAQDMRGAACELLGIRPEALLDWI
FT                   TSKAKRRTLTDTHLAGMSQSSGEEEHELALLRQLLVDPSLLAKLDGSLPWRNEAVRKVM
FT                   LAAQGARSPDDILDIFRGQPEEQLLIRLMFEGRDSGSLSRASSQEYEQKVTTYAAHAVD
FT                   DIQVTLNIDALKTEVDLLKKQLLSTPPAEQLALLSQIQELQRAIEAEKRARRGS"
FT   gene            complement(614142..614738)
FT                   /locus_tag="DR_0602"
FT   CDS_pept        complement(614142..614738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0602"
FT                   /product="phosphoglycerate mutase-related protein"
FT                   /note="similar to GB:AE000657 percent identity: 50.67;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10181"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR4"
FT                   /protein_id="AAF10181.1"
FT                   /translation="MNLTLLRHGRSRADDEGVCEGRYDSPLTEVGREHARKLAAYWAAH
FT                   PPGFDQAYCSTLSRASETAALVTAPLGLVPMPSDLLREFDNGPIAGLPFAKAEARYPIP
FT                   AFRHELEAFTVDGGESQAAFRARALLALELVWRGGENVLVVAHGGILNAMLRELTGARR
FT                   AHFAYGDTAFTTVQLSREHMGVTVTGVNLTPHLAE"
FT   gene            complement(614735..616381)
FT                   /locus_tag="DR_0603"
FT   CDS_pept        complement(614735..616381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0603"
FT                   /product="cytidine/deoxycytidylate
FT                   deaminase/nudix/methyltransferase domains protein"
FT                   /note="similar to GB:D26185 SP:P21335 GB:X52144 PID:40011
FT                   PID:467408 percent identity: 49.28; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10182"
FT                   /db_xref="GOA:Q9RWR3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR3"
FT                   /protein_id="AAF10182.1"
FT                   /translation="MTDPFLPGWLTAMSEAWNGFLYGSYPIGACIVDAQGNIVGRGRNR
FT                   LGEPRRAHAGVIGGHDLAHAEINALLSVPDLRRPECLSWTVLTTVEPCPQCAGAVAMSG
FT                   IRGVSYAAPDPWGGCARLLTDDPYVSSKGMRVSRAPEPLQRAALRLMLVALLEEGHRPE
FT                   DRLLQSFSRYKADLKAARELHGAGTLARLRSGGAGLEDALTELLGGALPLEWLDVLTEL
FT                   SPARHTAFAPDLSPGLERTGRACAWIEREDGFVLMTEARTGWTLPGGGIEPGETPEQAA
FT                   VREAWEEVGARCEVAGAGWTLDDGSGSVCVPLRVLTLESSPEGRPLIWVNPHALPWADD
FT                   VQLRQVLAARGQTPPHLQAPPLVARADELARASGFDRSCSEETGRLLRTLAASKPGGRV
FT                   LELGSGLGAGTAWLLAGMDASARLLTVESDSERARLTAEVLCDDPRAEVLAGDWAEALE
FT                   SGPFDLIFADAGAAKTPQALDRLADALKPGGLLVMDNFSPTMYLPADLYTGDPLRDALF
FT                   AHPRLTCTEVQVHRRERVILATKHAIPGRSK"
FT   gene            complement(616378..616944)
FT                   /locus_tag="DR_0604"
FT   CDS_pept        complement(616378..616944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0604"
FT                   /product="acetyltransferase, putative"
FT                   /note="similar to GP:2897873 percent identity: 55.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10183"
FT                   /db_xref="GOA:Q9RWR2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR2"
FT                   /protein_id="AAF10183.1"
FT                   /translation="MKHDLTLRAGDLTLRPLLEADIPALCELASAHEDALRLMGTPPNT
FT                   DGYYRAALSDPAQIAFVIEVGGELAGSTRYGDIRPAHSGLEIGWTWLTPEHWRTGVNRR
FT                   MKRLLLTHAFEEMDMERVQIKTDILNTRSQRAIERLGAVKEGVLRSHMRRADGTMRDTV
FT                   MYSVTRADWPEVRARLTASGGKGQA"
FT   gene            complement(616958..617641)
FT                   /locus_tag="DR_0605"
FT   CDS_pept        complement(616958..617641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0605"
FT                   /product="GGDEF family protein"
FT                   /note="similar to PID:1652841 percent identity: 58.40;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10184"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR038733"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR1"
FT                   /protein_id="AAF10184.1"
FT                   /translation="MLPSLNMTGGHWGRPDLFGPFPRRFSVARPAILSRTPFEEAFEKL
FT                   GSAPLTLAVLDLDHFKVLNDQLGHTEGDRVLKVVERLLSGSLPSGSVVGRIGGDEYAVI
FT                   LPETAAETALILFDEVIRHFQIHRDPQWPRGLGLSVGLAARPAHASEYAELYRAADEAL
FT                   LRAKREGRSRACIYVESKMVLKSNYYPKSQLERLAKLSAALGRTEASLLREALDDLIEK
FT                   YRGEL"
FT   gene            617795..618157
FT                   /locus_tag="DR_0606"
FT   CDS_pept        617795..618157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0606"
FT                   /product="chaperonin"
FT                   /note="similar to PID:1066157 percent identity: 85.26;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10185"
FT                   /db_xref="GOA:Q9RWR0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWR0"
FT                   /protein_id="AAF10185.1"
FT                   /translation="MKALGGKKLAGTTLRHSISLTGGPHMLKPLGDRVLVEIIEEAEQK
FT                   TAGGLYVPDSAKEKSQRGKVVAVGTGKTLDNGTKVAMEVKEGDTVYFAKYGGTEVSLEG
FT                   KNYSLLSERDLLAIVE"
FT   gene            618232..619878
FT                   /locus_tag="DR_0607"
FT   CDS_pept        618232..619878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0607"
FT                   /product="groEL protein"
FT                   /note="similar to PID:1066158 PID:1122942 percent identity:
FT                   88.93; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10186"
FT                   /db_xref="GOA:Q9RWQ9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWQ9"
FT                   /protein_id="AAF10186.1"
FT                   /translation="MAKQLVFDESARRSLERGVNAVANAVKVTLGPRGRNVVIEKKFGS
FT                   PTITKDGVTVAKEVELEDKLENIGAQLLKEVASKTNDITGDGTTTATVLGQAIVKEGLR
FT                   NVAAGANPLALKRGIDKAVAVAIEEIKKLAVSVEDSEAIKKVAGISANDETVGQEIASA
FT                   MDKVGKEGVITIEESKGFDTEVDVVEGMQFDKGFINPYFITNPEKMEAVLEDAYILINE
FT                   KKISNLKDMLPVLEKVAQTGRPLLIIAEDVEGEALATLVVNKLRGTLNIAAVKAPGFGD
FT                   RRKEMLRDIAAVTGGEVVSEDLGHKLENVGMEMLGRAARIRITKDETTIVDGKGEQAQI
FT                   DARVNAIKGELDSTDSDYAREKLQERLAKLSGGVAVIRVGAATETELKEKKHRYEDALS
FT                   TARSAVEEGIVAGGGTTLLRVIPAVRKAAESLTGDEATGARILIRALEEPARQIAANAG
FT                   EEGSVIVNAVVGSDKARYGFNAATGEYVEDMVAAGIVDPAKVTRTALQNAASIGALILT
FT                   TEAIVSDKPEKAAPAMPQGGGDMGGMGGMDF"
FT   gene            620331..620942
FT                   /locus_tag="DR_0608"
FT   CDS_pept        620331..620942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0608"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10195"
FT                   /db_xref="GOA:Q9RWQ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ8"
FT                   /protein_id="AAF10195.1"
FT                   /translation="MSVPSSVSFQTLSGDFGPVLGEVARLRLSLFREFPYLYDGTEEAE
FT                   AAHLQTYVQAPGALLVLARDETAGGRVVGACTAVPLVAEDADFLRAFAAAGIDPATVLY
FT                   LGEALLEDEYQSRGLGGELLSQVEAHAQALGLPIVAAAMVVRSEDHPQRPRGWRSPSHL
FT                   LERRGYVMHPELEITLSWQEIGESAPSSKPMRFWVKGLEG"
FT   gene            621293..621781
FT                   /locus_tag="DR_0609"
FT   CDS_pept        621293..621781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0609"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10196"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ7"
FT                   /protein_id="AAF10196.1"
FT                   /translation="MAQAGAVQLHRFGQVVQQRGPGVVVPGGVVSLLGAGKIFAQVGEQ
FT                   GLNRRRRQEFGLPSCGAESCAFWMTYPPPMLLVLSGIPGTGKSTLARELSRRLGAVYLR
FT                   VDTVEAALLNAGHAGITVEGYATAYAVAADNLALGLNVVADCVNPVAETREAWAEVAR"
FT   gene            621803..622024
FT                   /locus_tag="DR_0610"
FT   CDS_pept        621803..622024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0610"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10197"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ6"
FT                   /protein_id="AAF10197.1"
FT                   /translation="MEVVCSDGAEHRRRVESRHADATAHAGHWSPPDWEAVAKWPYQPW
FT                   QTPVLRVDTARDSVTELADRLLTEPKSI"
FT   gene            622070..623086
FT                   /locus_tag="DR_0611"
FT   CDS_pept        622070..623086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0611"
FT                   /product="LuxA-related protein"
FT                   /note="similar to GB:X73124 SP:P39606 PID:413968
FT                   GB:AL009126 percent identity: 54.70; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10188"
FT                   /db_xref="GOA:Q9RWQ5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ5"
FT                   /protein_id="AAF10188.1"
FT                   /translation="MKKIGFLSFGHWNPHPQSRTRSAGDVLRQSIDLAVAAEELGADGA
FT                   YFRVHHFAQQLASPFPLLAAVGAKTSNIEIGTGVIDMRYENPFSMAENAGAADLIAGGR
FT                   LQLGLSRGSPEQVIDGWRHFGFQPAPGETEQDMARRHTEVFLELLKGEGFAQPHPRPMF
FT                   SNPPGLLRLEPHSEGLRERIWWGAASNATAVWAAQKGMYLQSSTLKTDESGQPFHVQQA
FT                   EQLRAYKAAWQQAGHTRPPRTSVSRSIFAITNDLDRAYFGGQGDSDQFGRIDNYRAVFG
FT                   RSYAAEPDKLIEELRQDEAIAEADTLLLTVPNQLGVEYNAHVIESILKHVAPALGWR"
FT   gene            623135..624754
FT                   /locus_tag="DR_0612"
FT   CDS_pept        623135..624754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0612"
FT                   /product="arginine utilization protein RocB, putative"
FT                   /note="similar to GB:X73124 SP:P39635 PID:414001
FT                   GB:AL009126 percent identity: 50.58; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10189"
FT                   /db_xref="GOA:Q9RWQ4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR012166"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ4"
FT                   /protein_id="AAF10189.1"
FT                   /translation="MTIDVSARDVTIELVRAASVTNTAGEQAFPETLLRVLGRLPYFQA
FT                   HPEDLWTQPIENDPYGRRNVYALVRGDGPAGVVLTGHYDVVSAANYGPHADVAFDPEAL
FT                   LPRLIADLRVNARSEAERRALHDLESGDFLPGRGALDMKAGLAAGIAALAEFAARPARR
FT                   GNVLFAAVADEEVSSHGARQAAPELRALAEREGLDWRLVINLDATGDNGDGSAGQAVYL
FT                   GTAGKLLVSAFVVGVDTHAGYSLDGVNVNFLASELTRAFEFSPELTDRSAGIMGTPPTV
FT                   LRQQDLKTYYDVTTPARAWLCVNALTHGLDAATVLDRFKASAQAALDDALDTLRRRAEA
FT                   LGETRSAAHGATPLVLTYADLLERARQQVPDLDAALTAYDAGLDPQLDLPTRSAHLTGW
FT                   LWDASGLLGPAAVLGFASLHYPNTTLDSRNPTEAQALDLVRATLREKGAELGVTISERP
FT                   IFTGISDMSWFGTADSADIAAVNANTPAPAAHIHAPPAGLPCINLGPWGRDYHQWLERA
FT                   YAPYSFGTLPRLVSALTEAFLR"
FT   gene            complement(625089..625739)
FT                   /locus_tag="DR_0613"
FT   CDS_pept        complement(625089..625739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 54.40;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10190"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ3"
FT                   /protein_id="AAF10190.1"
FT                   /translation="MTQPSIPTEAQPYRIAPQTGTGFRLSKGDVLVVIDPLGEQVSDLM
FT                   AFAADTVGSEGQAEWLSSGRTFDYNETIYLTTGHQLYSNRSRVMFTLLRDDVGRHDFLL
FT                   TPCSTETFEILYPPGTAEGHPSCFGNLVKAFAPFGIEPDQIPTTLNIFMNVLVDEKGKV
FT                   NIGPPISQPGQRLELRAEMDLIVGLTACSAEGSNNGTFKPIDYFVIPADTQAE"
FT   gene            complement(625745..626464)
FT                   /locus_tag="DR_0614"
FT   CDS_pept        complement(625745..626464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:P45944 PID:1217881 PID:1303774
FT                   GB:AL009126 percent identity: 45.70; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10191"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ2"
FT                   /protein_id="AAF10191.1"
FT                   /translation="MQPTRGPVSARAAELNAAFREKILAPDFSCVAAKASMNTSAYALG
FT                   VYGELGSLSATXGLAHDLARFVQDQDDLGSDFTSFIATFDSPEGMTEPQFEERLWQQLR
FT                   ALHQLDTAPYSEEVSADPHSNKFGFSFAGRGFFIIGLHPGSSRVARAFPAPALVFNAHR
FT                   QFQKLRDTGRFERMQQTIRSRELKLQGSLNPNLANYGEAPEARQYSGRAVEPGWVAPFP
FT                   NTPTAGRCPFGFGDGAD"
FT   gene            626751..627704
FT                   /locus_tag="DR_0615"
FT   CDS_pept        626751..627704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0615"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="similar to GB:L04470 SP:Q04778 PID:142469
FT                   PID:1929339 GB:AL009126 percent identity: 59.74; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10192"
FT                   /db_xref="GOA:Q9RWQ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ1"
FT                   /protein_id="AAF10192.1"
FT                   /translation="MELRHLRHFVALAEEEHFGRAAERVFVVQQALSSSIRNLEEEVGV
FT                   QLVTRTTRRVQLTPAGEEFLIGARATLAQAAQTVERARRAAQGEVGRLTVGFVSGLAFG
FT                   GLPEIVRRFRELYPAVSVDLRELTAGEQEAALRGGQIDVGLLLLPVRDPALASRPLWRL
FT                   PLVAALPAAHPLASRTTLRIGDLSQEDFVFFPRYLRATYFDQVMHWCADAGFTPHVVQE
FT                   AIEIPTLLSLVAAGVGVFLPIEFFARLALPGVVYRPLEGAPVIEIVAVWRRAAAGEQST
FT                   RPTVQAFLQVAERVLSGENGAGEATPLPVLPTEPPR"
FT   gene            627755..628261
FT                   /locus_tag="DR_0616"
FT   CDS_pept        627755..628261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 59.43;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10193"
FT                   /db_xref="GOA:Q9RWQ0"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ0"
FT                   /protein_id="AAF10193.1"
FT                   /translation="MRHFPASLWSCESCGGFLLCLKRRPVLSASVAASVPFALQRSFPM
FT                   TMLSKPERLKSILQNLRISLPELRGAMVATTDGLPIAQAFSDNTDANRVAAMAATALGL
FT                   GKRINDTLGTGSLNEMSVSGVDGQVFIYSVGAKGVLAVVAPAGTNLGLLHMEARDAAQA
FT                   VASVL"
FT   gene            628352..631342
FT                   /locus_tag="DR_0617"
FT   CDS_pept        628352..631342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0617"
FT                   /product="metalloprotease, putative"
FT                   /note="similar to GP:3779244 percent identity: 55.47;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10194"
FT                   /db_xref="GOA:Q9RWP9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP9"
FT                   /protein_id="AAF10194.1"
FT                   /translation="MSFGRRSVCPDGAILGVMTATTFKLPAVGETLGRYHVERVEALPE
FT                   MSGQLILLRHENGARHAHVAREDDNLAFGVTFPTVPTDSSGVAHILEHTVLMGSQKFPV
FT                   PDPFFSMLPRSLNTFMNAMTASDWTTYPFSTRNVQDYYNLLSVYLDAAFFPLLRYESFR
FT                   QDGHRFEFETPDDPTSTLKLQGVVYNEMKGAMASPGSVMWRAFGKALYPDLTYANNSGG
FT                   SPEDIPGLTYEDLRAFHAAHYHPSNAYFFSYGNQDLRRVLDTIEEQVMSHFQRQDLDVS
FT                   IPDQTNFSEPRRMDVSYPGSDTERGGQVLLGWKLGYASDPDLSLRWGVLSDVLLGNAAA
FT                   PLTRPLIESGLGSALADLSGYRDDFREAAFAVGLKGLSSGKAAQVQELVLSTLRQIADE
FT                   GIDPALIEASLHQFEISQKEVSNAGYPYGLGVMFRLLGPWMNGGDPVTGLRLDAELSKL
FT                   RADLERGPVFEDLIRHWLLDNPHRVTLVVTPDPDLAARSEQAERELVARLSKDFTDEDR
FT                   ARIVRESLNLKNLQAQESDPNVLPTLTLADVPARVPRPEYTTEHSGRALVGRVPQPTGG
FT                   LTYLDVKVRLPELPSDLLLVLPLYAFAVTRSGAAGQDYAALARRIEAVTGGIAAGASVG
FT                   NGPDAVDELRISLSFSGKALARNAGELVSVLRDVIAEPTFDRERLRQLLEQRLAGMKAS
FT                   VVSAGNAYAERLAGAQVSSGAAISERFGGLSQLAALKAIVEGGAGQPEDLNDRLDALLA
FT                   QFGRVTTLIAQGEPLVCLTALPEDVGLDLTPITTTFQGDAPVGHPHPQLAARVPQARTT
FT                   DSPVAFNALAFATVPYTHPDSPALLVLSRLLRSEYLLGEIREKGGAYGAAASFDARSGV
FT                   FALSSYRDPNIARTYGVFRDARQFLDTDLGERELTEAILGASKTLDPLTSPDTVGRLRF
FT                   YGDQSGFTPEVQEAYKSRLLSVTLDDLRRVMDTYLTPEHAAYALVAGKDPSEDTAELGL
FT                   KWDVQGI"
FT   gene            631595..632350
FT                   /locus_tag="DR_0618"
FT   CDS_pept        631595..632350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0618"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10207"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP8"
FT                   /protein_id="AAF10207.1"
FT                   /translation="MLRPPLLPLLALSLSGCQLLPAAAQSPVRIGQVCGDIVEFSPLGN
FT                   LGHCDLVEARVTLARSANPKTVSGGLFNLKTGAGIALHLGHADGQRGEVSLSPVRGQDW
FT                   QKIFAYDTDYELRVTALDGQGRKLERRVRLHTEKAPYELAWVKTALPKPGDRVVTATIT
FT                   NRTPEAIQAGAVRLDVVCDQLHGTERRTVYFGSDTQSFAANETRQVRLPLLTQRDFQPQ
FT                   PWADVPFTECRNEYVEGLRGRRVIPSRTL"
FT   gene            complement(632357..632797)
FT                   /locus_tag="DR_0619"
FT   CDS_pept        complement(632357..632797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:2959336 percent identity: 65.54;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10198"
FT                   /db_xref="GOA:Q9RWP7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWP7"
FT                   /protein_id="AAF10198.1"
FT                   /translation="MRLHLITVGEPKLAYARSGWDEYEKRLRRYHKVQVSRVSGKTQQA
FT                   ESEAILKAAGKSPLILLDPRGKQFSSEKLSEYLDAEALGGHGELAFAIGGPDGHTDALR
FT                   GQAKLLWSLGELTLPHDLAMLVLVEALYRAATISAGEPYHRG"
FT   gene            complement(632821..635784)
FT                   /locus_tag="DR_0620"
FT   CDS_pept        complement(632821..635784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 50.37;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10199"
FT                   /db_xref="GOA:Q9RWP6"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP6"
FT                   /protein_id="AAF10199.1"
FT                   /translation="MSLKLMSLNLTSSKLPLWPTRFGWAFLGLVLLTLIGCINYALSLG
FT                   YGLTFLLSGVWIVTAAQARRAARTLSLSVQAPVEAVAGHEMAFSAQVRQAGAASPVTLR
FT                   AWAEQNGRRVPLTASLSLGAGDTQTAALKVPDPVRGPLRLSDVRLVAHDAFGLWQAAVP
FT                   VQVEAEVAVTPAPEADAPAPPTLAASGPGENGRRTAGQEDFAGLRPYVAGDAPRLISWR
FT                   HAARSGQLVTREFDAPLGQAWDLNWTATQGKVEARLSRLAAWVTAARAAGVPFRLTLPG
FT                   QALPVGSGDAHAVRALRALALHPPFPEVPEQPASSEFLTLPAWLGGPKTSEPHPTPLPA
FT                   APLQFSLLALGVALLPGLLRWPLWTSALVLWLLTYRGLQAEPGRKLRPLPPVLLLALVV
FT                   VAALGLNATYGTLLGQDGGTALLAALLALKAAETRTVRDARLLTLLGLFVTSTHFFHDQ
FT                   GPLTALHSLLASVLLLAAAARWAGDPAAEAAPGPVLPRPLLGLSARLLLLSLPLAALLF
FT                   IFFPRPDGPLWQLPINQGAKTGLADQISPGEYSNLAQSDAVAFRADFDGPLPPPDERYW
FT                   RGPVYEHFTGQGWQQVRGRFAAPSAEPRPGAPVWHYSITLEPNGKPWLLALDVPTTLPQ
FT                   SALLTSAFQAATLRPASLRTRYEWHSQPALLGRIESQDRLNLDLTLPDTPDAANPQARA
FT                   LAASWRTLAPEQRVQAGLDVFRKGDFAYTLNPPKLPADNRIDAFLFGSKRGFCEHYSSA
FT                   FAFLMRAAGVPARIVGGYQGGEVNPDGGYLIVRQQNAHAWAEVWLAGQGWVRVDPTAAV
FT                   APARVQADLGTALTQPRATAPRERTALERATLRLDALQNQWNTWVVSYDGEQQRSLLTR
FT                   LGISGPGSPVYLLALFGVAALTLLPALAFVRRRARPSDPALLALHDLGARLRLPRGPGE
FT                   TPTAYAERAAGLSPAQAPLLRDIARTFNALRYGPQPSPEHLRQLRSLVKQVRRVERN"
FT   gene            complement(635795..636757)
FT                   /locus_tag="DR_0621"
FT   CDS_pept        complement(635795..636757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0621"
FT                   /product="moxR protein"
FT                   /note="similar to PID:1001216 PID:1001272 percent identity:
FT                   70.88; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10200"
FT                   /db_xref="GOA:Q9RWP5"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP5"
FT                   /protein_id="AAF10200.1"
FT                   /translation="MATAPTTFSVSSPNGSAASQVMHRALEQLDQVILGKPTQLRLAVA
FT                   CLLARGHLLIEDQPGVGKTTLAQALARTLGLGFRRVQFTSDLLPADLLGVSIWDAASST
FT                   FRYQPGPIFSELLLADEINRATPRTQGALLEAMEERQVSEGGVTRPLPDPFFVIATQNP
FT                   AAFVGTSPLPEAQLDRFLMTVTLGYPDARAERTLLETGGRGQSVRELPAVLDAPLLLRA
FT                   QAEVDAVHAAPALLDYLQLLARATREQPAIASGLSPRALLALLAAARAWAYLAGRDMVL
FT                   PEDVQAVFPALASHRLVLRDPAARPGDVIRRLLDETPIP"
FT   gene            636904..637398
FT                   /locus_tag="DR_0622"
FT   CDS_pept        636904..637398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0622"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10208"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP4"
FT                   /protein_id="AAF10208.1"
FT                   /translation="MSPRALPGLVACLFAGSLSAACAQSGDRPLFVQPPQMQGAPATPA
FT                   ASTPMWTPPAQAAPAQPAPVRPAAAAPVRPLPAQAAPVSPASVPLTPGVRPGASSRPGV
FT                   TPRALPASGPRPAATATQAQTAAPLKLQLMPVWTGQFMVRPRELAPFNPLGLPQGAVSL
FT                   R"
FT   gene            637454..638620
FT                   /locus_tag="DR_0623"
FT   CDS_pept        637454..638620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0623"
FT                   /product="aspartate aminotransferase"
FT                   /note="similar to PID:1255699 percent identity: 75.92;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10201"
FT                   /db_xref="GOA:Q9RWP3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP3"
FT                   /protein_id="AAF10201.1"
FT                   /translation="MTSPFRLSARAQSLKPSATVAVTSRALELQRQGLDVISMSVGEPD
FT                   FDTPPHVKAAGIAAIEEGKTKYTPVSGIPELREAISAKFRRENGLDYAPNAVTVTSGGK
FT                   QALFNAFFALLNPGDEVLIPAPHWVSYPEMVALTGAVPVTVPTTPQQGFQLDPDALAAA
FT                   ITPRTRMVILNSPGNPTGAVFPPETLRAVADLATQHGLMIVTDEIYEHLVYDAEQVSIG
FT                   TYAPEHTLTINGASKAYAMTGWRIGYAGGPREVIAAMNALQSQSTSNASSVSQYAALAA
FT                   LEQHEETMRFIDRARTAYRERRDRIVAGLNALGLPTPTPQGAFYVMADTRAIHTDELEA
FT                   ARIILDEAQVAVVPGTDFAAPGQVRLSYATSMDNIEEVLRRLEGVVRR"
FT   gene            638737..639333
FT                   /locus_tag="DR_0624"
FT   CDS_pept        638737..639333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:L10328 SP:P31465 PID:290561 GB:U00096
FT                   PID:1790149 percent identity: 59.09; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10202"
FT                   /db_xref="GOA:Q9RWP2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP2"
FT                   /protein_id="AAF10202.1"
FT                   /translation="MAARGFRAGADHLRHQFCPPLVDPHRPWTARMKLLALSGSLRADS
FT                   VNTALLRALAEAAPAGVEVCFFDGLRDLPLFNPDAEERENAAVTAWRAALRGADAVVIS
FT                   SPEYAHGIPGAFKNALDWVVGSAEFDGKPTLLLCASARPQHAPAQLAEVLRTMGARVQG
FT                   PHLLDLPGNVAAAQSALRTPAQQAEARELLAALLP"
FT   gene            639376..640140
FT                   /locus_tag="DR_0625"
FT   CDS_pept        639376..640140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000666 percent identity: 44.79;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10203"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP1"
FT                   /protein_id="AAF10203.1"
FT                   /translation="MTNMQLGNEGTYSLRDFLAQTAERDNPGEVFELESSKMLEVRVNG
FT                   RIWSKLGAMVAYKGQLSFKREGTLEGGLMKAFKRAVSQEMSPLAKIEGRGVAYLADQGK
FT                   EIQILRLAGESLNVNGNDLLAFEDSVQYDITMQRRVAGMAAGGLFSVRVQGHGMVAVLS
FT                   HGKPLTLRVTPHEPIYTDPNATIAWSGNLQPQLVMDTSLRSIFGRGGGESYQMVFQGDG
FT                   FVVVQPYEEFGAGMLGGESGGGLGRTMGDLFD"
FT   gene            640190..641446
FT                   /locus_tag="DR_0626"
FT   CDS_pept        640190..641446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0626"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /note="similar to GB:D10483 SP:P17443 GB:X52540 PID:216504
FT                   PID:40858 percent identity: 52.25; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10204"
FT                   /db_xref="GOA:Q9RWP0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWP0"
FT                   /protein_id="AAF10204.1"
FT                   /translation="MPSPAHAGPPPGLTLLHSQTMSLVVMATGGTGGHIYPAVATAKEL
FT                   RGRGYEVALMGQKGGMEEGIAEREGLTFYGVDAGKLARSGQGRPDPRQLLKAGQGLAQA
FT                   RRTLAGLNPAAVVGYGGFASLPGVLAAQSLGIPTILHEQNARLGLTQRLAVRRARAVGT
FT                   AYDKVIGLDPRKATLVGMPVREERMPRAEALAALGLRDGPITIMVMGGSQGSLYLNQQV
FT                   PGILWRLFGKVGKLRGKGDSVPPIDLDLRGPHLIENARSREVQVLHATGPRWLAEVQPK
FT                   VENLPWYHVTGYVDAVAAWSVADLGITRAGTGTLAEAAFHGVPLVMVPLPESAENHQYH
FT                   NAVAVEQAGAGRVVEQKVLPETLEKVVLECAAPGKRAAMRDAAQKRARPGAAARFADLI
FT                   EVQLRRAPSPTAHAPTAHD"
FT   gene            641424..642872
FT                   /locus_tag="DR_0627"
FT   CDS_pept        641424..642872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0627"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /note="similar to PID:2104326 GB:AL123456 percent identity:
FT                   53.42; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10205"
FT                   /db_xref="GOA:Q9RWN9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWN9"
FT                   /protein_id="AAF10205.1"
FT                   /translation="MPQLPMTDSAPLPTPAPSSPAQPSAQPSLHYHLLGIGGIGMSAFA
FT                   RLLATRGHRVSGCDQNLGAQTAGLEAQGIPVAAGHAAAHVTEEPFGKIDVLVASEAVPK
FT                   SHPELAAARAAGVEVRPRMALLGELLAAGPSVGVIGTHGKTTTTSMIAVAMYGAGLDPS
FT                   AFVGGNVPEFGGNARTGTGPFVAEVDESDRGFALLGCETAVFTNAEDDHVGGELATYWS
FT                   TVEEQHAGFARFVAQSGRVLFCADWPGLDTLCSGAREQLTYGQSAGADYRAVNVRPDES
FT                   GTTFDVEFRGERLGEARVSLPGTHNVLNGLAALAVTHLYGGDFDRAARALADFHGPGRR
FT                   WEIKGERGGALVVDDYAHNATKVASAVQAARQTGRRVRVVFQPHRYLRTQQSWPRLADA
FT                   LMDADEVLVLDIAAASETPIEGVHATLITDRMTQGGHPNVHYCPDRAAVVRDLRESAQP
FT                   GDIIVTMGAGDVYRIAEEVVGGSA"
FT   gene            642869..643741
FT                   /locus_tag="DR_0628"
FT   CDS_pept        642869..643741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0628"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="similar to GB:M31827 SP:P18579 GB:X64259 PID:142833
FT                   PID:142849 percent identity: 54.71; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10206"
FT                   /db_xref="GOA:Q9RWN8"
FT