(data stored in ACNUC7421 zone)

EMBL: AE000516

ID   AE000516; SV 2; circular; genomic DNA; STD; PRO; 4403837 BP.
AC   AE000516; AE006915-AE007194;
PR   Project:PRJNA223;
DT   05-AUG-2004 (Rel. 80, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
DE   Mycobacterium tuberculosis CDC1551, complete genome.
KW   .
OS   Mycobacterium tuberculosis CDC1551
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; Mycobacterium tuberculosis complex.
RN   [1]
RP   1-4403837
RX   DOI; 10.1128/JB.184.19.5479-5490.2002.
RX   PUBMED; 12218036.
RA   Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O.,
RA   Peterson J., DeBoy R., Dodson R., Gwinn M., Haft D., Hickey E.,
RA   Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M., Salzberg S.L.,
RA   Delcher A., Utterback T., Weidman J., Khouri H., Gill J., Mikula A.,
RA   Bishai W., Jacobs Jr W.R.Jr., Venter J.C., Fraser C.M.;
RT   "Whole-genome comparison of Mycobacterium tuberculosis clinical and
RT   laboratory strains";
RL   J. Bacteriol. 184(19):5479-5490(2002).
RN   [2]
RP   1-4403837
RA   Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O.,
RA   Peterson J., DeBoy R.T., Dodson R., Gwinn M.L., Haft D.H., Hickey E.K.,
RA   Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L.,
RA   Delcher A., Utterback T.R., Weidman J., Khouri H.M., Gill J., Mikula A.,
RA   Bishai W., Jacobs W.R.Jr., Venter J.C., Fraser C.M.;
RT   ;
RL   Submitted (25-APR-2001) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
RN   [3]
RC   Sequence update by submitter
RP   1-4403837
RA   Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O.,
RA   Peterson J., DeBoy R.T., Dodson R., Gwinn M.L., Haft D.H., Hickey E.K.,
RA   Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L.,
RA   Delcher A., Utterback T.R., Weidman J., Khouri H.M., Gill J., Mikula A.,
RA   Bishai W., Jacobs W.R.Jr., Venter J.C., Fraser C.M.;
RT   ;
RL   Submitted (04-AUG-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
DR   MD5; 6ab03f2578cbcb2f076bc59323b6f4b2.
DR   BioSample; SAMN02603992.
DR   EnsemblGenomes-Gn; EBG00001054719.
DR   EnsemblGenomes-Gn; EBG00001054720.
DR   EnsemblGenomes-Gn; EBG00001054721.
DR   EnsemblGenomes-Gn; EBG00001054722.
DR   EnsemblGenomes-Gn; EBG00001054723.
DR   EnsemblGenomes-Gn; EBG00001054724.
DR   EnsemblGenomes-Gn; EBG00001054725.
DR   EnsemblGenomes-Gn; EBG00001054726.
DR   EnsemblGenomes-Gn; EBG00001054727.
DR   EnsemblGenomes-Gn; EBG00001054729.
DR   EnsemblGenomes-Gn; EBG00001054731.
DR   EnsemblGenomes-Gn; EBG00001054733.
DR   EnsemblGenomes-Gn; EBG00001054734.
DR   EnsemblGenomes-Gn; EBG00001054735.
DR   EnsemblGenomes-Gn; EBG00001054736.
DR   EnsemblGenomes-Gn; EBG00001054737.
DR   EnsemblGenomes-Gn; EBG00001054738.
DR   EnsemblGenomes-Gn; EBG00001054739.
DR   EnsemblGenomes-Gn; EBG00001054740.
DR   EnsemblGenomes-Gn; EBG00001054741.
DR   EnsemblGenomes-Gn; EBG00001054742.
DR   EnsemblGenomes-Gn; EBG00001054743.
DR   EnsemblGenomes-Gn; EBG00001054744.
DR   EnsemblGenomes-Gn; EBG00001054745.
DR   EnsemblGenomes-Gn; EBG00001054746.
DR   EnsemblGenomes-Gn; EBG00001054747.
DR   EnsemblGenomes-Gn; EBG00001054748.
DR   EnsemblGenomes-Gn; EBG00001054749.
DR   EnsemblGenomes-Gn; EBG00001054750.
DR   EnsemblGenomes-Gn; EBG00001054752.
DR   EnsemblGenomes-Gn; EBG00001054753.
DR   EnsemblGenomes-Gn; EBG00001054754.
DR   EnsemblGenomes-Gn; EBG00001054755.
DR   EnsemblGenomes-Gn; EBG00001054757.
DR   EnsemblGenomes-Gn; EBG00001054759.
DR   EnsemblGenomes-Gn; EBG00001054760.
DR   EnsemblGenomes-Gn; EBG00001054762.
DR   EnsemblGenomes-Gn; EBG00001054764.
DR   EnsemblGenomes-Gn; EBG00001054766.
DR   EnsemblGenomes-Gn; EBG00001054768.
DR   EnsemblGenomes-Gn; EBG00001054770.
DR   EnsemblGenomes-Gn; EBG00001054772.
DR   EnsemblGenomes-Gn; EBG00001054774.
DR   EnsemblGenomes-Gn; EBG00001054776.
DR   EnsemblGenomes-Gn; EBG00001054778.
DR   EnsemblGenomes-Gn; EBG00001054780.
DR   EnsemblGenomes-Gn; EBG00001054782.
DR   EnsemblGenomes-Gn; EBG00001054784.
DR   EnsemblGenomes-Gn; EBG00001054786.
DR   EnsemblGenomes-Gn; EBG00001054788.
DR   EnsemblGenomes-Gn; EBG00001054791.
DR   EnsemblGenomes-Gn; EBG00001054795.
DR   EnsemblGenomes-Gn; EBG00001054797.
DR   EnsemblGenomes-Gn; EBG00001054799.
DR   EnsemblGenomes-Gn; EBG00001054802.
DR   EnsemblGenomes-Gn; EBG00001054804.
DR   EnsemblGenomes-Gn; EBG00001054806.
DR   EnsemblGenomes-Gn; EBG00001054808.
DR   EnsemblGenomes-Gn; EBG00001054810.
DR   EnsemblGenomes-Gn; EBG00001054812.
DR   EnsemblGenomes-Gn; EBG00001054814.
DR   EnsemblGenomes-Gn; EBG00001054816.
DR   EnsemblGenomes-Gn; EBG00001054818.
DR   EnsemblGenomes-Gn; EBG00001054820.
DR   EnsemblGenomes-Gn; EBG00001054822.
DR   EnsemblGenomes-Gn; EBG00001054824.
DR   EnsemblGenomes-Gn; EBG00001054826.
DR   EnsemblGenomes-Gn; EBG00001054828.
DR   EnsemblGenomes-Gn; EBG00001054831.
DR   EnsemblGenomes-Tr; EBT00001656980.
DR   EnsemblGenomes-Tr; EBT00001656983.
DR   EnsemblGenomes-Tr; EBT00001656986.
DR   EnsemblGenomes-Tr; EBT00001656989.
DR   EnsemblGenomes-Tr; EBT00001656993.
DR   EnsemblGenomes-Tr; EBT00001656995.
DR   EnsemblGenomes-Tr; EBT00001656998.
DR   EnsemblGenomes-Tr; EBT00001657002.
DR   EnsemblGenomes-Tr; EBT00001657004.
DR   EnsemblGenomes-Tr; EBT00001657008.
DR   EnsemblGenomes-Tr; EBT00001657011.
DR   EnsemblGenomes-Tr; EBT00001657015.
DR   EnsemblGenomes-Tr; EBT00001657019.
DR   EnsemblGenomes-Tr; EBT00001657022.
DR   EnsemblGenomes-Tr; EBT00001657025.
DR   EnsemblGenomes-Tr; EBT00001657028.
DR   EnsemblGenomes-Tr; EBT00001657032.
DR   EnsemblGenomes-Tr; EBT00001657035.
DR   EnsemblGenomes-Tr; EBT00001657038.
DR   EnsemblGenomes-Tr; EBT00001657041.
DR   EnsemblGenomes-Tr; EBT00001657045.
DR   EnsemblGenomes-Tr; EBT00001657047.
DR   EnsemblGenomes-Tr; EBT00001657050.
DR   EnsemblGenomes-Tr; EBT00001657052.
DR   EnsemblGenomes-Tr; EBT00001657056.
DR   EnsemblGenomes-Tr; EBT00001657059.
DR   EnsemblGenomes-Tr; EBT00001657062.
DR   EnsemblGenomes-Tr; EBT00001657065.
DR   EnsemblGenomes-Tr; EBT00001657069.
DR   EnsemblGenomes-Tr; EBT00001657072.
DR   EnsemblGenomes-Tr; EBT00001657074.
DR   EnsemblGenomes-Tr; EBT00001657078.
DR   EnsemblGenomes-Tr; EBT00001657079.
DR   EnsemblGenomes-Tr; EBT00001657080.
DR   EnsemblGenomes-Tr; EBT00001657081.
DR   EnsemblGenomes-Tr; EBT00001657082.
DR   EnsemblGenomes-Tr; EBT00001657083.
DR   EnsemblGenomes-Tr; EBT00001657084.
DR   EnsemblGenomes-Tr; EBT00001657085.
DR   EnsemblGenomes-Tr; EBT00001657086.
DR   EnsemblGenomes-Tr; EBT00001657087.
DR   EnsemblGenomes-Tr; EBT00001657088.
DR   EnsemblGenomes-Tr; EBT00001657089.
DR   EnsemblGenomes-Tr; EBT00001657090.
DR   EnsemblGenomes-Tr; EBT00001657091.
DR   EnsemblGenomes-Tr; EBT00001657092.
DR   EnsemblGenomes-Tr; EBT00001657093.
DR   EnsemblGenomes-Tr; EBT00001657094.
DR   EnsemblGenomes-Tr; EBT00001657095.
DR   EnsemblGenomes-Tr; EBT00001657096.
DR   EnsemblGenomes-Tr; EBT00001657097.
DR   EnsemblGenomes-Tr; EBT00001657098.
DR   EnsemblGenomes-Tr; EBT00001657099.
DR   EnsemblGenomes-Tr; EBT00001657100.
DR   EnsemblGenomes-Tr; EBT00001657101.
DR   EnsemblGenomes-Tr; EBT00001657102.
DR   EnsemblGenomes-Tr; EBT00001657103.
DR   EnsemblGenomes-Tr; EBT00001657104.
DR   EnsemblGenomes-Tr; EBT00001657105.
DR   EnsemblGenomes-Tr; EBT00001657106.
DR   EnsemblGenomes-Tr; EBT00001657107.
DR   EnsemblGenomes-Tr; EBT00001657108.
DR   EnsemblGenomes-Tr; EBT00001657109.
DR   EnsemblGenomes-Tr; EBT00001657110.
DR   EnsemblGenomes-Tr; EBT00001657111.
DR   EnsemblGenomes-Tr; EBT00001657112.
DR   EnsemblGenomes-Tr; EBT00001657113.
DR   EnsemblGenomes-Tr; EBT00001657114.
DR   EnsemblGenomes-Tr; EBT00001657115.
DR   EuropePMC; PMC135346; 12218036.
DR   EuropePMC; PMC1482959; 16740934.
DR   EuropePMC; PMC2228276; 18081934.
DR   EuropePMC; PMC2266912; 18226217.
DR   EuropePMC; PMC2293142; 18310417.
DR   EuropePMC; PMC2413405; 18560597.
DR   EuropePMC; PMC2724981; 19578178.
DR   EuropePMC; PMC2738538; 12453367.
DR   EuropePMC; PMC2756628; 19823582.
DR   EuropePMC; PMC2854294; 20227226.
DR   EuropePMC; PMC308900; 14638775.
DR   EuropePMC; PMC3089889; 21584191.
DR   EuropePMC; PMC3152330; 21478170.
DR   EuropePMC; PMC3738908; 23929492.
DR   EuropePMC; PMC4137073; 25048541.
DR   EuropePMC; PMC4177513; 24975990.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC4425900; 25879806.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC4468655; 25941223.
DR   EuropePMC; PMC4967370; 27450008.
DR   EuropePMC; PMC5310062; 28201993.
DR   EuropePMC; PMC6071665; 30010947.
DR   EuropePMC; PMC6159577; 29987998.
DR   EuropePMC; PMC6299973; 30567498.
DR   GOA; P9WL22.
DR   GOA; P9WL38.
DR   GOA; P9WL40.
DR   GOA; P9WP28.
DR   InterPro; IPR000383; Xaa-Pro-like_dom.
DR   InterPro; IPR002678; GTP_cyclohydrolase_I/Nif3.
DR   InterPro; IPR003743; Zf-RING_7.
DR   InterPro; IPR005218; Diacylglycerol/lipid_kinase.
DR   InterPro; IPR013177; DUF1713.
DR   InterPro; IPR013736; Xaa-Pro_dipept_C.
DR   InterPro; IPR017221; GTP_cyclohydrolase_I_bac.
DR   InterPro; IPR017438; ATP-NAD_kinase_N.
DR   InterPro; IPR019662; DUF2516.
DR   InterPro; IPR019692; DUF2581.
DR   InterPro; IPR024341; DUF2631.
DR   InterPro; IPR029066; PLP-binding_barrel.
DR   InterPro; IPR029069; HotDog_dom_sf.
DR   InterPro; IPR036069; GTP_cyclohydrolase_I/Nif3_sf.
DR   InterPro; IPR039018; VapC20.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01779; AS1726.
DR   RFAM; RF01780; AS1890.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01783; b55.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01798; g2.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; AE000516.
DR   SILVA-SSU; AE000516.
DR   UniProtKB/Swiss-Prot; P0DKR7; WHB5B_MYCTO.
DR   UniProtKB/Swiss-Prot; P0DMV7; VPC20_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WFC2; VPB40_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WFK2; Y504_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WFM0; GCH1L_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WHX0; PPE66_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WHX8; PPE61_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WIG4; WA22_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WIH6; MAZF8_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WIQ8; Y1835_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WIR0; CFP6_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WJX4; Y849_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WKN8; Y942_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WKT4; Y500B_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WKW0; Y476_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WL22; Y2915_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WL32; Y2891_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WL38; Y2876_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WL40; VPB43_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WL52; Y2644_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLE8; Y2283_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLF8; Y2269_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLH2; Y2229_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLJ6; Y2087_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLQ2; Y1954_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLR2; Y1831_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLS6; Y1734_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLU4; Y1549_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WLY4; Y1413_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WMF0; Y880_MYCTO.
DR   UniProtKB/Swiss-Prot; P9WP28; DAGK_MYCTO.
CC   On or before Aug 4, 2004 this sequence version replaced
CC   gi:13879041, gi:13879055, gi:13879070, gi:13879090, gi:13879108,
CC   gi:13879123, gi:13879142, gi:13879151, gi:13879589, gi:13879599,
CC   gi:13879610, gi:13879624, gi:13879642, gi:13879655, gi:13879670,
CC   gi:13879686, gi:13879697, gi:13879709, gi:13879724, gi:13879736,
CC   gi:13879751, gi:13879767, gi:13879783, gi:13879798, gi:13879809,
CC   gi:13879821, gi:13879843, gi:13879855, gi:13879868, gi:13879889,
CC   gi:13879900, gi:13879915, gi:13879929, gi:13879948, gi:13879964,
CC   gi:13879978, gi:13879993, gi:13880013, gi:13880030, gi:13880047,
CC   gi:13880068, gi:13880085, gi:13880102, gi:13880118, gi:13880137,
CC   gi:13880154, gi:13880174, gi:13880186, gi:13880200, gi:13880217,
CC   gi:13880229, gi:13880249, gi:13880270, gi:13880290, gi:13880313,
CC   gi:13880330, gi:13880346, gi:13880364, gi:13880378, gi:13880395,
CC   gi:13880409, gi:13880424, gi:13880441, gi:13880459, gi:13880475,
CC   gi:13880491, gi:13880510, gi:13880526, gi:13880540, gi:13880557,
CC   gi:13880571, gi:13880583, gi:13880606, gi:13880620, gi:13880636,
CC   gi:13880655, gi:13880675, gi:13880691, gi:13880708, gi:13880724,
CC   gi:13880744, gi:13880759, gi:13880776, gi:13880790, gi:13880806,
CC   gi:13880812, gi:13880828, gi:13880843, gi:13880860, gi:13880876,
CC   gi:13880891, gi:13880907, gi:13880923, gi:13880937, gi:13880957,
CC   gi:13880970, gi:13880980, gi:13881000, gi:13881014, gi:13881030,
CC   gi:13881045, gi:13881061, gi:13881076, gi:13881089, gi:13881105,
CC   gi:13881116, gi:13881131, gi:13881145, gi:13881167, gi:13881190,
CC   gi:13881202, gi:13881219, gi:13881234, gi:13881250, gi:13881272,
CC   gi:13881290, gi:13881305, gi:13881320, gi:13881331, gi:13881338,
CC   gi:13881357, gi:13881373, gi:13881388, gi:13881409, gi:13881429,
CC   gi:13881442, gi:13881452, gi:13881471, gi:13881480, gi:13881495,
CC   gi:13881508, gi:13881521, gi:13881535, gi:13881554, gi:13881571,
CC   gi:13881590, gi:13881609, gi:13881625, gi:13881639, gi:13881654,
CC   gi:13881675, gi:13881695, gi:13881717, gi:13881730, gi:13881752,
CC   gi:13881762, gi:13881778, gi:13881782, gi:13881798, gi:13881822,
CC   gi:13881833, gi:13881849, gi:13881867, gi:13881884, gi:13881905,
CC   gi:13881920, gi:13881935, gi:13881949, gi:13881968, gi:13881981,
CC   gi:13881999, gi:13882015, gi:13882033, gi:13882050, gi:13882077,
CC   gi:13882094, gi:13882110, gi:13882124, gi:13882143, gi:13882156,
CC   gi:13882164, gi:13882178, gi:13882193, gi:13882212, gi:13882229,
CC   gi:13882246, gi:13882261, gi:13882278, gi:13882291, gi:13882303,
CC   gi:13882319, gi:13882335, gi:13882347, gi:13882375, gi:13882390,
CC   gi:13882407, gi:13882419, gi:13882440, gi:13882457, gi:13882475,
CC   gi:13882498, gi:13882512, gi:13882530, gi:13882548, gi:13882564,
CC   gi:13882579, gi:13882595, gi:13882617, gi:13882633, gi:13882652,
CC   gi:13882670, gi:13882686, gi:13882699, gi:13882714, gi:13882735,
CC   gi:13882751, gi:13882769, gi:13882781, gi:13882792, gi:13882800,
CC   gi:13882811, gi:13882832, gi:13882849, gi:13882865, gi:13882884,
CC   gi:13882902, gi:13882922, gi:13882943, gi:13882958, gi:13882969,
CC   gi:13882985, gi:13883003, gi:13883022, gi:13883042, gi:13883058,
CC   gi:13883073, gi:13883096, gi:13883109, gi:13883122, gi:13883140,
CC   gi:13883158, gi:13883176, gi:13883192, gi:13883210, gi:13883225,
CC   gi:13883241, gi:13883260, gi:13883275, gi:13883283, gi:13883290,
CC   gi:13883305, gi:13883321, gi:13883336, gi:13883353, gi:13883373,
CC   gi:13883389, gi:13883411, gi:13883439, gi:13883460, gi:13883468,
CC   gi:13883474, gi:13883494, gi:13883508, gi:13883521, gi:13883536,
CC   gi:13883554, gi:13883571, gi:13883590, gi:13883605, gi:13883620,
CC   gi:13883639, gi:13883658, gi:13883672, gi:13883689, gi:13883705,
CC   gi:13883716, gi:13883733, gi:13883751, gi:13883773, gi:13883785,
CC   gi:13883793, gi:13883810, gi:13883820, gi:13883836, gi:13883859,
CC   gi:13883870, gi:13883883, gi:13883894, gi:13883910, gi:13883923,
CC   gi:25168255.
FH   Key             Location/Qualifiers
FT   source          1..4403837
FT                   /organism="Mycobacterium tuberculosis CDC1551"
FT                   /strain="CDC1551"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:83331"
FT   gene            1..1524
FT                   /gene="dnaA"
FT                   /locus_tag="MT0001"
FT   CDS_pept        1..1524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="MT0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to EGAD:30231; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:MT0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44224"
FT                   /db_xref="GOA:P9WNW2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNW2"
FT                   /protein_id="AAK44224.1"
FT   gene            2052..3260
FT                   /gene="dnaN"
FT                   /locus_tag="MT0002"
FT   CDS_pept        2052..3260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="MT0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:30230; match to
FT                   protein family HMM PF00712; match to protein family HMM
FT                   PF02767; match to protein family HMM PF02768; match to
FT                   protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:MT0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44225"
FT                   /db_xref="GOA:P9WNU0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:4TR7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNU0"
FT                   /protein_id="AAK44225.1"
FT                   LPG"
FT   gene            3280..4437
FT                   /gene="recF"
FT                   /locus_tag="MT0003"
FT   CDS_pept        3280..4437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="MT0003"
FT                   /product="recF protein"
FT                   /note="identified by similarity to EGAD:30234; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:MT0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44226"
FT                   /db_xref="GOA:P9WHI8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHI8"
FT                   /protein_id="AAK44226.1"
FT   gene            4434..4997
FT                   /locus_tag="MT0004"
FT   CDS_pept        4434..4997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:20315; match to
FT                   protein family HMM PF05258"
FT                   /db_xref="EnsemblGenomes-Gn:MT0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44227"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFL0"
FT                   /protein_id="AAK44227.1"
FT   gene            5207..7267
FT                   /gene="gyrB"
FT                   /locus_tag="MT0005"
FT   CDS_pept        5207..7267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MT0005"
FT                   /product="DNA gyrase subunit B"
FT                   /note="identified by similarity to EGAD:140845; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:MT0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44228"
FT                   /db_xref="GOA:P9WG44"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG44"
FT                   /protein_id="AAK44228.1"
FT   gene            7302..9818
FT                   /gene="gyrA"
FT                   /locus_tag="MT0006"
FT   CDS_pept        7302..9818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="MT0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:38801; match to
FT                   protein family HMM PF00521; match to protein family HMM
FT                   PF03989; match to protein family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:MT0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44229"
FT                   /db_xref="GOA:P9WG46"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG46"
FT                   /protein_id="AAK44229.1"
FT   gene            9914..10828
FT                   /locus_tag="MT0007"
FT   CDS_pept        9914..10828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:132730"
FT                   /db_xref="EnsemblGenomes-Gn:MT0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44230"
FT                   /db_xref="GOA:P9WMA6"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA6"
FT                   /protein_id="AAK44230.1"
FT   gene            complement(11555..11692)
FT                   /locus_tag="MT0009"
FT   CDS_pept        complement(11555..11692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44231"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKT4"
FT                   /protein_id="AAK44231.1"
FT                   "
FT   gene            complement(11874..12311)
FT                   /locus_tag="MT0010"
FT   CDS_pept        complement(11874..12311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44232"
FT                   /db_xref="GOA:P9WJF2"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJF2"
FT                   /protein_id="AAK44232.1"
FT   gene            12468..13016
FT                   /gene="ppi-1"
FT                   /locus_tag="MT0011"
FT   CDS_pept        12468..13016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppi-1"
FT                   /locus_tag="MT0011"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:1575509; match to
FT                   protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:MT0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44233"
FT                   /db_xref="GOA:P9WHW2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHW2"
FT                   /protein_id="AAK44233.1"
FT   gene            complement(13024..13176)
FT                   /locus_tag="MT0012"
FT   CDS_pept        complement(13024..13176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0012"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44234"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKT3"
FT                   /protein_id="AAK44234.1"
FT                   SDEPT"
FT   gene            complement(13133..13558)
FT                   /locus_tag="MT0013"
FT   CDS_pept        complement(13133..13558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44235"
FT                   /db_xref="GOA:P9WMA2"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA2"
FT                   /protein_id="AAK44235.1"
FT   gene            complement(13714..13995)
FT                   /locus_tag="MT0014"
FT   CDS_pept        complement(13714..13995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44236"
FT                   /db_xref="GOA:P9WP56"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP56"
FT                   /protein_id="AAK44236.1"
FT   gene            14089..14877
FT                   /locus_tag="MT0015"
FT   CDS_pept        14089..14877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5102805"
FT                   /db_xref="EnsemblGenomes-Gn:MT0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44237"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAK7"
FT                   /protein_id="AAK44237.1"
FT   gene            14914..15612
FT                   /locus_tag="MT0016"
FT   CDS_pept        14914..15612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0016"
FT                   /product="glutamine amidotransferase, class I"
FT                   /note="identified by similarity to EGAD:151778; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:MT0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44238"
FT                   /db_xref="GOA:P9WN34"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WN34"
FT                   /protein_id="AAK44238.1"
FT                   AGEATGRTSA"
FT   gene            complement(15590..17470)
FT                   /locus_tag="MT0017"
FT   CDS_pept        complement(15590..17470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0017"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to EGAD:142239; match to
FT                   protein family HMM PF00069; match to protein family HMM
FT                   PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:MT0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44239"
FT                   /db_xref="GOA:P9WI80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI80"
FT                   /protein_id="AAK44239.1"
FT   gene            complement(17467..18762)
FT                   /locus_tag="MT0018"
FT   CDS_pept        complement(17467..18762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0018"
FT                   /product="serine/threonine protein kinase"
FT                   /note="identified by similarity to EGAD:142240; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MT0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44240"
FT                   /db_xref="GOA:P9WI82"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI82"
FT                   /protein_id="AAK44240.1"
FT   gene            complement(18759..20234)
FT                   /locus_tag="MT0019"
FT   CDS_pept        complement(18759..20234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0019"
FT                   /product="penicillin-binding protein, putative"
FT                   /note="identified by similarity to GP:5139605; match to
FT                   protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:MT0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44241"
FT                   /db_xref="GOA:P9WKD0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKD0"
FT                   /protein_id="AAK44241.1"
FT   gene            complement(20231..21640)
FT                   /gene="ftsW-1"
FT                   /locus_tag="MT0020"
FT   CDS_pept        complement(20231..21640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW-1"
FT                   /locus_tag="MT0020"
FT                   /product="cell division protein FtsW"
FT                   /note="identified by similarity to EGAD:20048; match to
FT                   protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:MT0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44242"
FT                   /db_xref="GOA:P9WN98"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WN98"
FT                   /protein_id="AAK44242.1"
FT                   TAAGTEVIERV"
FT   gene            complement(21637..23172)
FT                   /locus_tag="MT0021"
FT   CDS_pept        complement(21637..23172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5102797; match to
FT                   protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:MT0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44243"
FT                   /db_xref="GOA:P9WHW4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHW4"
FT                   /protein_id="AAK44243.1"
FT   gene            complement(23270..23737)
FT                   /locus_tag="MT0022"
FT   CDS_pept        complement(23270..23737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5102796; match to
FT                   protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:MT0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44244"
FT                   /db_xref="GOA:P9WJB4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJB4"
FT                   /protein_id="AAK44244.1"
FT   gene            complement(23861..25426)
FT                   /locus_tag="MT0023"
FT   CDS_pept        complement(23861..25426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:132732; match to
FT                   protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:MT0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44245"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKT1"
FT                   /protein_id="AAK44245.1"
FT                   VRMH"
FT   gene            complement(25895..26863)
FT                   /locus_tag="MT0024"
FT   CDS_pept        complement(25895..26863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0024"
FT                   /product="2-nitropropane dioxygenase"
FT                   /note="identified by similarity to EGAD:99227; match to
FT                   protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:MT0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44246"
FT                   /db_xref="GOA:L7N625"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:L7N625"
FT                   /protein_id="AAK44246.1"
FT   gene            26975..27283
FT                   /locus_tag="MT0025"
FT   CDS_pept        26975..27283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44247"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKT0"
FT                   /protein_id="AAK44247.1"
FT   gene            27577..28347
FT                   /locus_tag="MT0026"
FT   CDS_pept        27577..28347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0026"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by similarity to GP:3192004; match to
FT                   protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MT0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44248"
FT                   /db_xref="GOA:P9WMI2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMI2"
FT                   /protein_id="AAK44248.1"
FT   gene            28344..29189
FT                   /locus_tag="MT0027"
FT   CDS_pept        28344..29189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0027"
FT                   /product="NLP/P60 family protein"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:MT0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44249"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:L7N550"
FT                   /protein_id="AAK44249.1"
FT                   "
FT   gene            29227..29499
FT                   /locus_tag="MT0028"
FT   CDS_pept        29227..29499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0028"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44250"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA0"
FT                   /protein_id="AAK44250.1"
FT   gene            29703..31049
FT                   /locus_tag="MT0029"
FT   CDS_pept        29703..31049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44251"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMB0"
FT                   /protein_id="AAK44251.1"
FT   gene            31170..31487
FT                   /locus_tag="MT0030"
FT   CDS_pept        31170..31487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0030"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44252"
FT                   /db_xref="GOA:P9WM98"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM98"
FT                   /protein_id="AAK44252.1"
FT                   R"
FT   gene            31573..31800
FT                   /locus_tag="MT0030.1"
FT   CDS_pept        31573..31800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0030.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0030.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44253"
FT                   /db_xref="InterPro:IPR024426"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM96"
FT                   /protein_id="AAK44253.1"
FT   gene            complement(31805..31948)
FT                   /locus_tag="MT0031"
FT   CDS_pept        complement(31805..31948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44254"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS9"
FT                   /protein_id="AAK44254.1"
FT                   LI"
FT   gene            complement(32031..32609)
FT                   /locus_tag="MT0032"
FT   CDS_pept        complement(32031..32609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44255"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS8"
FT                   /protein_id="AAK44255.1"
FT   gene            32646..33098
FT                   /locus_tag="MT0033"
FT   CDS_pept        32646..33098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0033"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44256"
FT                   /db_xref="InterPro:IPR040833"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS7"
FT                   /protein_id="AAK44256.1"
FT   gene            33168..33497
FT                   /locus_tag="MT0034"
FT   CDS_pept        33168..33497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44257"
FT                   /db_xref="InterPro:IPR024296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM94"
FT                   /protein_id="AAK44257.1"
FT                   GGRLQ"
FT   gene            33526..33738
FT                   /locus_tag="MT0035"
FT   CDS_pept        33526..33738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44258"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5W5"
FT                   /protein_id="AAK44258.1"
FT   gene            complement(33844..34101)
FT                   /locus_tag="MT0036"
FT   CDS_pept        complement(33844..34101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS6"
FT                   /protein_id="AAK44259.1"
FT   gene            34239..36554
FT                   /locus_tag="MT0037"
FT   CDS_pept        34239..36554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0037"
FT                   /product="aminotransferase, class II"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:MT0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44260"
FT                   /db_xref="GOA:P9WQ84"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ84"
FT                   /protein_id="AAK44260.1"
FT                   LHVFAGLAEDLTPQGAAL"
FT   gene            36551..36814
FT                   /gene="acp-1"
FT                   /locus_tag="MT0038"
FT   CDS_pept        36551..36814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acp-1"
FT                   /locus_tag="MT0038"
FT                   /product="acyl carrier protein"
FT                   /note="identified by similarity to EGAD:37837; match to
FT                   protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:MT0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44261"
FT                   /db_xref="GOA:P71603"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="PDB:2CGQ"
FT                   /db_xref="UniProtKB/TrEMBL:P71603"
FT                   /protein_id="AAK44261.1"
FT   gene            36811..37206
FT                   /locus_tag="MT0039"
FT   CDS_pept        36811..37206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44262"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM92"
FT                   /protein_id="AAK44262.1"
FT   gene            37203..38891
FT                   /locus_tag="MT0040"
FT   CDS_pept        37203..38891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0040"
FT                   /product="AMP-binding family protein"
FT                   /note="identified by similarity to EGAD:154332; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44263"
FT                   /db_xref="GOA:Q7DAJ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAJ8"
FT                   /protein_id="AAK44263.1"
FT   gene            complement(39000..39773)
FT                   /locus_tag="MT0041"
FT   CDS_pept        complement(39000..39773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44264"
FT                   /db_xref="GOA:P9WM90"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM90"
FT                   /protein_id="AAK44264.1"
FT   gene            complement(39821..41122)
FT                   /locus_tag="MT0042"
FT   CDS_pept        complement(39821..41122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0042"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to GP:4808394"
FT                   /db_xref="EnsemblGenomes-Gn:MT0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44265"
FT                   /db_xref="GOA:P9WJY0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJY0"
FT                   /protein_id="AAK44265.1"
FT   gene            41248..41856
FT                   /locus_tag="MT0043"
FT   CDS_pept        41248..41856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:132725; match to
FT                   protein family HMM PF02622"
FT                   /db_xref="EnsemblGenomes-Gn:MT0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44266"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFK4"
FT                   /protein_id="AAK44266.1"
FT   gene            complement(41948..42295)
FT                   /locus_tag="MT0044"
FT   CDS_pept        complement(41948..42295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:132734"
FT                   /db_xref="EnsemblGenomes-Gn:MT0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44267"
FT                   /db_xref="GOA:P9WM88"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM88"
FT                   /protein_id="AAK44267.1"
FT                   GSCAVCTQACH"
FT   gene            complement(42377..43309)
FT                   /gene="mtc28"
FT                   /locus_tag="MT0046"
FT   CDS_pept        complement(42377..43309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtc28"
FT                   /locus_tag="MT0046"
FT                   /product="proline rich 28 kDa antigen"
FT                   /note="identified by similarity to GP:2522307"
FT                   /db_xref="EnsemblGenomes-Gn:MT0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44268"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIM8"
FT                   /protein_id="AAK44268.1"
FT   gene            43506..46415
FT                   /gene="leuS"
FT                   /locus_tag="MT0047"
FT   CDS_pept        43506..46415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="MT0047"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:134418; match to
FT                   protein family HMM PF00133; match to protein family HMM
FT                   TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:MT0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44269"
FT                   /db_xref="GOA:P9WFV0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFV0"
FT                   /protein_id="AAK44269.1"
FT   gene            complement(46525..47151)
FT                   /locus_tag="MT0048"
FT   CDS_pept        complement(46525..47151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0048"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by similarity to EGAD:132183; match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:MT0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44270"
FT                   /db_xref="GOA:L7N4F5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4F5"
FT                   /protein_id="AAK44270.1"
FT   gene            complement(47310..48044)
FT                   /locus_tag="MT0049"
FT   CDS_pept        complement(47310..48044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0049"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by similarity to GP:2623054; match to
FT                   protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:MT0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44271"
FT                   /db_xref="GOA:P9WMG8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMG8"
FT                   /protein_id="AAK44271.1"
FT   gene            complement(48177..48971)
FT                   /locus_tag="MT0050"
FT   CDS_pept        complement(48177..48971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4895125"
FT                   /db_xref="EnsemblGenomes-Gn:MT0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44272"
FT                   /db_xref="GOA:L7N5Z1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5Z1"
FT                   /protein_id="AAK44272.1"
FT   gene            complement(48987..49883)
FT                   /locus_tag="MT0051"
FT   CDS_pept        complement(48987..49883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44273"
FT                   /db_xref="GOA:P71702"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:3P2M"
FT                   /db_xref="UniProtKB/TrEMBL:P71702"
FT                   /protein_id="AAK44273.1"
FT                   DQPRALIEIVRGVLDTR"
FT   gene            complement(49965..51068)
FT                   /locus_tag="MT0052"
FT   CDS_pept        complement(49965..51068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0052"
FT                   /product="1L-myo-inositol-1-phosphate synthase"
FT                   /note="identified by similarity to GP:4808395; match to
FT                   protein family HMM PF01658"
FT                   /db_xref="EnsemblGenomes-Gn:MT0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44274"
FT                   /db_xref="GOA:P9WKI0"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKI0"
FT                   /protein_id="AAK44274.1"
FT   gene            complement(51129..51671)
FT                   /locus_tag="MT0053"
FT   CDS_pept        complement(51129..51671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108240; match to
FT                   protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:MT0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44275"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAJ4"
FT                   /protein_id="AAK44275.1"
FT                   NELIAAERAAPNPAEQT"
FT   gene            complement(51772..52641)
FT                   /locus_tag="MT0054"
FT   CDS_pept        complement(51772..52641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44276"
FT                   /db_xref="GOA:P9WM86"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM86"
FT                   /protein_id="AAK44276.1"
FT                   IKHVSYPS"
FT   gene            52775..53188
FT                   /locus_tag="MT0055"
FT   CDS_pept        52775..53188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2959416"
FT                   /db_xref="EnsemblGenomes-Gn:MT0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44277"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM84"
FT                   /protein_id="AAK44277.1"
FT   gene            53181..55643
FT                   /gene="ponA"
FT                   /locus_tag="MT0056"
FT   CDS_pept        53181..55643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ponA"
FT                   /locus_tag="MT0056"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by similarity to EGAD:39071; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:MT0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44278"
FT                   /db_xref="GOA:Q8VKS5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS5"
FT                   /protein_id="AAK44278.1"
FT                   AATPTPPP"
FT   gene            55685..57322
FT                   /locus_tag="MT0057"
FT   CDS_pept        55685..57322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4808398"
FT                   /db_xref="EnsemblGenomes-Gn:MT0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44279"
FT                   /db_xref="GOA:Q7DAJ3"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAJ3"
FT                   /protein_id="AAK44279.1"
FT   gene            57279..57917
FT                   /locus_tag="MT0058"
FT   CDS_pept        57279..57917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0058"
FT                   /product="4-methyl-5(B-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis enzyme, putative"
FT                   /note="identified by similarity to GP:4584494; match to
FT                   protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:MT0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44280"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAJ2"
FT                   /protein_id="AAK44280.1"
FT   gene            58136..58426
FT                   /gene="rpsF"
FT                   /locus_tag="MT0059"
FT   CDS_pept        58136..58426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="MT0059"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by similarity to EGAD:30232; match to
FT                   protein family HMM PF01250; match to protein family HMM
FT                   TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:MT0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44281"
FT                   /db_xref="GOA:P9WH30"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH30"
FT                   /protein_id="AAK44281.1"
FT   gene            58530..59024
FT                   /gene="ssb"
FT                   /locus_tag="MT0060"
FT   CDS_pept        58530..59024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="MT0060"
FT                   /product="single-strand binding protein"
FT                   /note="identified by similarity to EGAD:30233; match to
FT                   protein family HMM PF00436; match to protein family HMM
FT                   TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:MT0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44282"
FT                   /db_xref="GOA:P9WGD4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGD4"
FT                   /protein_id="AAK44282.1"
FT                   F"
FT   gene            59066..59320
FT                   /gene="rpsR-1"
FT                   /locus_tag="MT0061"
FT   CDS_pept        59066..59320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR-1"
FT                   /locus_tag="MT0061"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by similarity to GP:4808404; match to
FT                   protein family HMM PF01084; match to protein family HMM
FT                   TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:MT0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44283"
FT                   /db_xref="GOA:P9WH48"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH48"
FT                   /protein_id="AAK44283.1"
FT   gene            59353..59811
FT                   /gene="rplI"
FT                   /locus_tag="MT0062"
FT   CDS_pept        59353..59811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="MT0062"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by similarity to GP:4808405; match to
FT                   protein family HMM PF01281; match to protein family HMM
FT                   PF03948; match to protein family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:MT0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44284"
FT                   /db_xref="GOA:P9WH78"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH78"
FT                   /protein_id="AAK44284.1"
FT   gene            59840..60361
FT                   /locus_tag="MT0063"
FT   CDS_pept        59840..60361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44285"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM76"
FT                   /protein_id="AAK44285.1"
FT                   GESPWRSLMT"
FT   gene            60340..62964
FT                   /gene="dnaB"
FT                   /locus_tag="MT0064"
FT   CDS_pept        60340..62964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="MT0064"
FT                   /product="replicative DNA helicase, intein-containing"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to GP:2959407; match to
FT                   protein family HMM PF00772; match to protein family HMM
FT                   PF03796; match to protein family HMM TIGR00665; match to
FT                   protein family HMM TIGR01443; match to protein family HMM
FT                   TIGR01445"
FT                   /db_xref="EnsemblGenomes-Gn:MT0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44286"
FT                   /db_xref="GOA:P9WMR2"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMR2"
FT                   /protein_id="AAK44286.1"
FT                   MAR"
FT   gene            63144..63836
FT                   /locus_tag="MT0065"
FT   CDS_pept        63144..63836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44287"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4F6"
FT                   /protein_id="AAK44287.1"
FT                   VIKPGMYY"
FT   gene            63853..64911
FT                   /locus_tag="MT0066"
FT   CDS_pept        63853..64911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0066"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44288"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5R6"
FT                   /protein_id="AAK44288.1"
FT                   IGVALDRILMTA"
FT   gene            complement(64956..65336)
FT                   /locus_tag="MT0066.1"
FT   CDS_pept        complement(64956..65336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0066.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0066.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44289"
FT                   /db_xref="GOA:Q8VKS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS4"
FT                   /protein_id="AAK44289.1"
FT   gene            complement(65344..65556)
FT                   /locus_tag="MT0066.2"
FT   CDS_pept        complement(65344..65556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0066.2"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0066.2"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44290"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS3"
FT                   /protein_id="AAK44290.1"
FT   gene            65496..66638
FT                   /gene="celA"
FT                   /locus_tag="MT0067"
FT   CDS_pept        65496..66638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celA"
FT                   /locus_tag="MT0067"
FT                   /product="cellulase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:10117; match to
FT                   protein family HMM PF01341"
FT                   /db_xref="EnsemblGenomes-Gn:MT0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44291"
FT                   /db_xref="GOA:Q7DAI9"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAI9"
FT                   /protein_id="AAK44291.1"
FT   gene            66867..68306
FT                   /gene="mitR"
FT                   /locus_tag="MT0068"
FT   CDS_pept        66867..68306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mitR"
FT                   /locus_tag="MT0068"
FT                   /product="mitR protein"
FT                   /note="identified by similarity to GP:4731337; match to
FT                   protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:MT0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44292"
FT                   /db_xref="GOA:L7N4J5"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4J5"
FT                   /protein_id="AAK44292.1"
FT   gene            68362..68523
FT                   /locus_tag="MT0069"
FT   CDS_pept        68362..68523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0069"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS2"
FT                   /protein_id="AAK44293.1"
FT                   PATSPLRR"
FT   gene            68564..71503
FT                   /locus_tag="MT0070"
FT   CDS_pept        68564..71503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:105405; match to
FT                   protein family HMM PF03699"
FT                   /db_xref="EnsemblGenomes-Gn:MT0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44294"
FT                   /db_xref="GOA:P9WFL4"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFL4"
FT                   /protein_id="AAK44294.1"
FT   gene            71802..72203
FT                   /locus_tag="MT0071"
FT   CDS_pept        71802..72203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0071"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44295"
FT                   /db_xref="GOA:P9WFC0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFC0"
FT                   /protein_id="AAK44295.1"
FT   gene            complement(72255..74492)
FT                   /gene="icd-1"
FT                   /locus_tag="MT0072"
FT   CDS_pept        complement(72255..74492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd-1"
FT                   /locus_tag="MT0072"
FT                   /product="isocitrate dehydrogenase, NADP-dependent,
FT                   monomeric type"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:40125; match to
FT                   protein family HMM PF03971; match to protein family HMM
FT                   TIGR00178"
FT                   /db_xref="EnsemblGenomes-Gn:MT0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44296"
FT                   /db_xref="GOA:L7N5H0"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5H0"
FT                   /protein_id="AAK44296.1"
FT   gene            complement(74610..75179)
FT                   /locus_tag="MT0073"
FT   CDS_pept        complement(74610..75179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0073"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:4154041; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44297"
FT                   /db_xref="GOA:L7N554"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:L7N554"
FT                   /protein_id="AAK44297.1"
FT   gene            75282..76193
FT                   /locus_tag="MT0074"
FT   CDS_pept        75282..76193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0074"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by similarity to GP:3778997; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MT0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44298"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAI4"
FT                   /protein_id="AAK44298.1"
FT   gene            complement(76218..77603)
FT                   /gene="sdaA"
FT                   /locus_tag="MT0075"
FT   CDS_pept        complement(76218..77603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="MT0075"
FT                   /product="L-serine dehydratase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:97858; match to
FT                   protein family HMM PF03313; match to protein family HMM
FT                   PF03315; match to protein family HMM TIGR00720"
FT                   /db_xref="EnsemblGenomes-Gn:MT0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44299"
FT                   /db_xref="GOA:P9WGT4"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGT4"
FT                   /protein_id="AAK44299.1"
FT                   VEC"
FT   gene            complement(77600..78877)
FT                   /gene="glyA-1"
FT                   /locus_tag="MT0076"
FT   CDS_pept        complement(77600..78877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA-1"
FT                   /locus_tag="MT0076"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:10042; similarity
FT                   to GP:3402237; match to protein family HMM PF00464"
FT                   /db_xref="EnsemblGenomes-Gn:MT0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44300"
FT                   /db_xref="GOA:P9WGI6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGI6"
FT                   /protein_id="AAK44300.1"
FT   gene            79467..80183
FT                   /locus_tag="MT0077"
FT   CDS_pept        79467..80183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:135254"
FT                   /db_xref="EnsemblGenomes-Gn:MT0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44301"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS1"
FT                   /protein_id="AAK44301.1"
FT                   YRYRGNTIPTPWTQAV"
FT   gene            80614..81663
FT                   /locus_tag="MT0078"
FT   CDS_pept        80614..81663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107128; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MT0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44302"
FT                   /db_xref="GOA:P9WG16"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG16"
FT                   /protein_id="AAK44302.1"
FT                   DPAQAFGGP"
FT   gene            81666..82658
FT                   /locus_tag="MT0079"
FT   CDS_pept        81666..82658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0079"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to EGAD:103311; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:MT0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44303"
FT                   /db_xref="GOA:P9WQK4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQK4"
FT                   /protein_id="AAK44303.1"
FT   gene            82738..83973
FT                   /locus_tag="MT0080"
FT   CDS_pept        82738..83973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:106895; match to
FT                   protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:MT0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44304"
FT                   /db_xref="GOA:L7N543"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:L7N543"
FT                   /protein_id="AAK44304.1"
FT                   LQASAVGYNTPS"
FT   gene            83986..85158
FT                   /locus_tag="MT0081"
FT   CDS_pept        83986..85158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0081"
FT                   /product="aminotransferase, class I"
FT                   /note="identified by similarity to EGAD:8436; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:MT0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44305"
FT                   /db_xref="GOA:L7N5E9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5E9"
FT                   /protein_id="AAK44305.1"
FT   gene            complement(85173..85562)
FT                   /locus_tag="MT0082"
FT   CDS_pept        complement(85173..85562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44306"
FT                   /db_xref="GOA:L7N5K7"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5K7"
FT                   /protein_id="AAK44306.1"
FT   gene            complement(85626..86480)
FT                   /locus_tag="MT0083"
FT   CDS_pept        complement(85626..86480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0083"
FT                   /product="hydrolase, alpha/beta hydrolase fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MT0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44307"
FT                   /db_xref="GOA:Q7DAH8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAH8"
FT                   /protein_id="AAK44307.1"
FT                   VRT"
FT   gene            86518..87123
FT                   /locus_tag="MT0084"
FT   CDS_pept        86518..87123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0084"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to EGAD:48283; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44308"
FT                   /db_xref="GOA:L7N4U6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4U6"
FT                   /protein_id="AAK44308.1"
FT   gene            complement(87198..87791)
FT                   /locus_tag="MT0085"
FT   CDS_pept        complement(87198..87791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44309"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKS0"
FT                   /protein_id="AAK44309.1"
FT   gene            complement(87788..88000)
FT                   /locus_tag="MT0085.1"
FT   CDS_pept        complement(87788..88000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0085.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0085.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44310"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR9"
FT                   /protein_id="AAK44310.1"
FT   gene            88194..89015
FT                   /locus_tag="MT0086"
FT   CDS_pept        88194..89015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44311"
FT                   /db_xref="GOA:P9WMA8"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA8"
FT                   /protein_id="AAK44311.1"
FT   gene            89057..89470
FT                   /locus_tag="MT0087"
FT   CDS_pept        89057..89470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5777687"
FT                   /db_xref="EnsemblGenomes-Gn:MT0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44312"
FT                   /db_xref="GOA:P9WMA4"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA4"
FT                   /protein_id="AAK44312.1"
FT   gene            89565..89909
FT                   /locus_tag="MT0088"
FT   CDS_pept        89565..89909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0088"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by similarity to GP:5019372; match to
FT                   protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:MT0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44313"
FT                   /db_xref="GOA:P9WMI6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMI6"
FT                   /protein_id="AAK44313.1"
FT                   EDLRAGGSAT"
FT   gene            89914..90393
FT                   /locus_tag="MT0089"
FT   CDS_pept        89914..90393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0089"
FT                   /product="NADH-ubiquinone oxidoreductase, 20 Kd subunit"
FT                   /note="identified by similarity to EGAD:157973; match to
FT                   protein family HMM PF01058"
FT                   /db_xref="EnsemblGenomes-Gn:MT0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44314"
FT                   /db_xref="GOA:Q7DAH3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAH3"
FT                   /protein_id="AAK44314.1"
FT   gene            90390..92312
FT                   /locus_tag="MT0090"
FT   CDS_pept        90390..92312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0090"
FT                   /product="NADH-ubiquinone oxidoreductase, putative"
FT                   /note="identified by similarity to GP:3128268; match to
FT                   protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:MT0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44315"
FT                   /db_xref="GOA:P9WIW2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIW2"
FT                   /protein_id="AAK44315.1"
FT                   LVVAR"
FT   gene            92318..93268
FT                   /gene="hycD"
FT                   /locus_tag="MT0091"
FT   CDS_pept        92318..93268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycD"
FT                   /locus_tag="MT0091"
FT                   /product="formate hydrogenlyase, subunit 4"
FT                   /note="identified by similarity to EGAD:10144; match to
FT                   protein family HMM PF00146"
FT                   /db_xref="EnsemblGenomes-Gn:MT0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44316"
FT                   /db_xref="GOA:L7N4H6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4H6"
FT                   /protein_id="AAK44316.1"
FT   gene            93279..93941
FT                   /gene="hyfE"
FT                   /locus_tag="MT0092"
FT   CDS_pept        93279..93941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyfE"
FT                   /locus_tag="MT0092"
FT                   /product="hydrogenase-4 component E"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by similarity to EGAD:91723"
FT                   /db_xref="EnsemblGenomes-Gn:MT0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44317"
FT                   /db_xref="GOA:P9WM74"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM74"
FT                   /protein_id="AAK44317.1"
FT   gene            93941..95407
FT                   /locus_tag="MT0093"
FT   CDS_pept        93941..95407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0093"
FT                   /product="NADH-ubiquinone oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:MT0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44318"
FT                   /db_xref="GOA:L7N4G0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4G0"
FT                   /protein_id="AAK44318.1"
FT   gene            95590..96882
FT                   /pseudo
FT                   /gene="hycE"
FT                   /locus_tag="MT0095"
FT                   /note="formate hydrogenlyase, subunit 5; this gene contains
FT                   a premature stop which is not the result of sequencing
FT                   error;identified by similarity to EGAD:9621; match to
FT                   protein family HMM PF00329"
FT   gene            96917..97591
FT                   /locus_tag="MT0096"
FT   CDS_pept        96917..97591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0096"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44319"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM72"
FT                   /protein_id="AAK44319.1"
FT                   RA"
FT   gene            97748..98341
FT                   /locus_tag="MT0098"
FT   CDS_pept        97748..98341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0098"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by similarity to GP:145427"
FT                   /db_xref="EnsemblGenomes-Gn:MT0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44320"
FT                   /db_xref="GOA:P9WK02"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WK02"
FT                   /protein_id="AAK44320.1"
FT   gene            98470..99240
FT                   /locus_tag="MT0099"
FT   CDS_pept        98470..99240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44321"
FT                   /db_xref="GOA:P9WM70"
FT                   /db_xref="InterPro:IPR014511"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM70"
FT                   /protein_id="AAK44321.1"
FT   gene            99259..99630
FT                   /locus_tag="MT0099.1"
FT   CDS_pept        99259..99630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0099.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0099.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44322"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR8"
FT                   /protein_id="AAK44322.1"
FT   gene            99674..100441
FT                   /locus_tag="MT0100"
FT   CDS_pept        99674..100441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0100"
FT                   /product="5-methylthioadenosine
FT                   nucleosidase/S-adenosylhomocysteine nucleosidase, putative"
FT                   /note="identified by similarity to EGAD:109995; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:MT0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44323"
FT                   /db_xref="GOA:P9WJM2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJM2"
FT                   /protein_id="AAK44323.1"
FT   gene            100573..102858
FT                   /locus_tag="MT0101"
FT   CDS_pept        100573..102858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0101"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by similarity to EGAD:30313; match to
FT                   protein family HMM PF00122; match to protein family HMM
FT                   PF00403; match to protein family HMM PF00702; match to
FT                   protein family HMM TIGR01494; match to protein family HMM
FT                   TIGR01511; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:MT0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44324"
FT                   /db_xref="GOA:P9WPU0"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPU0"
FT                   /protein_id="AAK44324.1"
FT                   QMTAPSSA"
FT   gene            complement(102805..103653)
FT                   /locus_tag="MT0102"
FT   CDS_pept        complement(102805..103653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44325"
FT                   /db_xref="GOA:P9WM68"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM68"
FT                   /protein_id="AAK44325.1"
FT                   A"
FT   gene            complement(103700..104563)
FT                   /locus_tag="MT0103"
FT   CDS_pept        complement(103700..104563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2791849; match to
FT                   protein family HMM PF02720"
FT                   /db_xref="EnsemblGenomes-Gn:MT0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44326"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR7"
FT                   /protein_id="AAK44326.1"
FT                   DDDKPD"
FT   gene            complement(104424..105091)
FT                   /pseudo
FT                   /locus_tag="MT0104"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error;identified by similarity to
FT                   GP:2791850"
FT   gene            105314..106705
FT                   /locus_tag="MT0105"
FT   CDS_pept        105314..106705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0105"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to EGAD:46307; match to
FT                   protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MT0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44327"
FT                   /db_xref="GOA:P9WI48"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI48"
FT                   /protein_id="AAK44327.1"
FT                   TDAEQ"
FT   gene            106724..107593
FT                   /locus_tag="MT0106"
FT   CDS_pept        106724..107593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0106"
FT                   /product="dioxygenase, putative"
FT                   /note="identified by similarity to EGAD:36969; match to
FT                   protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:MT0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44328"
FT                   /db_xref="GOA:P9WG82"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG82"
FT                   /protein_id="AAK44328.1"
FT                   LKTPGYAA"
FT   gene            107590..108141
FT                   /locus_tag="MT0107"
FT   CDS_pept        107590..108141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44329"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM66"
FT                   /protein_id="AAK44329.1"
FT   gene            108146..109768
FT                   /locus_tag="MT0108"
FT   CDS_pept        108146..109768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0108"
FT                   /product="substrate--CoA ligase, putative"
FT                   /note="identified by similarity to EGAD:32938; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44330"
FT                   /db_xref="GOA:P9WQ54"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ54"
FT                   /protein_id="AAK44330.1"
FT   gene            109773..110009
FT                   /locus_tag="MT0109"
FT   CDS_pept        109773..110009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0109"
FT                   /product="pp-binding family protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:MT0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44331"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM64"
FT                   /protein_id="AAK44331.1"
FT   gene            109967..117529
FT                   /locus_tag="MT0110"
FT   CDS_pept        109967..117529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0110"
FT                   /product="peptide synthetase, putative"
FT                   /note="identified by similarity to EGAD:32939; match to
FT                   protein family HMM PF00501; match to protein family HMM
FT                   PF00550; match to protein family HMM PF00668; match to
FT                   protein family HMM TIGR01612; match to protein family HMM
FT                   TIGR01733; match to protein family HMM TIGR01746"
FT                   /db_xref="EnsemblGenomes-Gn:MT0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44332"
FT                   /db_xref="GOA:Q7DAG9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAG9"
FT                   /protein_id="AAK44332.1"
FT   gene            117704..119689
FT                   /locus_tag="MT0111"
FT   CDS_pept        117704..119689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:32940"
FT                   /db_xref="EnsemblGenomes-Gn:MT0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44333"
FT                   /db_xref="GOA:P9WM62"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM62"
FT                   /protein_id="AAK44333.1"
FT   gene            complement(119905..122163)
FT                   /locus_tag="MT0112"
FT   CDS_pept        complement(119905..122163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0112"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by similarity to EGAD:30313; match to
FT                   protein family HMM PF00122; match to protein family HMM
FT                   PF00403; match to protein family HMM PF00702; match to
FT                   protein family HMM TIGR01494; match to protein family HMM
FT                   TIGR01511; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:MT0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44334"
FT                   /db_xref="GOA:P9WPT8"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPT8"
FT                   /protein_id="AAK44334.1"
FT   gene            122307..123821
FT                   /locus_tag="MT0113"
FT   CDS_pept        122307..123821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0113"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by similarity to EGAD:53333; match to
FT                   protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:MT0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44335"
FT                   /db_xref="GOA:P9WM60"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM60"
FT                   /protein_id="AAK44335.1"
FT   gene            complement(123970..124254)
FT                   /gene="rpmB-1"
FT                   /locus_tag="MT0114"
FT   CDS_pept        complement(123970..124254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB-1"
FT                   /locus_tag="MT0114"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by similarity to EGAD:50445; match to
FT                   protein family HMM PF00830; match to protein family HMM
FT                   TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:MT0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44336"
FT                   /db_xref="GOA:P9WHB0"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHB0"
FT                   /protein_id="AAK44336.1"
FT   gene            124364..125560
FT                   /locus_tag="MT0115"
FT   CDS_pept        124364..125560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4139234; match to
FT                   protein family HMM PF02492"
FT                   /db_xref="EnsemblGenomes-Gn:MT0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44337"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPI4"
FT                   /protein_id="AAK44337.1"
FT   gene            complement(125655..130532)
FT                   /locus_tag="MT0116"
FT   CDS_pept        complement(125655..130532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0116"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:MT0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44338"
FT                   /db_xref="GOA:P9WPS4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPS4"
FT                   /protein_id="AAK44338.1"
FT   gene            130572..130697
FT                   /locus_tag="MT0116.1"
FT   CDS_pept        130572..130697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0116.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0116.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44339"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR6"
FT                   /protein_id="AAK44339.1"
FT   gene            complement(130886..131092)
FT                   /locus_tag="MT0117"
FT   CDS_pept        complement(130886..131092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0117"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAG8"
FT                   /protein_id="AAK44340.1"
FT   gene            131263..132864
FT                   /locus_tag="MT0118"
FT   CDS_pept        131263..132864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0118"
FT                   /product="PE_PGRS family protein"
FT                   /note="identified by similarity to EGAD:160757; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44341"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR5"
FT                   /protein_id="AAK44341.1"
FT                   GSGGTIFGFAGTPGPS"
FT   gene            132907..133761
FT                   /locus_tag="MT0119"
FT   CDS_pept        132907..133761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0119"
FT                   /product="Rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:MT0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44342"
FT                   /db_xref="GOA:Q7DAG7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAG7"
FT                   /protein_id="AAK44342.1"
FT                   NLS"
FT   gene            133942..135999
FT                   /locus_tag="MT0120"
FT   CDS_pept        133942..135999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0120"
FT                   /product="acetyltransferase, putative"
FT                   /note="identified by similarity to GP:1518853; match to
FT                   protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:MT0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44343"
FT                   /db_xref="GOA:Q7DAG6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAG6"
FT                   /protein_id="AAK44343.1"
FT   gene            136281..137237
FT                   /locus_tag="MT0121"
FT   CDS_pept        136281..137237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0121"
FT                   /product="GDP-D-mannose dehydratase, putative"
FT                   /note="identified by similarity to EGAD:38654; match to
FT                   protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MT0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44344"
FT                   /db_xref="GOA:L7N5R0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5R0"
FT                   /protein_id="AAK44344.1"
FT   gene            137242..138504
FT                   /gene="gmhA"
FT                   /locus_tag="MT0122"
FT   CDS_pept        137242..138504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="MT0122"
FT                   /product="phosphoheptose isomerase"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM TIGR00441; match to protein
FT                   family HMM TIGR01656; match to protein family HMM
FT                   TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:MT0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44345"
FT                   /db_xref="GOA:P9WGG0"
FT                   /db_xref="GOA:P9WMV2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGG0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMV2"
FT                   /protein_id="AAK44345.1"
FT   gene            138504..139664
FT                   /locus_tag="MT0123"
FT   CDS_pept        138504..139664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0123"
FT                   /product="lmbP protein, putative"
FT                   /note="identified by similarity to EGAD:49321; match to
FT                   protein family HMM PF00288"
FT                   /db_xref="EnsemblGenomes-Gn:MT0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44346"
FT                   /db_xref="GOA:L7N4E0"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4E0"
FT                   /protein_id="AAK44346.1"
FT   gene            139947..140135
FT                   /locus_tag="MT0124"
FT   CDS_pept        139947..140135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44347"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR4"
FT                   /protein_id="AAK44347.1"
FT                   ERADRYVARMPIAVIAD"
FT   gene            complement(140258..140890)
FT                   /locus_tag="MT0125"
FT   CDS_pept        complement(140258..140890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4539222; match to
FT                   protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:MT0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44348"
FT                   /db_xref="GOA:Q7DAG3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7DAG3"
FT                   /protein_id="AAK44348.1"
FT   gene            141185..142135
FT                   /locus_tag="MT0125.1"
FT   CDS_pept        141185..142135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0125.1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by similarity to GP:4200252; similarity
FT                   to EGAD:137604; match to protein family HMM PF00126; match
FT                   to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:MT0125.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44349"
FT                   /db_xref="GOA:Q8VKR3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR3"
FT                   /protein_id="AAK44349.1"
FT   gene            complement(142119..143867)
FT                   /gene="oxc"
FT                   /locus_tag="MT0126"
FT   CDS_pept        complement(142119..143867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxc"
FT                   /locus_tag="MT0126"
FT                   /product="oxalyl-CoA decarboxylase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:21204; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02775; match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:MT0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44350"
FT                   /db_xref="GOA:L7N5Z3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5Z3"
FT                   /protein_id="AAK44350.1"
FT                   AISGDG"
FT   gene            143989..145617
FT                   /locus_tag="MT0127"
FT   CDS_pept        143989..145617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0127"
FT                   /product="coenzyme A synthetase, putative"
FT                   /note="identified by similarity to EGAD:50975; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44351"
FT                   /db_xref="GOA:Q7DAG1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAG1"
FT                   /protein_id="AAK44351.1"
FT   gene            complement(145618..147762)
FT                   /gene="fusA-1"
FT                   /locus_tag="MT0128"
FT   CDS_pept        complement(145618..147762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA-1"
FT                   /locus_tag="MT0128"
FT                   /product="translation elongation factor G"
FT                   /note="identified by similarity to EGAD:98539; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF00679; match to protein family HMM PF03144; match to
FT                   protein family HMM PF03764; match to protein family HMM
FT                   TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:MT0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44352"
FT                   /db_xref="GOA:P9WNM8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNM8"
FT                   /protein_id="AAK44352.1"
FT   gene            complement(147899..148333)
FT                   /locus_tag="MT0129"
FT   CDS_pept        complement(147899..148333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0129"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44353"
FT                   /db_xref="GOA:Q7DAG0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019967"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAG0"
FT                   /protein_id="AAK44353.1"
FT   gene            complement(148443..148862)
FT                   /locus_tag="MT0130"
FT   CDS_pept        complement(148443..148862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0130"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44354"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR2"
FT                   /protein_id="AAK44354.1"
FT   gene            148847..149215
FT                   /locus_tag="MT0131"
FT   CDS_pept        148847..149215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0131"
FT                   /product="DNA-binding protein, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:MT0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44355"
FT                   /db_xref="GOA:L7N5Q9"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5Q9"
FT                   /protein_id="AAK44355.1"
FT                   PVLDEFVQRETGRILPRR"
FT   gene            149482..151167
FT                   /locus_tag="MT0132"
FT   CDS_pept        149482..151167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0132"
FT                   /product="PE_PGRS family protein"
FT                   /note="identified by similarity to EGAD:160782; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44356"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR1"
FT                   /protein_id="AAK44356.1"
FT   gene            151319..152386
FT                   /locus_tag="MT0133"
FT   CDS_pept        151319..152386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0133"
FT                   /product="serine protease, putative"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:MT0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44357"
FT                   /db_xref="GOA:L7N4F0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4F0"
FT                   /protein_id="AAK44357.1"
FT                   GTRTGNVTLAEGPPA"
FT   gene            152495..154300
FT                   /locus_tag="MT0134"
FT   CDS_pept        152495..154300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0134"
FT                   /product="alpha-amylase family protein"
FT                   /note="identified by similarity to GP:2808807; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:MT0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44358"
FT                   /db_xref="GOA:P9WQ18"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ18"
FT                   /protein_id="AAK44358.1"
FT   gene            154403..155770
FT                   /gene="pep2"
FT                   /locus_tag="MT0135"
FT   CDS_pept        154403..155770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pep2"
FT                   /locus_tag="MT0135"
FT                   /product="pep2 protein"
FT                   /note="identified by similarity to GP:2808801"
FT                   /db_xref="EnsemblGenomes-Gn:MT0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44359"
FT                   /db_xref="GOA:Q7DAF6"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7DAF6"
FT                   /protein_id="AAK44359.1"
FT   gene            155838..156617
FT                   /locus_tag="MT0136"
FT   CDS_pept        155838..156617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44360"
FT                   /db_xref="GOA:L7N4E6"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4E6"
FT                   /protein_id="AAK44360.1"
FT   gene            complement(156749..157789)
FT                   /gene="fbpC"
FT                   /locus_tag="MT0137"
FT   CDS_pept        complement(156749..157789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="MT0137"
FT                   /product="esterase, putative, antigen 85-C"
FT                   /note="identified by similarity to EGAD:10287; match to
FT                   protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:MT0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44361"
FT                   /db_xref="GOA:P9WQN8"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQN8"
FT                   /protein_id="AAK44361.1"
FT                   PAAPAA"
FT   gene            158018..158473
FT                   /locus_tag="MT0138"
FT   CDS_pept        158018..158473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0138"
FT                   /product="nodulation protein N-related protein"
FT                   /note="identified by similarity to EGAD:6779; match to
FT                   protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:MT0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44362"
FT                   /db_xref="GOA:P9WNP2"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNP2"
FT                   /protein_id="AAK44362.1"
FT   gene            complement(158486..159829)
FT                   /locus_tag="MT0139"
FT   CDS_pept        complement(158486..159829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0139"
FT                   /product="acyl-CoA dehydrogenase, putative"
FT                   /note="identified by similarity to GP:5441764; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:MT0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44363"
FT                   /db_xref="GOA:L7N5Y8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5Y8"
FT                   /protein_id="AAK44363.1"
FT   gene            complement(159871..160953)
FT                   /locus_tag="MT0140"
FT   CDS_pept        complement(159871..160953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0140"
FT                   /product="glucose-6-phosphate dehydrogenase,
FT                   F420-dependent, putative"
FT                   /note="identified by similarity to GP:5031437; match to
FT                   protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MT0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44364"
FT                   /db_xref="GOA:Q7DAF2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR031017"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAF2"
FT                   /protein_id="AAK44364.1"
FT   gene            161040..161645
FT                   /locus_tag="MT0141"
FT   CDS_pept        161040..161645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0141"
FT                   /product="puromycin N-acetyltransferase, putative"
FT                   /note="identified by similarity to EGAD:39767; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MT0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44365"
FT                   /db_xref="GOA:L7N608"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:L7N608"
FT                   /protein_id="AAK44365.1"
FT   gene            161942..162844
FT                   /locus_tag="MT0142"
FT   CDS_pept        161942..162844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0142"
FT                   /product="epoxide hydrolase"
FT                   /note="identified by similarity to EGAD:129212; match to
FT                   protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MT0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44366"
FT                   /db_xref="GOA:L7N5E1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5E1"
FT                   /protein_id="AAK44366.1"
FT   gene            complement(162815..163420)
FT                   /locus_tag="MT0143"
FT   CDS_pept        complement(162815..163420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0143"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:5689972; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44367"
FT                   /db_xref="GOA:L7N632"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:L7N632"
FT                   /protein_id="AAK44367.1"
FT   gene            163537..164862
FT                   /locus_tag="MT0144"
FT   CDS_pept        163537..164862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0144"
FT                   /product="P450 heme-thiolate protein"
FT                   /note="identified by similarity to EGAD:40195; match to
FT                   protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:MT0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44368"
FT                   /db_xref="GOA:P9WPM2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPM2"
FT                   /protein_id="AAK44368.1"
FT   gene            complement(164883..165431)
FT                   /gene="msrA"
FT                   /locus_tag="MT0145"
FT   CDS_pept        complement(164883..165431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="MT0145"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:21089; match to
FT                   protein family HMM PF01625; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:MT0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44369"
FT                   /db_xref="GOA:P9WJM4"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJM4"
FT                   /protein_id="AAK44369.1"
FT   gene            165494..165997
FT                   /locus_tag="MT0146"
FT   CDS_pept        165494..165997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44370"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5M4"
FT                   /protein_id="AAK44370.1"
FT                   HGGP"
FT   gene            165998..167020
FT                   /locus_tag="MT0147"
FT   CDS_pept        165998..167020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0147"
FT                   /product="dihydroflavonol 4-reductase-related protein"
FT                   /note="identified by similarity to EGAD:49933"
FT                   /db_xref="EnsemblGenomes-Gn:MT0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44371"
FT                   /db_xref="GOA:L7N5K2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5K2"
FT                   /protein_id="AAK44371.1"
FT                   "
FT   gene            167081..167461
FT                   /locus_tag="MT0148"
FT   CDS_pept        167081..167461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44372"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4Y6"
FT                   /protein_id="AAK44372.1"
FT   gene            complement(167442..167852)
FT                   /locus_tag="MT0149"
FT   CDS_pept        complement(167442..167852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0149"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44373"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4G6"
FT                   /protein_id="AAK44373.1"
FT   gene            167882..168808
FT                   /locus_tag="MT0150"
FT   CDS_pept        167882..168808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44374"
FT                   /db_xref="GOA:L7N508"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:L7N508"
FT                   /protein_id="AAK44374.1"
FT   gene            complement(168875..170353)
FT                   /locus_tag="MT0151"
FT   CDS_pept        complement(168875..170353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0151"
FT                   /product="chloride channel"
FT                   /note="identified by similarity to EGAD:105376; match to
FT                   protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:MT0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44375"
FT                   /db_xref="GOA:Q7DAE3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAE3"
FT                   /protein_id="AAK44375.1"
FT   gene            170455..171297
FT                   /locus_tag="MT0152"
FT   CDS_pept        170455..171297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0152"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to EGAD:37513; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44376"
FT                   /db_xref="GOA:L7N5S4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5S4"
FT                   /protein_id="AAK44376.1"
FT   gene            171386..172339
FT                   /locus_tag="MT0153"
FT   CDS_pept        171386..172339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4158189; match to
FT                   protein family HMM PF02409; match to protein family HMM
FT                   TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MT0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44377"
FT                   /db_xref="GOA:P9WFJ0"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFJ0"
FT                   /protein_id="AAK44377.1"
FT   gene            172373..173314
FT                   /locus_tag="MT0154"
FT   CDS_pept        172373..173314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4158189; match to
FT                   protein family HMM PF02409; match to protein family HMM
FT                   TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MT0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44378"
FT                   /db_xref="GOA:P9WFJ2"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFJ2"
FT                   /protein_id="AAK44378.1"
FT   gene            173454..174929
FT                   /locus_tag="MT0155"
FT   CDS_pept        173454..174929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0155"
FT                   /product="aldehyde dehydrogenase, class 3"
FT                   /note="identified by similarity to EGAD:63178; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MT0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44379"
FT                   /db_xref="GOA:Q7DAD9"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAD9"
FT                   /protein_id="AAK44379.1"
FT   gene            174983..175864
FT                   /locus_tag="MT0156"
FT   CDS_pept        174983..175864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0156"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by similarity to EGAD:144568; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MT0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44380"
FT                   /db_xref="GOA:Q7DAD8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAD8"
FT                   /protein_id="AAK44380.1"
FT                   DLSGAKIAGFKL"
FT   gene            175871..176839
FT                   /locus_tag="MT0157"
FT   CDS_pept        175871..176839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0157"
FT                   /product="quinone oxidoreductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:140039; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MT0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44381"
FT                   /db_xref="GOA:L7N539"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:L7N539"
FT                   /protein_id="AAK44381.1"
FT   gene            complement(176836..177123)
FT                   /locus_tag="MT0158"
FT   CDS_pept        complement(176836..177123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44382"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5X9"
FT                   /protein_id="AAK44382.1"
FT   gene            177559..177684
FT                   /locus_tag="MT0159"
FT   CDS_pept        177559..177684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0159"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44383"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKR0"
FT                   /protein_id="AAK44383.1"
FT   gene            complement(177714..179480)
FT                   /locus_tag="MT0160"
FT   CDS_pept        complement(177714..179480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0160"
FT                   /product="PE family protein"
FT                   /note="identified by similarity to EGAD:161906; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44384"
FT                   /db_xref="GOA:Q8VKQ9"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ9"
FT                   /protein_id="AAK44384.1"
FT                   ADITQQLQSFSI"
FT   gene            complement(179490..181091)
FT                   /locus_tag="MT0161"
FT   CDS_pept        complement(179490..181091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0161"
FT                   /product="PE family protein"
FT                   /note="identified by similarity to EGAD:161930"
FT                   /db_xref="EnsemblGenomes-Gn:MT0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44385"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAD5"
FT                   /protein_id="AAK44385.1"
FT                   SRRHRRPPTTVYRPRQ"
FT   gene            complement(181326..182156)
FT                   /locus_tag="MT0162"
FT   CDS_pept        complement(181326..182156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4539176"
FT                   /db_xref="EnsemblGenomes-Gn:MT0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44386"
FT                   /db_xref="GOA:P96830"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="PDB:1YWF"
FT                   /db_xref="PDB:2OZ5"
FT                   /db_xref="UniProtKB/TrEMBL:P96830"
FT                   /protein_id="AAK44386.1"
FT   gene            complement(182158..183381)
FT                   /locus_tag="MT0163"
FT   CDS_pept        complement(182158..183381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0163"
FT                   /product="acyl-CoA dehydrogenase, putative"
FT                   /note="identified by similarity to GP:5441764; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:MT0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44387"
FT                   /db_xref="GOA:Q7DAD3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAD3"
FT                   /protein_id="AAK44387.1"
FT                   STFAAAVT"
FT   gene            183793..185223
FT                   /pseudo
FT                   /locus_tag="MT0164"
FT                   /note="NAD(P) transhydrogenase, alpha subunit, authentic
FT                   point mutation; this gene contains a premature stop which
FT                   is not the result of sequencing error;identified by
FT                   similarity to EGAD:9297"
FT   gene            185220..186647
FT                   /gene="pntB"
FT                   /locus_tag="MT0165"
FT   CDS_pept        185220..186647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="MT0165"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:22113; match to
FT                   protein family HMM PF02233"
FT                   /db_xref="EnsemblGenomes-Gn:MT0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44388"
FT                   /db_xref="GOA:L7N505"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:L7N505"
FT                   /protein_id="AAK44388.1"
FT                   GDAKKSVTEVSEELKAL"
FT   gene            186953..187597
FT                   /locus_tag="MT0167"
FT   CDS_pept        186953..187597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:5441765; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44389"
FT                   /db_xref="GOA:L7N4U0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4U0"
FT                   /protein_id="AAK44389.1"
FT   gene            complement(187601..189007)
FT                   /locus_tag="MT0168"
FT   CDS_pept        complement(187601..189007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0168"
FT                   /product="PE family protein"
FT                   /note="identified by similarity to EGAD:162096; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44390"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAD0"
FT                   /protein_id="AAK44390.1"
FT                   SVARLIPPIA"
FT   gene            complement(189099..190607)
FT                   /locus_tag="MT0169"
FT   CDS_pept        complement(189099..190607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0169"
FT                   /product="PE family protein"
FT                   /note="identified by similarity to EGAD:162344; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44391"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAC9"
FT                   /protein_id="AAK44391.1"
FT   gene            190775..192125
FT                   /pseudo
FT                   /locus_tag="MT0170"
FT                   /note="oxidoreductase, putative, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error;identified by similarity to GP:2104618"
FT   gene            complement(192153..193304)
FT                   /locus_tag="MT0171"
FT   CDS_pept        complement(192153..193304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0171"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MT0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44392"
FT                   /db_xref="GOA:Q7DAC8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAC8"
FT                   /protein_id="AAK44392.1"
FT   gene            193286..193741
FT                   /locus_tag="MT0172"
FT   CDS_pept        193286..193741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:36339; match to
FT                   protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:MT0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44393"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAC7"
FT                   /protein_id="AAK44393.1"
FT   gene            193795..194280
FT                   /locus_tag="MT0173"
FT   CDS_pept        193795..194280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104615"
FT                   /db_xref="EnsemblGenomes-Gn:MT0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44394"
FT                   /db_xref="GOA:Q8VKQ8"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ8"
FT                   /protein_id="AAK44394.1"
FT   gene            complement(194313..194984)
FT                   /pseudo
FT                   /locus_tag="MT0174"
FT                   /note="transcriptional regulator, putative; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error;identified by similarity to EGAD:30307;
FT                   match to protein family HMM PF00392"
FT   gene            195270..196826
FT                   /locus_tag="MT0175"
FT   CDS_pept        195270..196826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0175"
FT                   /product="substrate--CoA ligase"
FT                   /note="identified by similarity to GP:5881868; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44395"
FT                   /db_xref="GOA:Q7DAC6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAC6"
FT                   /protein_id="AAK44395.1"
FT                   L"
FT   gene            197030..197827
FT                   /locus_tag="MT0176"
FT   CDS_pept        197030..197827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:49445; match to
FT                   protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MT0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44396"
FT                   /db_xref="GOA:L7N5B8"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5B8"
FT                   /protein_id="AAK44396.1"
FT   gene            complement(197778..198455)
FT                   /locus_tag="MT0177"
FT   CDS_pept        complement(197778..198455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ7"
FT                   /protein_id="AAK44397.1"
FT                   RSR"
FT   gene            198484..200067
FT                   /gene="mce-1"
FT                   /locus_tag="MT0178"
FT   CDS_pept        198484..200067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce-1"
FT                   /locus_tag="MT0178"
FT                   /product="virulence factor"
FT                   /note="identified by similarity to GP:5814111; match to
FT                   protein family HMM PF02470; match to protein family HMM
FT                   TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44398"
FT                   /db_xref="GOA:Q8VKQ6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ6"
FT                   /protein_id="AAK44398.1"
FT                   RQVGDNTINP"
FT   gene            200064..201104
FT                   /locus_tag="MT0179"
FT   CDS_pept        200064..201104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0179"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44399"
FT                   /db_xref="GOA:L7N4C4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4C4"
FT                   /protein_id="AAK44399.1"
FT                   GRCTPQ"
FT   gene            201128..202648
FT                   /locus_tag="MT0180"
FT   CDS_pept        201128..202648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0180"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44400"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ5"
FT                   /protein_id="AAK44400.1"
FT   gene            202645..204237
FT                   /locus_tag="MT0181"
FT   CDS_pept        202645..204237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0181"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44401"
FT                   /db_xref="GOA:L7N5G3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5G3"
FT                   /protein_id="AAK44401.1"
FT                   VGAPLPAEAGGGQ"
FT   gene            204237..205406
FT                   /locus_tag="MT0182"
FT   CDS_pept        204237..205406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0182"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44402"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAC2"
FT                   /protein_id="AAK44402.1"
FT   gene            205400..206947
FT                   /locus_tag="MT0183"
FT   CDS_pept        205400..206947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0183"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44403"
FT                   /db_xref="GOA:Q8VKQ4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ4"
FT                   /protein_id="AAK44403.1"
FT   gene            206983..207567
FT                   /locus_tag="MT0184"
FT   CDS_pept        206983..207567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44404"
FT                   /db_xref="GOA:Q8VKQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ3"
FT                   /protein_id="AAK44404.1"
FT   gene            207570..208532
FT                   /locus_tag="MT0185"
FT   CDS_pept        207570..208532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44405"
FT                   /db_xref="GOA:Q7DAC1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAC1"
FT                   /protein_id="AAK44405.1"
FT   gene            208529..209083
FT                   /locus_tag="MT0186"
FT   CDS_pept        208529..209083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44406"
FT                   /db_xref="GOA:L7N5H6"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5H6"
FT                   /protein_id="AAK44406.1"
FT   gene            209050..209784
FT                   /locus_tag="MT0187"
FT   CDS_pept        209050..209784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0187"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44407"
FT                   /db_xref="GOA:L7N5B1"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5B1"
FT                   /protein_id="AAK44407.1"
FT   gene            complement(209815..210924)
FT                   /locus_tag="MT0188"
FT   CDS_pept        complement(209815..210924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44408"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4T3"
FT                   /protein_id="AAK44408.1"
FT   gene            complement(211004..212362)
FT                   /locus_tag="MT0189"
FT   CDS_pept        complement(211004..212362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44409"
FT                   /db_xref="GOA:L7N5G4"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5G4"
FT                   /protein_id="AAK44409.1"
FT   gene            complement(212389..213123)
FT                   /locus_tag="MT0190"
FT   CDS_pept        complement(212389..213123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:48572; match to
FT                   protein family HMM PF02678"
FT                   /db_xref="EnsemblGenomes-Gn:MT0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44410"
FT                   /db_xref="GOA:P9WI84"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI84"
FT                   /protein_id="AAK44410.1"
FT   gene            complement(213140..214252)
FT                   /gene="sigG"
FT                   /locus_tag="MT0191"
FT   CDS_pept        complement(213140..214252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigG"
FT                   /locus_tag="MT0191"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by similarity to GP:5748621; match to
FT                   protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:MT0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44411"
FT                   /db_xref="GOA:P9WGG4"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGG4"
FT                   /protein_id="AAK44411.1"
FT   gene            214068..215039
FT                   /locus_tag="MT0192"
FT   CDS_pept        214068..215039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0192"
FT                   /product="lysophospholipase, putative"
FT                   /note="identified by similarity to EGAD:88655; match to
FT                   protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MT0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44412"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAB5"
FT                   /protein_id="AAK44412.1"
FT   gene            215081..215830
FT                   /locus_tag="MT0193"
FT   CDS_pept        215081..215830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104589"
FT                   /db_xref="EnsemblGenomes-Gn:MT0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44413"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:L7N562"
FT                   /protein_id="AAK44413.1"
FT   gene            215827..216336
FT                   /locus_tag="MT0194"
FT   CDS_pept        215827..216336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104590"
FT                   /db_xref="EnsemblGenomes-Gn:MT0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44414"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5B5"
FT                   /protein_id="AAK44414.1"
FT                   AQEGVR"
FT   gene            216381..218456
FT                   /locus_tag="MT0195"
FT   CDS_pept        216381..218456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0195"
FT                   /product="beta-glucosidase, putative"
FT                   /note="identified by similarity to EGAD:124978; match to
FT                   protein family HMM PF00933; match to protein family HMM
FT                   PF01915"
FT                   /db_xref="EnsemblGenomes-Gn:MT0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44415"
FT                   /db_xref="GOA:L7N5K3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5K3"
FT                   /protein_id="AAK44415.1"
FT   gene            complement(218502..218663)
FT                   /locus_tag="MT0196"
FT   CDS_pept        complement(218502..218663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0196"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44416"
FT                   /db_xref="GOA:P9WK08"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WK08"
FT                   /protein_id="AAK44416.1"
FT                   GDELAPVK"
FT   gene            218823..219479
FT                   /locus_tag="MT0197"
FT   CDS_pept        218823..219479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0197"
FT                   /product="O-methyltransferase"
FT                   /note="identified by similarity to EGAD:41133; match to
FT                   protein family HMM PF01596"
FT                   /db_xref="EnsemblGenomes-Gn:MT0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44417"
FT                   /db_xref="GOA:Q7DAB1"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAB1"
FT                   /protein_id="AAK44417.1"
FT   gene            219598..220029
FT                   /locus_tag="MT0198"
FT   CDS_pept        219598..220029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4835334; match to
FT                   protein family HMM PF03779"
FT                   /db_xref="EnsemblGenomes-Gn:MT0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44418"
FT                   /db_xref="GOA:L7N4G2"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4G2"
FT                   /protein_id="AAK44418.1"
FT   gene            complement(220108..221835)
FT                   /gene="ilvD"
FT                   /locus_tag="MT0199"
FT   CDS_pept        complement(220108..221835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="MT0199"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:149464; match to
FT                   protein family HMM PF00920; match to protein family HMM
FT                   TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:MT0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44419"
FT                   /db_xref="GOA:P9WKJ4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKJ4"
FT                   /protein_id="AAK44419.1"
FT   gene            221983..222273
FT                   /locus_tag="MT0200"
FT   CDS_pept        221983..222273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:109047; match to
FT                   protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:MT0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44420"
FT                   /db_xref="GOA:L7N5P9"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5P9"
FT                   /protein_id="AAK44420.1"
FT   gene            222401..223642
FT                   /locus_tag="MT0201"
FT   CDS_pept        222401..223642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0201"
FT                   /product="sugar transporter family protein"
FT                   /note="identified by similarity to EGAD:5517; match to
FT                   protein family HMM PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:MT0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44421"
FT                   /db_xref="GOA:P9WJX6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJX6"
FT                   /protein_id="AAK44421.1"
FT                   QHLFENPTLSPGDG"
FT   gene            223676..224776
FT                   /locus_tag="MT0202"
FT   CDS_pept        223676..224776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:132223; match to
FT                   protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:MT0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44422"
FT                   /db_xref="GOA:Q8VKQ1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ1"
FT                   /protein_id="AAK44422.1"
FT   gene            complement(224836..226662)
FT                   /locus_tag="MT0203"
FT   CDS_pept        complement(224836..226662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44423"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKQ0"
FT                   /protein_id="AAK44423.1"
FT   gene            226849..230574
FT                   /locus_tag="MT0204"
FT   CDS_pept        226849..230574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0204"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by similarity to EGAD:125285; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:MT0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44424"
FT                   /db_xref="GOA:Q8VKP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP9"
FT                   /protein_id="AAK44424.1"
FT                   TRLCSPEITQLQCIDA"
FT   gene            230593..230742
FT                   /locus_tag="MT0204.1"
FT   CDS_pept        230593..230742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0204.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0204.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP8"
FT                   /protein_id="AAK44425.1"
FT                   PADN"
FT   gene            230876..231646
FT                   /locus_tag="MT0205"
FT   CDS_pept        230876..231646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0205"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by similarity to GP:4007689; match to
FT                   protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:MT0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44426"
FT                   /db_xref="GOA:Q7DAA7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAA7"
FT                   /protein_id="AAK44426.1"
FT   gene            231759..232343
FT                   /locus_tag="MT0206"
FT   CDS_pept        231759..232343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0206"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by similarity to EGAD:30693; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44427"
FT                   /db_xref="GOA:P9WME0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WME0"
FT                   /protein_id="AAK44427.1"
FT   gene            232340..234589
FT                   /locus_tag="MT0207"
FT   CDS_pept        232340..234589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0207"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="identified by similarity to EGAD:21062; match to
FT                   protein family HMM PF00384; match to protein family HMM
FT                   PF01568; match to protein family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:MT0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44428"
FT                   /db_xref="GOA:Q8VKP7"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP7"
FT                   /protein_id="AAK44428.1"
FT   gene            complement(234630..236621)
FT                   /locus_tag="MT0208"
FT   CDS_pept        complement(234630..236621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0208"
FT                   /product="endopeptidase, peptidase family M13"
FT                   /note="identified by similarity to GP:2104600; match to
FT                   protein family HMM PF01431; match to protein family HMM
FT                   PF05649"
FT                   /db_xref="EnsemblGenomes-Gn:MT0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44429"
FT                   /db_xref="GOA:O53649"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="PDB:3ZUK"
FT                   /db_xref="UniProtKB/TrEMBL:O53649"
FT                   /protein_id="AAK44429.1"
FT   gene            236775..237323
FT                   /locus_tag="MT0209"
FT   CDS_pept        236775..237323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104601"
FT                   /db_xref="EnsemblGenomes-Gn:MT0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44430"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAA4"
FT                   /protein_id="AAK44430.1"
FT   gene            237320..238009
FT                   /locus_tag="MT0210"
FT   CDS_pept        237320..238009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104602"
FT                   /db_xref="EnsemblGenomes-Gn:MT0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44431"
FT                   /db_xref="GOA:L7N5T8"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5T8"
FT                   /protein_id="AAK44431.1"
FT                   VTPINAR"
FT   gene            complement(238006..238503)
FT                   /locus_tag="MT0211"
FT   CDS_pept        complement(238006..238503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104603"
FT                   /db_xref="EnsemblGenomes-Gn:MT0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44432"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAA2"
FT                   /protein_id="AAK44432.1"
FT                   DS"
FT   gene            complement(238506..241406)
FT                   /locus_tag="MT0212"
FT   CDS_pept        complement(238506..241406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0212"
FT                   /product="membrane protein MmpL11"
FT                   /note="identified by similarity to GP:2104604"
FT                   /db_xref="EnsemblGenomes-Gn:MT0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44433"
FT                   /db_xref="GOA:P9WJT8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJT8"
FT                   /protein_id="AAK44433.1"
FT   gene            241628..242038
FT                   /locus_tag="MT0213"
FT   CDS_pept        241628..242038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0213"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44434"
FT                   /db_xref="GOA:O53654"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="PDB:3MAY"
FT                   /db_xref="UniProtKB/TrEMBL:O53654"
FT                   /protein_id="AAK44434.1"
FT   gene            complement(242090..243328)
FT                   /locus_tag="MT0214"
FT   CDS_pept        complement(242090..243328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104605; match to
FT                   protein family HMM PF03706; match to protein family HMM
FT                   TIGR00374"
FT                   /db_xref="EnsemblGenomes-Gn:MT0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44435"
FT                   /db_xref="GOA:Q7DAA0"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAA0"
FT                   /protein_id="AAK44435.1"
FT                   PDLRPEGGETPPR"
FT   gene            243498..244601
FT                   /locus_tag="MT0215"
FT   CDS_pept        243498..244601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2687332; match to
FT                   protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:MT0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44436"
FT                   /db_xref="GOA:P9WFM4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFM4"
FT                   /protein_id="AAK44436.1"
FT   gene            complement(244598..247432)
FT                   /locus_tag="MT0216"
FT   CDS_pept        complement(244598..247432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0216"
FT                   /product="membrane protein, MmpL family"
FT                   /note="identified by similarity to GP:2104606; match to
FT                   protein family HMM PF03176"
FT                   /db_xref="EnsemblGenomes-Gn:MT0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44437"
FT                   /db_xref="GOA:P9WJV4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJV4"
FT                   /protein_id="AAK44437.1"
FT                   ALSAQDLLRREGRL"
FT   gene            complement(247498..248232)
FT                   /locus_tag="MT0217"
FT   CDS_pept        complement(247498..248232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104607"
FT                   /db_xref="EnsemblGenomes-Gn:MT0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44438"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA99"
FT                   /protein_id="AAK44438.1"
FT   gene            complement(248229..249020)
FT                   /locus_tag="MT0218"
FT   CDS_pept        complement(248229..249020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:7643; match to
FT                   protein family HMM PF02390; match to protein family HMM
FT                   TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:MT0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44439"
FT                   /db_xref="GOA:P9WFY8"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFY8"
FT                   /protein_id="AAK44439.1"
FT   gene            249152..250237
FT                   /locus_tag="MT0219"
FT   CDS_pept        249152..250237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44440"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4J4"
FT                   /protein_id="AAK44440.1"
FT   gene            250267..251712
FT                   /locus_tag="MT0220"
FT   CDS_pept        250267..251712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0220"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44441"
FT                   /db_xref="GOA:Q8VKP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP6"
FT                   /protein_id="AAK44441.1"
FT   gene            251896..253716
FT                   /gene="pckA"
FT                   /locus_tag="MT0221"
FT   CDS_pept        251896..253716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="MT0221"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:151802; match to
FT                   protein family HMM PF00821"
FT                   /db_xref="EnsemblGenomes-Gn:MT0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44442"
FT                   /db_xref="GOA:P9WIH2"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIH2"
FT                   /protein_id="AAK44442.1"
FT   gene            complement(253783..254754)
FT                   /locus_tag="MT0222"
FT   CDS_pept        complement(253783..254754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0222"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by similarity to EGAD:20305; match to
FT                   protein family HMM TIGR00125; match to protein family HMM
FT                   TIGR01526"
FT                   /db_xref="EnsemblGenomes-Gn:MT0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44443"
FT                   /db_xref="GOA:Q7DA97"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="InterPro:IPR041749"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA97"
FT                   /protein_id="AAK44443.1"
FT   gene            complement(254751..256064)
FT                   /locus_tag="MT0223"
FT   CDS_pept        complement(254751..256064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0223"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by similarity to EGAD:107221; match to
FT                   protein family HMM PF02310; match to protein family HMM
FT                   PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:MT0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44444"
FT                   /db_xref="GOA:L7N4V3"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4V3"
FT                   /protein_id="AAK44444.1"
FT   gene            256178..257791
FT                   /locus_tag="MT0224"
FT   CDS_pept        256178..257791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0224"
FT                   /product="substrate--CoA ligase, putative"
FT                   /note="identified by similarity to GP:4455741; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44445"
FT                   /db_xref="GOA:L7N5T5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5T5"
FT                   /protein_id="AAK44445.1"
FT   gene            complement(257897..259018)
FT                   /locus_tag="MT0225"
FT   CDS_pept        complement(257897..259018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0225"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by similarity to EGAD:29975; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771"
FT                   /db_xref="EnsemblGenomes-Gn:MT0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44446"
FT                   /db_xref="GOA:Q7DA94"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA94"
FT                   /protein_id="AAK44446.1"
FT   gene            259027..260040
FT                   /locus_tag="MT0226"
FT   CDS_pept        259027..260040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104610"
FT                   /db_xref="EnsemblGenomes-Gn:MT0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44447"
FT                   /db_xref="GOA:P96398"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="PDB:2BI0"
FT                   /db_xref="UniProtKB/TrEMBL:P96398"
FT                   /protein_id="AAK44447.1"
FT   gene            complement(260037..260858)
FT                   /locus_tag="MT0227"
FT   CDS_pept        complement(260037..260858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0227"
FT                   /product="esterase/lipase, putative"
FT                   /note="identified by similarity to EGAD:131294"
FT                   /db_xref="EnsemblGenomes-Gn:MT0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44448"
FT                   /db_xref="GOA:Q7DA92"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA92"
FT                   /protein_id="AAK44448.1"
FT   gene            261038..262366
FT                   /locus_tag="MT0228"
FT   CDS_pept        261038..262366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44449"
FT                   /db_xref="GOA:Q7DA91"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA91"
FT                   /protein_id="AAK44449.1"
FT   gene            262368..262916
FT                   /locus_tag="MT0229"
FT   CDS_pept        262368..262916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44450"
FT                   /db_xref="GOA:L7N4A1"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4A1"
FT                   /protein_id="AAK44450.1"
FT   gene            262926..264137
FT                   /locus_tag="MT0230"
FT   CDS_pept        262926..264137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0230"
FT                   /product="esterase, putative"
FT                   /note="identified by similarity to GP:5106360"
FT                   /db_xref="EnsemblGenomes-Gn:MT0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44451"
FT                   /db_xref="GOA:L7N4U2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4U2"
FT                   /protein_id="AAK44451.1"
FT                   KEVI"
FT   gene            264241..265590
FT                   /locus_tag="MT0231"
FT   CDS_pept        264241..265590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44452"
FT                   /db_xref="GOA:P9WKB6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKB6"
FT                   /protein_id="AAK44452.1"
FT   gene            265621..266409
FT                   /locus_tag="MT0232"
FT   CDS_pept        265621..266409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0232"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by similarity to GP:3885480; match to
FT                   protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MT0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44453"
FT                   /db_xref="GOA:L7N5S5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5S5"
FT                   /protein_id="AAK44453.1"
FT   gene            complement(266415..267878)
FT                   /locus_tag="MT0233"
FT   CDS_pept        complement(266415..267878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0233"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by similarity to EGAD:137626; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MT0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44454"
FT                   /db_xref="GOA:P96405"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="PDB:3B4W"
FT                   /db_xref="UniProtKB/TrEMBL:P96405"
FT                   /protein_id="AAK44454.1"
FT   gene            complement(267977..268741)
FT                   /locus_tag="MT0234"
FT   CDS_pept        complement(267977..268741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3063871"
FT                   /db_xref="EnsemblGenomes-Gn:MT0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44455"
FT                   /db_xref="GOA:P9WJZ8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJZ8"
FT                   /protein_id="AAK44455.1"
FT   gene            268777..269931
FT                   /locus_tag="MT0235"
FT   CDS_pept        268777..269931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0235"
FT                   /product="glycosyl transferase"
FT                   /note="identified by similarity to GP:3063872; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MT0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44456"
FT                   /db_xref="GOA:L7N515"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:L7N515"
FT                   /protein_id="AAK44456.1"
FT   gene            complement(269948..271678)
FT                   /locus_tag="MT0236"
FT   CDS_pept        complement(269948..271678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3063873"
FT                   /db_xref="EnsemblGenomes-Gn:MT0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44457"
FT                   /db_xref="GOA:L7N5S8"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5S8"
FT                   /protein_id="AAK44457.1"
FT                   "
FT   gene            complement(271688..272953)
FT                   /locus_tag="MT0237"
FT   CDS_pept        complement(271688..272953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0237"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44458"
FT                   /db_xref="GOA:L7N4X8"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4X8"
FT                   /protein_id="AAK44458.1"
FT   gene            273253..274392
FT                   /locus_tag="MT0238"
FT   CDS_pept        273253..274392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0238"
FT                   /product="acyltransferase"
FT                   /note="identified by similarity to EGAD:8956; match to
FT                   protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:MT0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44459"
FT                   /db_xref="GOA:Q7DA82"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA82"
FT                   /protein_id="AAK44459.1"
FT   gene            complement(274420..275100)
FT                   /locus_tag="MT0239"
FT   CDS_pept        complement(274420..275100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0239"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44460"
FT                   /db_xref="GOA:L7N5I6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5I6"
FT                   /protein_id="AAK44460.1"
FT                   GTID"
FT   gene            complement(275097..276134)
FT                   /gene="opd"
FT                   /locus_tag="MT0240"
FT   CDS_pept        complement(275097..276134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opd"
FT                   /locus_tag="MT0240"
FT                   /product="parathion hydrolase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:9198; match to
FT                   protein family HMM PF02126"
FT                   /db_xref="EnsemblGenomes-Gn:MT0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44461"
FT                   /db_xref="GOA:P9WHN8"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHN8"
FT                   /protein_id="AAK44461.1"
FT                   QGGYQ"
FT   gene            276172..277878
FT                   /locus_tag="MT0241"
FT   CDS_pept        276172..277878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0241"
FT                   /product="acyl-CoA dehydrogenase, putative"
FT                   /note="identified by similarity to EGAD:103876; match to
FT                   protein family HMM PF00441"
FT                   /db_xref="EnsemblGenomes-Gn:MT0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44462"
FT                   /db_xref="GOA:L7N634"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:L7N634"
FT                   /protein_id="AAK44462.1"
FT   gene            278013..278702
FT                   /locus_tag="MT0242"
FT   CDS_pept        278013..278702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0242"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to EGAD:5730; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44463"
FT                   /db_xref="GOA:L7N4D1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4D1"
FT                   /protein_id="AAK44463.1"
FT                   TRSEEIT"
FT   gene            278699..279643
FT                   /locus_tag="MT0244"
FT   CDS_pept        278699..279643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0244"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit, putative"
FT                   /note="identified by similarity to EGAD:141276"
FT                   /db_xref="EnsemblGenomes-Gn:MT0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44464"
FT                   /db_xref="GOA:P9WH68"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033908"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH68"
FT                   /protein_id="AAK44464.1"
FT   gene            complement(279719..281122)
FT                   /gene="gabD-1"
FT                   /locus_tag="MT0245"
FT   CDS_pept        complement(279719..281122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD-1"
FT                   /locus_tag="MT0245"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:142852; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MT0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44465"
FT                   /db_xref="GOA:P9WNX8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNX8"
FT                   /protein_id="AAK44465.1"
FT                   CNIKTVWIA"
FT   gene            complement(281280..282728)
FT                   /locus_tag="MT0246"
FT   CDS_pept        complement(281280..282728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0246"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44466"
FT                   /db_xref="GOA:L7N4E1"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4E1"
FT                   /protein_id="AAK44466.1"
FT   gene            complement(282763..286965)
FT                   /locus_tag="MT0247"
FT   CDS_pept        complement(282763..286965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3063877"
FT                   /db_xref="EnsemblGenomes-Gn:MT0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44467"
FT                   /db_xref="GOA:Q7DA75"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA75"
FT                   /protein_id="AAK44467.1"
FT   gene            complement(287012..287560)
FT                   /locus_tag="MT0250"
FT   CDS_pept        complement(287012..287560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0250"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44468"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WLB0"
FT                   /protein_id="AAK44468.1"
FT   gene            287300..288466
FT                   /locus_tag="MT0251"
FT   CDS_pept        287300..288466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0251"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by similarity to GP:3063878; match to
FT                   protein family HMM PF00933"
FT                   /db_xref="EnsemblGenomes-Gn:MT0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44469"
FT                   /db_xref="GOA:Q7DA74"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA74"
FT                   /protein_id="AAK44469.1"
FT   gene            288542..289156
FT                   /locus_tag="MT0252"
FT   CDS_pept        288542..289156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0252"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:3063879; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44470"
FT                   /db_xref="GOA:L7N4P6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4P6"
FT                   /protein_id="AAK44470.1"
FT   gene            289218..289451
FT                   /locus_tag="MT0253"
FT   CDS_pept        289218..289451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0253"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44471"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ40"
FT                   /protein_id="AAK44471.1"
FT   gene            289459..289896
FT                   /locus_tag="MT0254"
FT   CDS_pept        289459..289896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44472"
FT                   /db_xref="GOA:P9WF86"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WF86"
FT                   /protein_id="AAK44472.1"
FT   gene            complement(289926..290768)
FT                   /locus_tag="MT0255"
FT   CDS_pept        complement(289926..290768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0255"
FT                   /product="MaoC family protein"
FT                   /note="identified by match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:MT0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44473"
FT                   /db_xref="GOA:L7N5I2"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5I2"
FT                   /protein_id="AAK44473.1"
FT   gene            complement(290779..292143)
FT                   /gene="fabG-1"
FT                   /locus_tag="MT0256"
FT   CDS_pept        complement(290779..292143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG-1"
FT                   /locus_tag="MT0256"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:2738155; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MT0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44474"
FT                   /db_xref="GOA:O53665"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3M1L"
FT                   /db_xref="PDB:3Q6I"
FT                   /db_xref="PDB:3V1T"
FT                   /db_xref="PDB:3V1U"
FT                   /db_xref="PDB:4FW8"
FT                   /db_xref="UniProtKB/TrEMBL:O53665"
FT                   /protein_id="AAK44474.1"
FT   gene            292285..293607
FT                   /locus_tag="MT0257"
FT   CDS_pept        292285..293607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0257"
FT                   /product="thiolase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:90971; match to
FT                   protein family HMM PF00108; match to protein family HMM
FT                   PF02803; match to protein family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:MT0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44475"
FT                   /db_xref="GOA:L7N5J4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5J4"
FT                   /protein_id="AAK44475.1"
FT   gene            complement(293913..295748)
FT                   /locus_tag="MT0258"
FT   CDS_pept        complement(293913..295748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0258"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:MT0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44476"
FT                   /db_xref="GOA:L7N547"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR034188"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:L7N547"
FT                   /protein_id="AAK44476.1"
FT   gene            296120..296608
FT                   /locus_tag="MT0259"
FT   CDS_pept        296120..296608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0259"
FT                   /product="oxidoreductase, putative"
FT                   /note="identified by similarity to EGAD:39824; match to
FT                   protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:MT0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44477"
FT                   /db_xref="GOA:L7N5R9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5R9"
FT                   /protein_id="AAK44477.1"
FT   gene            296885..298234
FT                   /locus_tag="MT0260"
FT   CDS_pept        296885..298234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44478"
FT                   /db_xref="GOA:Q7DA65"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA65"
FT                   /protein_id="AAK44478.1"
FT   gene            complement(298231..298977)
FT                   /locus_tag="MT0261"
FT   CDS_pept        complement(298231..298977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0261"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:MT0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44479"
FT                   /db_xref="GOA:L7N4K2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4K2"
FT                   /protein_id="AAK44479.1"
FT   gene            complement(298978..300918)
FT                   /locus_tag="MT0262"
FT   CDS_pept        complement(298978..300918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0262"
FT                   /product="FAD flavoprotein oxidase, putative"
FT                   /note="identified by similarity to EGAD:106738; match to
FT                   protein family HMM PF00890; match to protein family HMM
FT                   PF02910"
FT                   /db_xref="EnsemblGenomes-Gn:MT0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44480"
FT                   /db_xref="GOA:L7N5C5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5C5"
FT                   /protein_id="AAK44480.1"
FT                   EELAEHPGRRG"
FT   gene            complement(300949..301770)
FT                   /locus_tag="MT0263"
FT   CDS_pept        complement(300949..301770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44481"
FT                   /db_xref="GOA:L7N615"
FT                   /db_xref="UniProtKB/TrEMBL:L7N615"
FT                   /protein_id="AAK44481.1"
FT   gene            complement(301850..302083)
FT                   /locus_tag="MT0264"
FT   CDS_pept        complement(301850..302083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3063888"
FT                   /db_xref="EnsemblGenomes-Gn:MT0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44482"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA61"
FT                   /protein_id="AAK44482.1"
FT   gene            complement(302288..302767)
FT                   /locus_tag="MT0265"
FT   CDS_pept        complement(302288..302767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0265"
FT                   /product="heat shock protein, HSP20 family"
FT                   /note="identified by similarity to GP:5070146; match to
FT                   protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:MT0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44483"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:L7N524"
FT                   /protein_id="AAK44483.1"
FT   gene            302981..305542
FT                   /gene="nirB"
FT                   /locus_tag="MT0266"
FT   CDS_pept        302981..305542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="MT0266"
FT                   /product="NAD(P)H-dependent nitrite reductase, large
FT                   subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:37437; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF01077; match to protein family HMM PF03460; match to
FT                   protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:MT0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44484"
FT                   /db_xref="GOA:Q8VKP5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP5"
FT                   /protein_id="AAK44484.1"
FT   gene            complement(305940..306464)
FT                   /gene="cobU"
FT                   /locus_tag="MT0267"
FT   CDS_pept        complement(305940..306464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="MT0267"
FT                   /product="cobinamide kinase/cobinamide phosphate
FT                   guanylyltransferase"
FT                   /note="identified by similarity to EGAD:30341; match to
FT                   protein family HMM PF02283"
FT                   /db_xref="EnsemblGenomes-Gn:MT0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44485"
FT                   /db_xref="GOA:L7N4T1"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4T1"
FT                   /protein_id="AAK44485.1"
FT                   HLVIAGRVLKL"
FT   gene            complement(306489..307973)
FT                   /gene="cobQ-1"
FT                   /locus_tag="MT0268"
FT   CDS_pept        complement(306489..307973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ-1"
FT                   /locus_tag="MT0268"
FT                   /product="cobyric acid synthase"
FT                   /note="identified by similarity to EGAD:33065; match to
FT                   protein family HMM PF01656; match to protein family HMM
FT                   TIGR00313"
FT                   /db_xref="EnsemblGenomes-Gn:MT0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44486"
FT                   /db_xref="GOA:P9WP94"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP94"
FT                   /protein_id="AAK44486.1"
FT   gene            complement(307992..309662)
FT                   /locus_tag="MT0269"
FT   CDS_pept        complement(307992..309662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0269"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to EGAD:161418; match to
FT                   protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MT0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44487"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI46"
FT                   /protein_id="AAK44487.1"
FT   gene            complement(309659..309766)
FT                   /locus_tag="MT0270"
FT   CDS_pept        complement(309659..309766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44488"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP4"
FT                   /protein_id="AAK44488.1"
FT   gene            309814..310188
FT                   /locus_tag="MT0270.1"
FT   CDS_pept        309814..310188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0270.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0270.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44489"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP3"
FT                   /protein_id="AAK44489.1"
FT   gene            310145..310393
FT                   /locus_tag="MT0270.2"
FT   CDS_pept        310145..310393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0270.2"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0270.2"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP2"
FT                   /protein_id="AAK44490.1"
FT   gene            complement(310409..310864)
FT                   /locus_tag="MT0271"
FT   CDS_pept        complement(310409..310864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44491"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5G1"
FT                   /protein_id="AAK44491.1"
FT   gene            complement(310889..311632)
FT                   /locus_tag="MT0272"
FT   CDS_pept        complement(310889..311632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0272"
FT                   /product="chalcone/stilbene synthase family protein"
FT                   /note="identified by match to protein family HMM PF01903"
FT                   /db_xref="EnsemblGenomes-Gn:MT0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44492"
FT                   /db_xref="GOA:Q7DA56"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA56"
FT                   /protein_id="AAK44492.1"
FT   gene            complement(311629..312774)
FT                   /locus_tag="MT0273"
FT   CDS_pept        complement(311629..312774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0273"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by similarity to EGAD:109362; match to
FT                   protein family HMM PF00486; match to protein family HMM
FT                   PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:MT0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44493"
FT                   /db_xref="GOA:L7N4Q5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4Q5"
FT                   /protein_id="AAK44493.1"
FT   gene            complement(312874..314283)
FT                   /gene="narK-1"
FT                   /locus_tag="MT0274"
FT   CDS_pept        complement(312874..314283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK-1"
FT                   /locus_tag="MT0274"
FT                   /product="nitrite extrusion protein"
FT                   /note="identified by similarity to EGAD:136425"
FT                   /db_xref="EnsemblGenomes-Gn:MT0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44494"
FT                   /db_xref="GOA:L7N5B0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5B0"
FT                   /protein_id="AAK44494.1"
FT                   ATTAPAGLAYV"
FT   gene            complement(314424..314969)
FT                   /gene="aac"
FT                   /locus_tag="MT0275"
FT   CDS_pept        complement(314424..314969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aac"
FT                   /locus_tag="MT0275"
FT                   /product="aminoglycoside 2-N-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by similarity to EGAD:155035; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MT0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44495"
FT                   /db_xref="GOA:P9WQG8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQG8"
FT                   /protein_id="AAK44495.1"
FT                   SLDTSAELMCDWRAGDVW"
FT   gene            complement(314979..315881)
FT                   /locus_tag="MT0276"
FT   CDS_pept        complement(314979..315881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0276"
FT                   /product="urea amidolyase-related protein"
FT                   /note="identified by similarity to EGAD:90929; match to
FT                   protein family HMM PF02626; match to protein family HMM
FT                   TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:MT0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44496"
FT                   /db_xref="GOA:Q7DA53"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA53"
FT                   /protein_id="AAK44496.1"
FT   gene            complement(315898..316572)
FT                   /locus_tag="MT0277"
FT   CDS_pept        complement(315898..316572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:90926; match to
FT                   protein family HMM PF02682"
FT                   /db_xref="EnsemblGenomes-Gn:MT0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44497"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA52"
FT                   /protein_id="AAK44497.1"
FT                   AA"
FT   gene            complement(316626..317618)
FT                   /locus_tag="MT0278"
FT   CDS_pept        complement(316626..317618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0278"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by similarity to EGAD:160069; match to
FT                   protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:MT0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44498"
FT                   /db_xref="GOA:Q7DA51"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA51"
FT                   /protein_id="AAK44498.1"
FT   gene            complement(317640..321268)
FT                   /pseudo
FT                   /locus_tag="MT0279"
FT                   /note="5-oxo-L-prolinase, putative, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error;identified by similarity to SP:P97608"
FT   gene            321445..322836
FT                   /gene="narK-2"
FT                   /locus_tag="MT0280"
FT   CDS_pept        321445..322836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK-2"
FT                   /locus_tag="MT0280"
FT                   /product="nitrite extrusion protein"
FT                   /note="identified by similarity to EGAD:9741; match to
FT                   protein family HMM TIGR00886"
FT                   /db_xref="EnsemblGenomes-Gn:MT0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44499"
FT                   /db_xref="GOA:L7N5I5"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5I5"
FT                   /protein_id="AAK44499.1"
FT                   GQVGV"
FT   gene            complement(322878..323387)
FT                   /locus_tag="MT0281"
FT   CDS_pept        complement(322878..323387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44500"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:L7N569"
FT                   /protein_id="AAK44500.1"
FT                   VDIGRV"
FT   gene            complement(323452..324636)
FT                   /locus_tag="MT0282"
FT   CDS_pept        complement(323452..324636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5139565"
FT                   /db_xref="EnsemblGenomes-Gn:MT0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44501"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA48"
FT                   /protein_id="AAK44501.1"
FT   gene            324681..326363
FT                   /locus_tag="MT0283"
FT   CDS_pept        324681..326363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0283"
FT                   /product="substrate--CoA ligase"
FT                   /note="identified by similarity to EGAD:108855; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44502"
FT                   /db_xref="GOA:L7N5E5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5E5"
FT                   /protein_id="AAK44502.1"
FT   gene            complement(326380..328575)
FT                   /locus_tag="MT0284"
FT   CDS_pept        complement(326380..328575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0284"
FT                   /product="acyl-CoA dehydrogenase, putative"
FT                   /note="identified by similarity to EGAD:15093; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771"
FT                   /db_xref="EnsemblGenomes-Gn:MT0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44503"
FT                   /db_xref="GOA:L7N5P6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5P6"
FT                   /protein_id="AAK44503.1"
FT   gene            complement(328689..329705)
FT                   /locus_tag="MT0285"
FT   CDS_pept        complement(328689..329705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44504"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA45"
FT                   /protein_id="AAK44504.1"
FT   gene            complement(329819..330439)
FT                   /locus_tag="MT0286"
FT   CDS_pept        complement(329819..330439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3046313; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44505"
FT                   /db_xref="GOA:L7N4S4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4S4"
FT                   /protein_id="AAK44505.1"
FT   gene            330494..331117
FT                   /locus_tag="MT0286.1"
FT   CDS_pept        330494..331117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0286.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0286.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44506"
FT                   /db_xref="GOA:Q7DA43"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA43"
FT                   /protein_id="AAK44506.1"
FT   gene            complement(331047..331772)
FT                   /locus_tag="MT0287"
FT   CDS_pept        complement(331047..331772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44507"
FT                   /db_xref="GOA:Q7DA42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA42"
FT                   /protein_id="AAK44507.1"
FT   gene            331862..332782
FT                   /locus_tag="MT0288"
FT   CDS_pept        331862..332782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44508"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5R4"
FT                   /protein_id="AAK44508.1"
FT   gene            complement(332822..333250)
FT                   /locus_tag="MT0289"
FT   CDS_pept        complement(332822..333250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0289"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44509"
FT                   /db_xref="GOA:P9WF84"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WF84"
FT                   /protein_id="AAK44509.1"
FT   gene            complement(333274..333447)
FT                   /locus_tag="MT0290"
FT   CDS_pept        complement(333274..333447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44510"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP1"
FT                   /protein_id="AAK44510.1"
FT                   VLDEGLELNSRK"
FT   gene            complement(333551..336268)
FT                   /locus_tag="MT0291"
FT   CDS_pept        complement(333551..336268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0291"
FT                   /product="PE_PGRS family protein"
FT                   /note="identified by similarity to EGAD:160285; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44511"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIG2"
FT                   /protein_id="AAK44511.1"
FT   gene            336255..336410
FT                   /locus_tag="MT0291.1"
FT   CDS_pept        336255..336410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0291.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0291.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44512"
FT                   /db_xref="GOA:Q8VKP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKP0"
FT                   /protein_id="AAK44512.1"
FT                   AITNDI"
FT   gene            complement(336394..336525)
FT                   /locus_tag="MT0291.2"
FT   CDS_pept        complement(336394..336525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0291.2"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0291.2"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44513"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN9"
FT                   /protein_id="AAK44513.1"
FT   gene            complement(336656..336850)
FT                   /locus_tag="MT0291.3"
FT   CDS_pept        complement(336656..336850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0291.3"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0291.3"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN8"
FT                   /protein_id="AAK44514.1"
FT   gene            337082..338878
FT                   /locus_tag="MT0291.4"
FT   CDS_pept        337082..338878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0291.4"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0291.4"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN7"
FT                   /protein_id="AAK44515.1"
FT   gene            339309..341036
FT                   /locus_tag="MT0292"
FT   CDS_pept        339309..341036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0292"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to EGAD:161582; match to
FT                   protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MT0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44516"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI44"
FT                   /protein_id="AAK44516.1"
FT   gene            341060..341968
FT                   /locus_tag="MT0293"
FT   CDS_pept        341060..341968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4582351; match to
FT                   protein family HMM PF02409; match to protein family HMM
FT                   TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MT0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44517"
FT                   /db_xref="GOA:P9WFI8"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFI8"
FT                   /protein_id="AAK44517.1"
FT   gene            complement(342048..342155)
FT                   /locus_tag="MT0294"
FT   CDS_pept        complement(342048..342155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44518"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN5"
FT                   /protein_id="AAK44518.1"
FT   gene            342246..344087
FT                   /locus_tag="MT0295"
FT   CDS_pept        342246..344087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0295"
FT                   /product="ATPase, AAA family"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:MT0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44519"
FT                   /db_xref="GOA:P9WPI2"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPI2"
FT                   /protein_id="AAK44519.1"
FT   gene            344084..345700
FT                   /locus_tag="MT0296"
FT   CDS_pept        344084..345700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4455685; match to
FT                   protein family HMM PF05108"
FT                   /db_xref="EnsemblGenomes-Gn:MT0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44520"
FT                   /db_xref="GOA:P9WNR2"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNR2"
FT                   /protein_id="AAK44520.1"
FT   gene            345697..349689
FT                   /locus_tag="MT0297"
FT   CDS_pept        345697..349689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0297"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="identified by similarity to GP:3413408; match to
FT                   protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:MT0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44521"
FT                   /db_xref="GOA:P9WNA8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNA8"
FT                   /protein_id="AAK44521.1"
FT   gene            349686..349994
FT                   /locus_tag="MT0298"
FT   CDS_pept        349686..349994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0298"
FT                   /product="PE family protein"
FT                   /note="identified by similarity to EGAD:161592; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44522"
FT                   /db_xref="GOA:Q7DA36"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA36"
FT                   /protein_id="AAK44522.1"
FT   gene            349997..351538
FT                   /locus_tag="MT0299"
FT   CDS_pept        349997..351538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0299"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to EGAD:161593; match to
FT                   protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MT0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44523"
FT                   /db_xref="GOA:P9WI42"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI42"
FT                   /protein_id="AAK44523.1"
FT   gene            351587..351880
FT                   /locus_tag="MT0300"
FT   CDS_pept        351587..351880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0300"
FT                   /product="PE family protein"
FT                   /note="identified by similarity to EGAD:161596"
FT                   /db_xref="EnsemblGenomes-Gn:MT0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44524"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5C4"
FT                   /protein_id="AAK44524.1"
FT   gene            351910..352200
FT                   /locus_tag="MT0301"
FT   CDS_pept        351910..352200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0301"
FT                   /product="secreted antigen, putative"
FT                   /note="identified by similarity to GP:2370279"
FT                   /db_xref="EnsemblGenomes-Gn:MT0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44525"
FT                   /db_xref="GOA:P9WNK2"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNK2"
FT                   /protein_id="AAK44525.1"
FT   gene            352211..353098
FT                   /locus_tag="MT0302"
FT   CDS_pept        352211..353098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0302"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44526"
FT                   /db_xref="GOA:P9WJC6"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJC6"
FT                   /protein_id="AAK44526.1"
FT                   PGQRVSRDFSTQSS"
FT   gene            353145..354563
FT                   /locus_tag="MT0303"
FT   CDS_pept        353145..354563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0303"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44527"
FT                   /db_xref="GOA:P9WNQ2"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNQ2"
FT                   /protein_id="AAK44527.1"
FT                   MAYLVGLFAWVLNR"
FT   gene            354701..355945
FT                   /locus_tag="MT0304"
FT   CDS_pept        354701..355945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0304"
FT                   /product="subtilase family protein"
FT                   /note="identified by similarity to EGAD:49094; match to
FT                   protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:MT0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44528"
FT                   /db_xref="GOA:Q7DA31"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA31"
FT                   /protein_id="AAK44528.1"
FT                   AATVAIARRRREPTE"
FT   gene            355942..356937
FT                   /locus_tag="MT0305"
FT   CDS_pept        355942..356937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44529"
FT                   /db_xref="GOA:P9WJE4"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJE4"
FT                   /protein_id="AAK44529.1"
FT   gene            complement(356924..358126)
FT                   /locus_tag="MT0306"
FT   CDS_pept        complement(356924..358126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44530"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN4"
FT                   /protein_id="AAK44530.1"
FT                   D"
FT   gene            358233..359018
FT                   /gene="tam"
FT                   /locus_tag="MT0307"
FT   CDS_pept        358233..359018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tam"
FT                   /locus_tag="MT0307"
FT                   /product="trans-aconitate methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P76145"
FT                   /db_xref="EnsemblGenomes-Gn:MT0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44531"
FT                   /db_xref="GOA:P9WGA2"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGA2"
FT                   /protein_id="AAK44531.1"
FT   gene            complement(359007..359810)
FT                   /locus_tag="MT0308"
FT   CDS_pept        complement(359007..359810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0308"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44532"
FT                   /db_xref="GOA:L7N5Y3"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5Y3"
FT                   /protein_id="AAK44532.1"
FT   gene            complement(359820..361217)
FT                   /locus_tag="MT0310"
FT   CDS_pept        complement(359820..361217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0310"
FT                   /product="sulfatase family protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:MT0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44533"
FT                   /db_xref="GOA:Q7DA28"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA28"
FT                   /protein_id="AAK44533.1"
FT                   GIDEHCS"
FT   gene            361303..363171
FT                   /locus_tag="MT0311"
FT   CDS_pept        361303..363171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0311"
FT                   /product="PE_PGRS family protein"
FT                   /note="identified by similarity to EGAD:132585; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44534"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN3"
FT                   /protein_id="AAK44534.1"
FT   gene            363314..363541
FT                   /locus_tag="MT0312"
FT   CDS_pept        363314..363541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0312"
FT                   /product="DNA-binding protein, CopG family"
FT                   /note="identified by match to protein family HMM PF01402"
FT                   /db_xref="EnsemblGenomes-Gn:MT0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44535"
FT                   /db_xref="GOA:P9WJ08"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ08"
FT                   /protein_id="AAK44535.1"
FT   gene            363691..363840
FT                   /locus_tag="MT0313"
FT   CDS_pept        363691..363840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44536"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA26"
FT                   /protein_id="AAK44536.1"
FT                   ALLC"
FT   gene            364106..364531
FT                   /locus_tag="MT0314"
FT   CDS_pept        364106..364531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0314"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44537"
FT                   /db_xref="GOA:P9WFB8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFB8"
FT                   /protein_id="AAK44537.1"
FT   gene            364667..365299
FT                   /locus_tag="MT0315"
FT   CDS_pept        364667..365299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0315"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to EGAD:5882; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44538"
FT                   /db_xref="GOA:L7N4S8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4S8"
FT                   /protein_id="AAK44538.1"
FT   gene            365296..366204
FT                   /locus_tag="MT0316"
FT   CDS_pept        365296..366204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0316"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by similarity to EGAD:150890; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MT0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44539"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:L7N583"
FT                   /protein_id="AAK44539.1"
FT   gene            complement(366212..375772)
FT                   /locus_tag="MT0318"
FT   CDS_pept        complement(366212..375772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0318"
FT                   /product="PPE family protein"
FT                   /note="identified by match to protein family HMM PF00823;
FT                   match to protein family HMM PF01469; match to protein
FT                   family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:MT0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44540"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN2"
FT                   /protein_id="AAK44540.1"
FT                   IGNFGTNLAGFFRG"
FT   gene            375975..376646
FT                   /gene="bluB"
FT                   /locus_tag="MT0319"
FT   CDS_pept        375975..376646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bluB"
FT                   /locus_tag="MT0319"
FT                   /product="nitroreductase, cobalamin biosynthesis protein"
FT                   /note="identified by similarity to EGAD:33064; match to
FT                   protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:MT0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44541"
FT                   /db_xref="GOA:L7N591"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:L7N591"
FT                   /protein_id="AAK44541.1"
FT                   E"
FT   gene            complement(376634..377116)
FT                   /locus_tag="MT0320"
FT   CDS_pept        complement(376634..377116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44542"
FT                   /db_xref="UniProtKB/TrEMBL:L7N624"
FT                   /protein_id="AAK44542.1"
FT   gene            377174..377890
FT                   /locus_tag="MT0321"
FT   CDS_pept        377174..377890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0321"
FT                   /product="PAP2 superfamily protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:MT0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44543"
FT                   /db_xref="GOA:L7N4B8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4B8"
FT                   /protein_id="AAK44543.1"
FT                   PVEVSRQPEPEVDTAR"
FT   gene            377992..378648
FT                   /locus_tag="MT0322"
FT   CDS_pept        377992..378648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0322"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44544"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5Y7"
FT                   /protein_id="AAK44544.1"
FT   gene            complement(378718..379209)
FT                   /gene="baiE"
FT                   /locus_tag="MT0323"
FT   CDS_pept        complement(378718..379209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="baiE"
FT                   /locus_tag="MT0323"
FT                   /product="baiE protein"
FT                   /note="identified by similarity to EGAD:10415"
FT                   /db_xref="EnsemblGenomes-Gn:MT0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44545"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4A7"
FT                   /protein_id="AAK44545.1"
FT                   "
FT   gene            379233..380462
FT                   /locus_tag="MT0324"
FT   CDS_pept        379233..380462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0324"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44546"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5S2"
FT                   /protein_id="AAK44546.1"
FT                   PRRSLPLTVK"
FT   gene            380503..380601
FT                   /locus_tag="MT0325"
FT   CDS_pept        380503..380601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0325"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44547"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN1"
FT                   /protein_id="AAK44547.1"
FT                   /translation="MTPPHRPHTNEVVTEPYTAHPPLWLTLATDPY"
FT   gene            380617..382479
FT                   /locus_tag="MT0326"
FT   CDS_pept        380617..382479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44548"
FT                   /db_xref="GOA:L7N5E8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5E8"
FT                   /protein_id="AAK44548.1"
FT   gene            382551..382937
FT                   /locus_tag="MT0327"
FT   CDS_pept        382551..382937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44549"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WL02"
FT                   /protein_id="AAK44549.1"
FT   gene            complement(382940..383125)
FT                   /locus_tag="MT0328"
FT   CDS_pept        complement(382940..383125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44550"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKN0"
FT                   /protein_id="AAK44550.1"
FT                   SPKISNAGGSNSVQQG"
FT   gene            383070..383315
FT                   /locus_tag="MT0328.1"
FT   CDS_pept        383070..383315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0328.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0328.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44551"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM9"
FT                   /protein_id="AAK44551.1"
FT   gene            complement(383191..383601)
FT                   /locus_tag="MT0328.2"
FT   CDS_pept        complement(383191..383601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0328.2"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0328.2"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44552"
FT                   /db_xref="GOA:Q8VKM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM8"
FT                   /protein_id="AAK44552.1"
FT   gene            383662..384546
FT                   /locus_tag="MT0329"
FT   CDS_pept        383662..384546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0329"
FT                   /product="beta-glucanase, putative"
FT                   /note="identified by similarity to EGAD:124922; match to
FT                   protein family HMM PF00722; match to protein family HMM
FT                   TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:MT0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44553"
FT                   /db_xref="GOA:Q7DA14"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA14"
FT                   /protein_id="AAK44553.1"
FT                   YPQEMLVDWVRVF"
FT   gene            384595..385209
FT                   /locus_tag="MT0330"
FT   CDS_pept        384595..385209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0330"
FT                   /product="muconolactone isomerase, putative"
FT                   /note="identified by similarity to EGAD:135957; match to
FT                   protein family HMM PF02426"
FT                   /db_xref="EnsemblGenomes-Gn:MT0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44554"
FT                   /db_xref="GOA:L7N5F4"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5F4"
FT                   /protein_id="AAK44554.1"
FT   gene            complement(385233..385970)
FT                   /locus_tag="MT0332"
FT   CDS_pept        complement(385233..385970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3319725; match to
FT                   protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:MT0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44555"
FT                   /db_xref="GOA:Q7DA12"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA12"
FT                   /protein_id="AAK44555.1"
FT   gene            complement(386365..387141)
FT                   /locus_tag="MT0333"
FT   CDS_pept        complement(386365..387141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44556"
FT                   /db_xref="GOA:Q8VKM7"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM7"
FT                   /protein_id="AAK44556.1"
FT   gene            387208..387876
FT                   /gene="pcp"
FT                   /locus_tag="MT0334"
FT   CDS_pept        387208..387876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="MT0334"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:140552; match to
FT                   protein family HMM PF01470; match to protein family HMM
FT                   TIGR00504"
FT                   /db_xref="EnsemblGenomes-Gn:MT0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44557"
FT                   /db_xref="GOA:P9WIJ4"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIJ4"
FT                   /protein_id="AAK44557.1"
FT                   "
FT   gene            387948..388610
FT                   /locus_tag="MT0335"
FT   CDS_pept        387948..388610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44558"
FT                   /db_xref="UniProtKB/TrEMBL:L7N564"
FT                   /protein_id="AAK44558.1"
FT   gene            388642..389214
FT                   /gene="dcd"
FT                   /locus_tag="MT0336"
FT   CDS_pept        388642..389214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="MT0336"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:5019328; match to
FT                   protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:MT0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44559"
FT                   /db_xref="GOA:P9WP16"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP16"
FT                   /protein_id="AAK44559.1"
FT   gene            389320..390651
FT                   /gene="ugdA"
FT                   /locus_tag="MT0337"
FT   CDS_pept        389320..390651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugdA"
FT                   /locus_tag="MT0337"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:153504; match to
FT                   protein family HMM PF00984; match to protein family HMM
FT                   PF03720; match to protein family HMM PF03721"
FT                   /db_xref="EnsemblGenomes-Gn:MT0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44560"
FT                   /db_xref="GOA:L7N5L2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5L2"
FT                   /protein_id="AAK44560.1"
FT   gene            complement(390640..391311)
FT                   /locus_tag="MT0338"
FT   CDS_pept        complement(390640..391311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0338"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44561"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA09"
FT                   /protein_id="AAK44561.1"
FT                   P"
FT   gene            391412..392092
FT                   /locus_tag="MT0339"
FT   CDS_pept        391412..392092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0339"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by similarity to GP:3955039; match to
FT                   protein family HMM PF00581; match to protein family HMM
FT                   PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:MT0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44562"
FT                   /db_xref="GOA:Q7DA08"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA08"
FT                   /protein_id="AAK44562.1"
FT                   GHGD"
FT   gene            392099..392323
FT                   /locus_tag="MT0340"
FT   CDS_pept        392099..392323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0340"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44563"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5F3"
FT                   /protein_id="AAK44563.1"
FT   gene            392333..392788
FT                   /locus_tag="MT0341"
FT   CDS_pept        392333..392788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44564"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4V0"
FT                   /protein_id="AAK44564.1"
FT   gene            complement(392756..394105)
FT                   /locus_tag="MT0342"
FT   CDS_pept        complement(392756..394105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0342"
FT                   /product="P450 heme-thiolate protein"
FT                   /note="identified by similarity to EGAD:40204; match to
FT                   protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:MT0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44565"
FT                   /db_xref="GOA:P9WPN0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPN0"
FT                   /protein_id="AAK44565.1"
FT   gene            394171..394773
FT                   /locus_tag="MT0343"
FT   CDS_pept        394171..394773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0343"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:4726006; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44566"
FT                   /db_xref="GOA:L7N582"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:L7N582"
FT                   /protein_id="AAK44566.1"
FT   gene            complement(394754..395380)
FT                   /locus_tag="MT0344"
FT   CDS_pept        complement(394754..395380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0344"
FT                   /product="MitM-related protein"
FT                   /note="identified by similarity to GP:4731342"
FT                   /db_xref="EnsemblGenomes-Gn:MT0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44567"
FT                   /db_xref="GOA:L7N5H9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5H9"
FT                   /protein_id="AAK44567.1"
FT   gene            complement(395407..396147)
FT                   /locus_tag="MT0345"
FT   CDS_pept        complement(395407..396147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0345"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:3201567; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44568"
FT                   /db_xref="GOA:L7N4X4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4X4"
FT                   /protein_id="AAK44568.1"
FT   gene            396261..397427
FT                   /locus_tag="MT0346"
FT   CDS_pept        396261..397427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0346"
FT                   /product="phage tail component protein, putative"
FT                   /note="identified by similarity to GP:2623858; match to
FT                   protein family HMM PF00070"
FT                   /db_xref="EnsemblGenomes-Gn:MT0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44569"
FT                   /db_xref="GOA:Q7DA02"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DA02"
FT                   /protein_id="AAK44569.1"
FT   gene            complement(397639..398628)
FT                   /locus_tag="MT0347"
FT   CDS_pept        complement(397639..398628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0347"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44570"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM6"
FT                   /protein_id="AAK44570.1"
FT   gene            398718..399584
FT                   /gene="rfbA"
FT                   /locus_tag="MT0348"
FT   CDS_pept        398718..399584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="MT0348"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:17315; match to
FT                   protein family HMM PF00483; match to protein family HMM
FT                   TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:MT0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44571"
FT                   /db_xref="GOA:P9WH12"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH12"
FT                   /protein_id="AAK44571.1"
FT                   LELLERN"
FT   gene            complement(399595..400110)
FT                   /locus_tag="MT0349"
FT   CDS_pept        complement(399595..400110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0349"
FT                   /product="PE family protein"
FT                   /note="identified by similarity to EGAD:132537; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44572"
FT                   /db_xref="GOA:O86338"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:O86338"
FT                   /protein_id="AAK44572.1"
FT                   RGFHNHRQ"
FT   gene            400252..401763
FT                   /locus_tag="MT0350"
FT   CDS_pept        400252..401763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0350"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44573"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4F2"
FT                   /protein_id="AAK44573.1"
FT   gene            complement(401933..403222)
FT                   /gene="aspC"
FT                   /locus_tag="MT0351"
FT   CDS_pept        complement(401933..403222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="MT0351"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:91506; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:MT0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44574"
FT                   /db_xref="GOA:P9WQ90"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ90"
FT                   /protein_id="AAK44574.1"
FT   gene            complement(403253..405901)
FT                   /locus_tag="MT0352"
FT   CDS_pept        complement(403253..405901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0352"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by similarity to EGAD:29984; match to
FT                   protein family HMM PF00037; match to protein family HMM
FT                   PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:MT0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44575"
FT                   /db_xref="GOA:Q7D9Z9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Z9"
FT                   /protein_id="AAK44575.1"
FT                   IARGARPPGKR"
FT   gene            complement(406010..408508)
FT                   /locus_tag="MT0353"
FT   CDS_pept        complement(406010..408508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0353"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by similarity to EGAD:132540; match to
FT                   protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:MT0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44576"
FT                   /db_xref="GOA:L7N4T7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4T7"
FT                   /protein_id="AAK44576.1"
FT   gene            408694..409233
FT                   /locus_tag="MT0355"
FT   CDS_pept        408694..409233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44577"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4P8"
FT                   /protein_id="AAK44577.1"
FT                   DPHTVEPDHHGYDIHG"
FT   gene            409416..410861
FT                   /locus_tag="MT0356"
FT   CDS_pept        409416..410861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44578"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ96"
FT                   /protein_id="AAK44578.1"
FT   gene            410898..412820
FT                   /locus_tag="MT0357"
FT   CDS_pept        410898..412820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0357"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44579"
FT                   /db_xref="GOA:P9WJ98"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ98"
FT                   /protein_id="AAK44579.1"
FT                   SLGRA"
FT   gene            412817..414298
FT                   /locus_tag="MT0357.1"
FT   CDS_pept        412817..414298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0357.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0357.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44580"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ94"
FT                   /protein_id="AAK44580.1"
FT   gene            complement(414441..415001)
FT                   /locus_tag="MT0359"
FT   CDS_pept        complement(414441..415001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0359"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44581"
FT                   /db_xref="UniProtKB/TrEMBL:L7N643"
FT                   /protein_id="AAK44581.1"
FT   gene            415104..415520
FT                   /locus_tag="MT0360"
FT   CDS_pept        415104..415520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44582"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Z3"
FT                   /protein_id="AAK44582.1"
FT   gene            complement(415562..417025)
FT                   /gene="ansP-1"
FT                   /locus_tag="MT0361"
FT   CDS_pept        complement(415562..417025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansP-1"
FT                   /locus_tag="MT0361"
FT                   /product="L-asparagine permease"
FT                   /note="identified by similarity to EGAD:13728; match to
FT                   protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MT0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44583"
FT                   /db_xref="GOA:P9WQM6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQM6"
FT                   /protein_id="AAK44583.1"
FT   gene            417364..418350
FT                   /locus_tag="MT0362"
FT   CDS_pept        417364..418350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0362"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44584"
FT                   /db_xref="GOA:L7N4N8"
FT                   /db_xref="InterPro:IPR026349"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4N8"
FT                   /protein_id="AAK44584.1"
FT   gene            418353..419006
FT                   /locus_tag="MT0363"
FT   CDS_pept        418353..419006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44585"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4G1"
FT                   /protein_id="AAK44585.1"
FT   gene            419126..419668
FT                   /locus_tag="MT0364"
FT   CDS_pept        419126..419668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44586"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Z0"
FT                   /protein_id="AAK44586.1"
FT                   SIRREARSHRKSVKLAD"
FT   gene            419895..421772
FT                   /gene="dnaK"
FT                   /locus_tag="MT0365"
FT   CDS_pept        419895..421772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="MT0365"
FT                   /product="dnaK protein"
FT                   /note="identified by similarity to EGAD:5870; match to
FT                   protein family HMM PF00012"
FT                   /db_xref="EnsemblGenomes-Gn:MT0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44587"
FT                   /db_xref="GOA:P9WMJ8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMJ8"
FT                   /protein_id="AAK44587.1"
FT   gene            421859..422476
FT                   /gene="grpE"
FT                   /locus_tag="MT0366"
FT   CDS_pept        421859..422476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="MT0366"
FT                   /product="grpE protein"
FT                   /note="identified by similarity to SP:Q05562; match to
FT                   protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:MT0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44588"
FT                   /db_xref="GOA:P9WMT4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMT4"
FT                   /protein_id="AAK44588.1"
FT   gene            422512..423699
FT                   /gene="dnaJ-1"
FT                   /locus_tag="MT0367"
FT   CDS_pept        422512..423699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ-1"
FT                   /locus_tag="MT0367"
FT                   /product="dnaJ protein"
FT                   /note="identified by similarity to GP:581617; match to
FT                   protein family HMM PF00226; match to protein family HMM
FT                   PF00684; match to protein family HMM PF01556"
FT                   /db_xref="EnsemblGenomes-Gn:MT0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44589"
FT                   /db_xref="GOA:P9WNV8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNV8"
FT                   /protein_id="AAK44589.1"
FT   gene            423699..424079
FT                   /gene="hspR"
FT                   /locus_tag="MT0368"
FT   CDS_pept        423699..424079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspR"
FT                   /locus_tag="MT0368"
FT                   /product="transcriptional regulator HspR"
FT                   /note="identified by similarity to EGAD:14005; match to
FT                   protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:MT0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44590"
FT                   /db_xref="GOA:L7N4R7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4R7"
FT                   /protein_id="AAK44590.1"
FT   gene            complement(424306..424863)
FT                   /locus_tag="MT0369"
FT   CDS_pept        complement(424306..424863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0369"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to EGAD:160762"
FT                   /db_xref="EnsemblGenomes-Gn:MT0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44591"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM4"
FT                   /protein_id="AAK44591.1"
FT   gene            complement(424940..434767)
FT                   /locus_tag="MT0370"
FT   CDS_pept        complement(424940..434767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0370"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to EGAD:160777; match to
FT                   protein family HMM PF00823; match to protein family HMM
FT                   PF01469; match to protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:MT0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44592"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM3"
FT                   /protein_id="AAK44592.1"
FT   gene            complement(434918..435547)
FT                   /locus_tag="MT0372"
FT   CDS_pept        complement(434918..435547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3129992; match to
FT                   protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:MT0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44593"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Y8"
FT                   /protein_id="AAK44593.1"
FT   gene            complement(435559..436857)
FT                   /gene="purA"
FT                   /locus_tag="MT0373"
FT   CDS_pept        complement(435559..436857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="MT0373"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:15130; match to
FT                   protein family HMM PF00709; match to protein family HMM
FT                   TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:MT0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44594"
FT                   /db_xref="GOA:P9WHN2"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHN2"
FT                   /protein_id="AAK44594.1"
FT   gene            436948..437595
FT                   /locus_tag="MT0374"
FT   CDS_pept        436948..437595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3129994"
FT                   /db_xref="EnsemblGenomes-Gn:MT0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44595"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5M5"
FT                   /protein_id="AAK44595.1"
FT   gene            437747..438385
FT                   /locus_tag="MT0375"
FT   CDS_pept        437747..438385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108332; match to
FT                   protein family HMM PF02163"
FT                   /db_xref="EnsemblGenomes-Gn:MT0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44596"
FT                   /db_xref="GOA:Q7D9Y6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Y6"
FT                   /protein_id="AAK44596.1"
FT   gene            complement(438390..438803)
FT                   /locus_tag="MT0376"
FT   CDS_pept        complement(438390..438803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4753871"
FT                   /db_xref="EnsemblGenomes-Gn:MT0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44597"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Y5"
FT                   /protein_id="AAK44597.1"
FT   gene            438910..439737
FT                   /locus_tag="MT0377"
FT   CDS_pept        438910..439737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3129997"
FT                   /db_xref="EnsemblGenomes-Gn:MT0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44598"
FT                   /db_xref="GOA:L7N4J8"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4J8"
FT                   /protein_id="AAK44598.1"
FT   gene            439959..441341
FT                   /locus_tag="MT0378"
FT   CDS_pept        439959..441341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0378"
FT                   /product="divalent cation transporter, MgtE family"
FT                   /note="identified by similarity to GP:780283; match to
FT                   protein family HMM PF00571; match to protein family HMM
FT                   PF01769; match to protein family HMM PF03448; match to
FT                   protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:MT0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44599"
FT                   /db_xref="GOA:L7N4U3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4U3"
FT                   /protein_id="AAK44599.1"
FT                   GL"
FT   gene            complement(441353..442387)
FT                   /gene="fba"
FT                   /locus_tag="MT0379"
FT   CDS_pept        complement(441353..442387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="MT0379"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:19099; match to
FT                   protein family HMM PF01116; match to protein family HMM
FT                   TIGR00167; match to protein family HMM TIGR01520"
FT                   /db_xref="EnsemblGenomes-Gn:MT0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44600"
FT                   /db_xref="GOA:P9WQA2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQA2"
FT                   /protein_id="AAK44600.1"
FT                   SLTH"
FT   gene            442483..443166
FT                   /gene="dedA"
FT                   /locus_tag="MT0380"
FT   CDS_pept        442483..443166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="MT0380"
FT                   /product="dedA protein"
FT                   /note="identified by similarity to EGAD:14096; match to
FT                   protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:MT0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44601"
FT                   /db_xref="GOA:P9WP08"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP08"
FT                   /protein_id="AAK44601.1"
FT                   LVLPE"
FT   gene            complement(443155..444285)
FT                   /locus_tag="MT0381"
FT   CDS_pept        complement(443155..444285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0381"
FT                   /product="fructose-bisphosphate aldolase family protein"
FT                   /note="identified by similarity to EGAD:11470"
FT                   /db_xref="EnsemblGenomes-Gn:MT0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44602"
FT                   /db_xref="GOA:L7N4P9"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4P9"
FT                   /protein_id="AAK44602.1"
FT   gene            complement(444310..444903)
FT                   /locus_tag="MT0382"
FT   CDS_pept        complement(444310..444903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0382"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44603"
FT                   /db_xref="GOA:L7N5R2"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5R2"
FT                   /protein_id="AAK44603.1"
FT   gene            444914..445342
FT                   /locus_tag="MT0383"
FT   CDS_pept        444914..445342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0383"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44604"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM2"
FT                   /protein_id="AAK44604.1"
FT   gene            complement(445402..446613)
FT                   /locus_tag="MT0384"
FT   CDS_pept        complement(445402..446613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2924374; match to
FT                   protein family HMM PF05762"
FT                   /db_xref="EnsemblGenomes-Gn:MT0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44605"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Y0"
FT                   /protein_id="AAK44605.1"
FT                   AGAR"
FT   gene            complement(446619..447221)
FT                   /locus_tag="MT0384.1"
FT   CDS_pept        complement(446619..447221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0384.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0384.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44606"
FT                   /db_xref="GOA:Q7D9X9"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9X9"
FT                   /protein_id="AAK44606.1"
FT   gene            complement(447235..448131)
FT                   /locus_tag="MT0385"
FT   CDS_pept        complement(447235..448131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:42844"
FT                   /db_xref="EnsemblGenomes-Gn:MT0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44607"
FT                   /db_xref="GOA:L7N4W9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4W9"
FT                   /protein_id="AAK44607.1"
FT                   RTQIRDAYQAFTECSHA"
FT   gene            complement(448128..448721)
FT                   /locus_tag="MT0386"
FT   CDS_pept        complement(448128..448721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:109011"
FT                   /db_xref="EnsemblGenomes-Gn:MT0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44608"
FT                   /db_xref="GOA:O53706"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="PDB:2WE9"
FT                   /db_xref="PDB:2WEE"
FT                   /db_xref="PDB:2YES"
FT                   /db_xref="UniProtKB/TrEMBL:O53706"
FT                   /protein_id="AAK44608.1"
FT   gene            complement(448718..449473)
FT                   /locus_tag="MT0387"
FT   CDS_pept        complement(448718..449473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5105927; match to
FT                   protein family HMM PF02625"
FT                   /db_xref="EnsemblGenomes-Gn:MT0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44609"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:L7N516"
FT                   /protein_id="AAK44609.1"
FT   gene            complement(449492..451891)
FT                   /locus_tag="MT0388"
FT   CDS_pept        complement(449492..451891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0388"
FT                   /product="carbon monoxide dehydrogenase, large subunit,
FT                   putative"
FT                   /note="identified by similarity to EGAD:42843; match to
FT                   protein family HMM PF01315; match to protein family HMM
FT                   PF02738"
FT                   /db_xref="EnsemblGenomes-Gn:MT0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44610"
FT                   /db_xref="GOA:L7N4Z4"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4Z4"
FT                   /protein_id="AAK44610.1"
FT   gene            complement(451888..452367)
FT                   /locus_tag="MT0389"
FT   CDS_pept        complement(451888..452367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0389"
FT                   /product="carbon monoxide dehydrogenase, small subunit,
FT                   putative"
FT                   /note="identified by similarity to EGAD:42842; match to
FT                   protein family HMM PF00111; match to protein family HMM
FT                   PF01799"
FT                   /db_xref="EnsemblGenomes-Gn:MT0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44611"
FT                   /db_xref="GOA:L7N5C9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5C9"
FT                   /protein_id="AAK44611.1"
FT   gene            complement(452382..453284)
FT                   /locus_tag="MT0390"
FT   CDS_pept        complement(452382..453284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0390"
FT                   /product="carbon monoxide dehydrogenase, medium subunit,
FT                   putative"
FT                   /note="identified by similarity to EGAD:42841; match to
FT                   protein family HMM PF00941; match to protein family HMM
FT                   PF03450"
FT                   /db_xref="EnsemblGenomes-Gn:MT0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44612"
FT                   /db_xref="GOA:Q7D9X3"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9X3"
FT                   /protein_id="AAK44612.1"
FT   gene            454510..455475
FT                   /locus_tag="MT0391"
FT   CDS_pept        454510..455475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0391"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by similarity to EGAD:6794; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:MT0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44613"
FT                   /db_xref="GOA:P9WMF6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMF6"
FT                   /protein_id="AAK44613.1"
FT   gene            complement(455648..456226)
FT                   /locus_tag="MT0392"
FT   CDS_pept        complement(455648..456226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0392"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44614"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM1"
FT                   /protein_id="AAK44614.1"
FT   gene            complement(456357..456908)
FT                   /locus_tag="MT0393"
FT   CDS_pept        complement(456357..456908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0393"
FT                   /product="spoU rRNA methylase family protein"
FT                   /note="identified by similarity to EGAD:18750; match to
FT                   protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:MT0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44615"
FT                   /db_xref="GOA:L7N5U1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5U1"
FT                   /protein_id="AAK44615.1"
FT   gene            complement(457004..457768)
FT                   /locus_tag="MT0394"
FT   CDS_pept        complement(457004..457768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44616"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKM0"
FT                   /protein_id="AAK44616.1"
FT   gene            complement(457930..458469)
FT                   /gene="pyrE"
FT                   /locus_tag="MT0395"
FT   CDS_pept        complement(457930..458469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="MT0395"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:48854; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:MT0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44617"
FT                   /db_xref="GOA:P9WHK8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHK8"
FT                   /protein_id="AAK44617.1"
FT                   GLRYRSVLGLADLGLD"
FT   gene            complement(458550..459404)
FT                   /locus_tag="MT0396"
FT   CDS_pept        complement(458550..459404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44618"
FT                   /db_xref="GOA:L7N4H8"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4H8"
FT                   /protein_id="AAK44618.1"
FT                   YQH"
FT   gene            complement(459545..462091)
FT                   /gene="clpB"
FT                   /locus_tag="MT0397"
FT   CDS_pept        complement(459545..462091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="MT0397"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpB"
FT                   /note="identified by similarity to GP:4098131; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02861"
FT                   /db_xref="EnsemblGenomes-Gn:MT0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44619"
FT                   /db_xref="GOA:P9WPD0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPD0"
FT                   /protein_id="AAK44619.1"
FT   gene            462119..463396
FT                   /locus_tag="MT0398"
FT   CDS_pept        462119..463396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0398"
FT                   /product="oxidoreductase, putative"
FT                   /note="identified by similarity to EGAD:34053; match to
FT                   protein family HMM PF00042; match to protein family HMM
FT                   PF00175; match to protein family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:MT0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44620"
FT                   /db_xref="GOA:Q7D9X0"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9X0"
FT                   /protein_id="AAK44620.1"
FT   gene            463479..466757
FT                   /locus_tag="MT0399"
FT   CDS_pept        463479..466757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0399"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by similarity to EGAD:50086; match to
FT                   protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:MT0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44621"
FT                   /db_xref="GOA:Q7D9W9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9W9"
FT                   /protein_id="AAK44621.1"
FT   gene            complement(466761..468092)
FT                   /locus_tag="MT0400"
FT   CDS_pept        complement(466761..468092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0400"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to EGAD:160361; match to
FT                   protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MT0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44622"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR022171"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL9"
FT                   /protein_id="AAK44622.1"
FT   gene            468426..469685
FT                   /gene="purT"
FT                   /locus_tag="MT0401"
FT   CDS_pept        468426..469685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="MT0401"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="2.1.2.-"
FT                   /note="identified by similarity to EGAD:22284; match to
FT                   protein family HMM PF02222; match to protein family HMM
FT                   TIGR01142"
FT                   /db_xref="EnsemblGenomes-Gn:MT0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44623"
FT                   /db_xref="GOA:L7N5Z9"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5Z9"
FT                   /protein_id="AAK44623.1"
FT   gene            469724..470104
FT                   /locus_tag="MT0401.1"
FT   CDS_pept        469724..470104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0401.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0401.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAT90139"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ASF0"
FT                   /protein_id="AAT90139.1"
FT   gene            470101..471321
FT                   /gene="metZ"
FT                   /locus_tag="MT0402"
FT   CDS_pept        470101..471321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="MT0402"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.2.99.-"
FT                   /note="identified by similarity to SP:P55218; match to
FT                   protein family HMM PF01053; match to protein family HMM
FT                   TIGR01325"
FT                   /db_xref="EnsemblGenomes-Gn:MT0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44624"
FT                   /db_xref="GOA:P9WGB4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGB4"
FT                   /protein_id="AAK44624.1"
FT                   DIDRALS"
FT   gene            complement(471318..472730)
FT                   /gene="ndh-1"
FT                   /locus_tag="MT0403"
FT   CDS_pept        complement(471318..472730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh-1"
FT                   /locus_tag="MT0403"
FT                   /product="NADH dehydrogenase"
FT                   /note="identified by similarity to GP:2708705; match to
FT                   protein family HMM PF00070"
FT                   /db_xref="EnsemblGenomes-Gn:MT0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44625"
FT                   /db_xref="GOA:L7N4W5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4W5"
FT                   /protein_id="AAK44625.1"
FT                   EQAEHAEQEAAG"
FT   gene            472872..474197
FT                   /locus_tag="MT0404"
FT   CDS_pept        472872..474197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44626"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:L7N639"
FT                   /protein_id="AAK44626.1"
FT   gene            complement(474213..474932)
FT                   /locus_tag="MT0404.1"
FT   CDS_pept        complement(474213..474932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0404.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0404.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44627"
FT                   /db_xref="GOA:L7N4B1"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4B1"
FT                   /protein_id="AAK44627.1"
FT                   GSAPTGDHPTPHPSTSR"
FT   gene            475031..475435
FT                   /locus_tag="MT0405"
FT   CDS_pept        475031..475435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0405"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44628"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9W3"
FT                   /protein_id="AAK44628.1"
FT   gene            475417..475833
FT                   /locus_tag="MT0406"
FT   CDS_pept        475417..475833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0406"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44629"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9W2"
FT                   /protein_id="AAK44629.1"
FT   gene            complement(475874..476344)
FT                   /locus_tag="MT0407"
FT   CDS_pept        complement(475874..476344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL8"
FT                   /protein_id="AAK44630.1"
FT   gene            476485..476733
FT                   /locus_tag="MT0407.1"
FT   CDS_pept        476485..476733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0407.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0407.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44631"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL7"
FT                   /protein_id="AAK44631.1"
FT   gene            complement(476770..477411)
FT                   /locus_tag="MT0408"
FT   CDS_pept        complement(476770..477411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44632"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5C8"
FT                   /protein_id="AAK44632.1"
FT   gene            complement(477418..478647)
FT                   /locus_tag="MT0409"
FT   CDS_pept        complement(477418..478647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0409"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:MT0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44633"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4X0"
FT                   /protein_id="AAK44633.1"
FT                   NDAPPMPPGR"
FT   gene            complement(478657..479847)
FT                   /locus_tag="MT0410"
FT   CDS_pept        complement(478657..479847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0410"
FT                   /product="glutaryl-CoA dehydrogenase, putative"
FT                   /note="identified by similarity to EGAD:45525; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771"
FT                   /db_xref="EnsemblGenomes-Gn:MT0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44634"
FT                   /db_xref="GOA:Q7D9V9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9V9"
FT                   /protein_id="AAK44634.1"
FT   gene            479880..480251
FT                   /locus_tag="MT0411"
FT   CDS_pept        479880..480251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3129989"
FT                   /db_xref="EnsemblGenomes-Gn:MT0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44635"
FT                   /db_xref="GOA:L7N4Q7"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4Q7"
FT                   /protein_id="AAK44635.1"
FT   gene            complement(480446..483322)
FT                   /locus_tag="MT0412"
FT   CDS_pept        complement(480446..483322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0412"
FT                   /product="membrane protein, MmpL family"
FT                   /note="identified by similarity to EGAD:39019; match to
FT                   protein family HMM PF03176; match to protein family HMM
FT                   TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MT0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44636"
FT                   /db_xref="GOA:P9WJV8"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJV8"
FT                   /protein_id="AAK44636.1"
FT   gene            complement(483432..484316)
FT                   /locus_tag="MT0413"
FT   CDS_pept        complement(483432..484316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0413"
FT                   /product="IS6110, transposase"
FT                   /note="identified by similarity to GP:581365; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MT0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44637"
FT                   /db_xref="GOA:P9WKH8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKH8"
FT                   /protein_id="AAK44637.1"
FT                   AAYYAQRQRPAAG"
FT   gene            complement(484367..484693)
FT                   /locus_tag="MT0414"
FT   CDS_pept        complement(484367..484693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0414"
FT                   /product="IS6110, hypothetical protein"
FT                   /note="identified by similarity to SP:P19772; match to
FT                   protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:MT0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44638"
FT                   /db_xref="GOA:P9WKH4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKH4"
FT                   /protein_id="AAK44638.1"
FT                   RPAR"
FT   gene            complement(484650..485105)
FT                   /locus_tag="MT0415"
FT   CDS_pept        complement(484650..485105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5524339"
FT                   /db_xref="EnsemblGenomes-Gn:MT0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44639"
FT                   /db_xref="GOA:P9WJT4"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJT4"
FT                   /protein_id="AAK44639.1"
FT   gene            complement(485313..485426)
FT                   /locus_tag="MT0416"
FT   CDS_pept        complement(485313..485426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44640"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL6"
FT                   /protein_id="AAK44640.1"
FT   gene            485426..487183
FT                   /locus_tag="MT0417"
FT   CDS_pept        485426..487183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0417"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by similarity to EGAD:154332; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44641"
FT                   /db_xref="GOA:P9WQ56"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ56"
FT                   /protein_id="AAK44641.1"
FT                   KLQRVATFP"
FT   gene            487180..491388
FT                   /locus_tag="MT0418"
FT   CDS_pept        487180..491388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0418"
FT                   /product="polyketide synthase"
FT                   /note="identified by similarity to GP:4678703; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF00550; match to protein family HMM PF00698; match to
FT                   protein family HMM PF00975; match to protein family HMM
FT                   PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:MT0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44642"
FT                   /db_xref="GOA:Q7D9V6"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9V6"
FT                   /protein_id="AAK44642.1"
FT                   "
FT   gene            complement(491336..492094)
FT                   /locus_tag="MT0419"
FT   CDS_pept        complement(491336..492094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0419"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by similarity to GP:5031427; match to
FT                   protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MT0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44643"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9V5"
FT                   /protein_id="AAK44643.1"
FT   gene            492232..493242
FT                   /gene="fgd"
FT                   /locus_tag="MT0420"
FT   CDS_pept        492232..493242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgd"
FT                   /locus_tag="MT0420"
FT                   /product="glucose-6-phosphate dehydrogenase,
FT                   F420-dependent"
FT                   /note="identified by similarity to GP:5031428; match to
FT                   protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MT0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44644"
FT                   /db_xref="GOA:P9WNE0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNE0"
FT                   /protein_id="AAK44644.1"
FT   gene            493235..495307
FT                   /gene="pta"
FT                   /locus_tag="MT0421"
FT   CDS_pept        493235..495307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="MT0421"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:30391; match to
FT                   protein family HMM PF01515; match to protein family HMM
FT                   TIGR00651"
FT                   /db_xref="EnsemblGenomes-Gn:MT0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44645"
FT                   /db_xref="GOA:P9WHP0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHP0"
FT                   /protein_id="AAK44645.1"
FT   gene            495300..496457
FT                   /gene="ackA"
FT                   /locus_tag="MT0422"
FT   CDS_pept        495300..496457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="MT0422"
FT                   /product="acetate kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:17374; match to
FT                   protein family HMM PF00871; match to protein family HMM
FT                   TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:MT0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44646"
FT                   /db_xref="GOA:P9WQH0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQH0"
FT                   /protein_id="AAK44646.1"
FT   gene            complement(496511..498820)
FT                   /locus_tag="MT0423"
FT   CDS_pept        complement(496511..498820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0423"
FT                   /product="serine/threonine protein kinase"
FT                   /note="identified by similarity to GP:4154050; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MT0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44647"
FT                   /db_xref="GOA:P9WI72"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI72"
FT                   /protein_id="AAK44647.1"
FT                   YTLVDMANKVRPTSTF"
FT   gene            complement(498763..499749)
FT                   /locus_tag="MT0424"
FT   CDS_pept        complement(498763..499749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0424"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="identified by similarity to GP:4154051; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:MT0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44648"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:L7N636"
FT                   /protein_id="AAK44648.1"
FT   gene            complement(499749..501068)
FT                   /locus_tag="MT0425"
FT   CDS_pept        complement(499749..501068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4154052"
FT                   /db_xref="EnsemblGenomes-Gn:MT0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44649"
FT                   /db_xref="GOA:Q7D9V2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9V2"
FT                   /protein_id="AAK44649.1"
FT   gene            501162..501815
FT                   /locus_tag="MT0426"
FT   CDS_pept        501162..501815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0426"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by similarity to EGAD:160314; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:MT0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44650"
FT                   /db_xref="GOA:P9WIX8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIX8"
FT                   /protein_id="AAK44650.1"
FT   gene            complement(501799..502467)
FT                   /gene="thiE"
FT                   /locus_tag="MT0427"
FT   CDS_pept        complement(501799..502467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="MT0427"
FT                   /product="thiamin-phosphate pyrophosphorylase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:10927; match to
FT                   protein family HMM PF02581; match to protein family HMM
FT                   TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:MT0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44651"
FT                   /db_xref="GOA:P9WG74"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG74"
FT                   /protein_id="AAK44651.1"
FT                   "
FT   gene            502597..503619
FT                   /locus_tag="MT0428"
FT   CDS_pept        502597..503619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0428"
FT                   /product="amino acid oxidase flavoprotein ThiO, putative"
FT                   /note="identified by similarity to GP:2627327; match to
FT                   protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MT0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44652"
FT                   /db_xref="GOA:L7N4G7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4G7"
FT                   /protein_id="AAK44652.1"
FT                   "
FT   gene            503616..503822
FT                   /locus_tag="MT0429"
FT   CDS_pept        503616..503822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4154055; match to
FT                   protein family HMM PF02597; match to protein family HMM
FT                   TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:MT0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44653"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4D5"
FT                   /protein_id="AAK44653.1"
FT   gene            503815..504573
FT                   /gene="thiG"
FT                   /locus_tag="MT0430"
FT   CDS_pept        503815..504573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="MT0430"
FT                   /product="thiamin biosynthesis protein ThiG"
FT                   /note="identified by similarity to EGAD:19518; match to
FT                   protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:MT0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44654"
FT                   /db_xref="GOA:P9WG72"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG72"
FT                   /protein_id="AAK44654.1"
FT   gene            504595..504747
FT                   /locus_tag="MT0431"
FT   CDS_pept        504595..504747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44655"
FT                   /db_xref="GOA:Q8VKL5"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL5"
FT                   /protein_id="AAK44655.1"
FT                   WAYLA"
FT   gene            504966..506447
FT                   /locus_tag="MT0432"
FT   CDS_pept        504966..506447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0432"
FT                   /product="hydrolase"
FT                   /note="identified by similarity to EGAD:39603; match to
FT                   protein family HMM PF02225; match to protein family HMM
FT                   PF04389"
FT                   /db_xref="EnsemblGenomes-Gn:MT0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44656"
FT                   /db_xref="GOA:Q7D9U8"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9U8"
FT                   /protein_id="AAK44656.1"
FT   gene            506535..508031
FT                   /locus_tag="MT0433"
FT   CDS_pept        506535..508031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0433"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44657"
FT                   /db_xref="GOA:L7N5I7"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5I7"
FT                   /protein_id="AAK44657.1"
FT   gene            complement(508010..508420)
FT                   /locus_tag="MT0434"
FT   CDS_pept        complement(508010..508420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0434"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44658"
FT                   /db_xref="GOA:L7N530"
FT                   /db_xref="UniProtKB/TrEMBL:L7N530"
FT                   /protein_id="AAK44658.1"
FT   gene            complement(508581..509210)
FT                   /locus_tag="MT0435"
FT   CDS_pept        complement(508581..509210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0435"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44659"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:L7N628"
FT                   /protein_id="AAK44659.1"
FT   gene            complement(509207..510004)
FT                   /gene="thiD"
FT                   /locus_tag="MT0436"
FT   CDS_pept        complement(509207..510004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="MT0436"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:90778; match to
FT                   protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:MT0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44660"
FT                   /db_xref="GOA:P9WG76"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG76"
FT                   /protein_id="AAK44660.1"
FT   gene            complement(510031..511680)
FT                   /gene="thiC"
FT                   /locus_tag="MT0437"
FT   CDS_pept        complement(510031..511680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="MT0437"
FT                   /product="thiamin biosynthesis protein ThiC"
FT                   /note="identified by similarity to EGAD:9555; match to
FT                   protein family HMM PF01964; match to protein family HMM
FT                   TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:MT0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44661"
FT                   /db_xref="GOA:P9WG78"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG78"
FT                   /protein_id="AAK44661.1"
FT   gene            complement(511826..512104)
FT                   /locus_tag="MT0438"
FT   CDS_pept        complement(511826..512104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0438"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL4"
FT                   /protein_id="AAK44662.1"
FT   gene            complement(512151..516770)
FT                   /locus_tag="MT0440"
FT   CDS_pept        complement(512151..516770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0440"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by similarity to EGAD:46314; match to
FT                   protein family HMM PF00122; match to protein family HMM
FT                   PF00702; match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:MT0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44663"
FT                   /db_xref="GOA:Q7D9U4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9U4"
FT                   /protein_id="AAK44663.1"
FT   gene            complement(516822..517397)
FT                   /locus_tag="MT0441"
FT   CDS_pept        complement(516822..517397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44664"
FT                   /db_xref="GOA:Q8VKL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL3"
FT                   /protein_id="AAK44664.1"
FT   gene            complement(517466..518341)
FT                   /gene="xth"
FT                   /locus_tag="MT0442"
FT   CDS_pept        complement(517466..518341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="MT0442"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:3367747; match to
FT                   protein family HMM PF03372; match to protein family HMM
FT                   TIGR00195; match to protein family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:MT0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44665"
FT                   /db_xref="GOA:L7N548"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:L7N548"
FT                   /protein_id="AAK44665.1"
FT                   APVLVDLHAG"
FT   gene            complement(518344..519291)
FT                   /locus_tag="MT0443"
FT   CDS_pept        complement(518344..519291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44666"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9U2"
FT                   /protein_id="AAK44666.1"
FT   gene            complement(519252..519845)
FT                   /gene="def"
FT                   /locus_tag="MT0444"
FT   CDS_pept        complement(519252..519845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="MT0444"
FT                   /product="peptide deformylase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:29661; match to
FT                   protein family HMM PF01327; match to protein family HMM
FT                   TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:MT0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44667"
FT                   /db_xref="GOA:P9WIJ2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIJ2"
FT                   /protein_id="AAK44667.1"
FT   gene            519978..520490
FT                   /locus_tag="MT0445"
FT   CDS_pept        519978..520490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44668"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9U1"
FT                   /protein_id="AAK44668.1"
FT                   RLGFEVT"
FT   gene            520522..521016
FT                   /gene="AT103"
FT                   /locus_tag="MT0446"
FT   CDS_pept        520522..521016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AT103"
FT                   /locus_tag="MT0446"
FT                   /product="tuberculin related peptide"
FT                   /note="identified by similarity to EGAD:24367"
FT                   /db_xref="EnsemblGenomes-Gn:MT0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44669"
FT                   /db_xref="GOA:L7N5I0"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5I0"
FT                   /protein_id="AAK44669.1"
FT                   G"
FT   gene            521049..521771
FT                   /gene="sodC"
FT                   /locus_tag="MT0447"
FT   CDS_pept        521049..521771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="MT0447"
FT                   /product="superoxide dismutase"
FT                   /note="identified by similarity to EGAD:8516; match to
FT                   protein family HMM PF00080"
FT                   /db_xref="EnsemblGenomes-Gn:MT0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44670"
FT                   /db_xref="GOA:P9WGE8"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGE8"
FT                   /protein_id="AAK44670.1"
FT                   LTTGDAGKRVACGVIGSG"
FT   gene            521752..522903
FT                   /locus_tag="MT0448"
FT   CDS_pept        521752..522903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:90659; match to
FT                   protein family HMM PF04107"
FT                   /db_xref="EnsemblGenomes-Gn:MT0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44671"
FT                   /db_xref="GOA:P9WPK8"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPK8"
FT                   /protein_id="AAK44671.1"
FT   gene            522960..523616
FT                   /locus_tag="MT0449"
FT   CDS_pept        522960..523616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5596802; match to
FT                   protein family HMM PF02190"
FT                   /db_xref="EnsemblGenomes-Gn:MT0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44672"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9T9"
FT                   /protein_id="AAK44672.1"
FT   gene            complement(523622..523732)
FT                   /locus_tag="MT0450"
FT   CDS_pept        complement(523622..523732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44673"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL2"
FT                   /protein_id="AAK44673.1"
FT   gene            complement(523796..525982)
FT                   /locus_tag="MT0451"
FT   CDS_pept        complement(523796..525982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0451"
FT                   /product="cell division control protein, putative"
FT                   /note="identified by similarity to EGAD:106180; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02359"
FT                   /db_xref="EnsemblGenomes-Gn:MT0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44674"
FT                   /db_xref="GOA:L7N5K4"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5K4"
FT                   /protein_id="AAK44674.1"
FT   gene            complement(525979..526845)
FT                   /gene="pssA"
FT                   /locus_tag="MT0452"
FT   CDS_pept        complement(525979..526845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="MT0452"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:89668; match to
FT                   protein family HMM PF01066; match to protein family HMM
FT                   TIGR00473"
FT                   /db_xref="EnsemblGenomes-Gn:MT0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44675"
FT                   /db_xref="GOA:P9WPG0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPG0"
FT                   /protein_id="AAK44675.1"
FT                   RKPGRRL"
FT   gene            complement(526836..527531)
FT                   /locus_tag="MT0453"
FT   CDS_pept        complement(526836..527531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4154044; match to
FT                   protein family HMM PF02666; match to protein family HMM
FT                   TIGR00164"
FT                   /db_xref="EnsemblGenomes-Gn:MT0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44676"
FT                   /db_xref="GOA:P9WHQ4"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHQ4"
FT                   /protein_id="AAK44676.1"
FT                   GETVLAECR"
FT   gene            complement(527592..528809)
FT                   /gene="moeA-1"
FT                   /locus_tag="MT0454"
FT   CDS_pept        complement(527592..528809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA-1"
FT                   /locus_tag="MT0454"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /note="identified by similarity to EGAD:135894; match to
FT                   protein family HMM PF00994; match to protein family HMM
FT                   PF03453; match to protein family HMM PF03454; match to
FT                   protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:MT0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44677"
FT                   /db_xref="GOA:P9WJQ4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJQ4"
FT                   /protein_id="AAK44677.1"
FT                   QVWDLT"
FT   gene            complement(528828..529844)
FT                   /locus_tag="MT0455"
FT   CDS_pept        complement(528828..529844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0455"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by similarity to EGAD:75852; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MT0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44678"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9T6"
FT                   /protein_id="AAK44678.1"
FT   gene            530057..531679
FT                   /gene="groEL-1"
FT                   /locus_tag="MT0456"
FT   CDS_pept        530057..531679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL-1"
FT                   /locus_tag="MT0456"
FT                   /product="chaperonin, 60 kDa"
FT                   /note="identified by similarity to EGAD:5739; match to
FT                   protein family HMM PF00118"
FT                   /db_xref="EnsemblGenomes-Gn:MT0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44679"
FT                   /db_xref="GOA:P9WPE6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPE6"
FT                   /protein_id="AAK44679.1"
FT   gene            complement(531745..532173)
FT                   /locus_tag="MT0457"
FT   CDS_pept        complement(531745..532173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44680"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKW2"
FT                   /protein_id="AAK44680.1"
FT   gene            complement(532200..533663)
FT                   /locus_tag="MT0458"
FT   CDS_pept        complement(532200..533663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0458"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to SP:P42611; match to
FT                   protein family HMM PF00823; match to protein family HMM
FT                   PF01469"
FT                   /db_xref="EnsemblGenomes-Gn:MT0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44681"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI40"
FT                   /protein_id="AAK44681.1"
FT   gene            533803..534360
FT                   /locus_tag="MT0459"
FT   CDS_pept        533803..534360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4835326"
FT                   /db_xref="EnsemblGenomes-Gn:MT0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44682"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9T5"
FT                   /protein_id="AAK44682.1"
FT   gene            complement(534540..535238)
FT                   /locus_tag="MT0460"
FT   CDS_pept        complement(534540..535238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5531432"
FT                   /db_xref="EnsemblGenomes-Gn:MT0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44683"
FT                   /db_xref="GOA:P9WGX4"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGX4"
FT                   /protein_id="AAK44683.1"
FT                   GTILAELPLG"
FT   gene            complement(535282..535845)
FT                   /locus_tag="MT0461"
FT   CDS_pept        complement(535282..535845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0461"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by similarity to GP:5531433; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:MT0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44684"
FT                   /db_xref="GOA:P9WGH6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGH6"
FT                   /protein_id="AAK44684.1"
FT   gene            complement(535894..536703)
FT                   /locus_tag="MT0462"
FT   CDS_pept        complement(535894..536703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2815312"
FT                   /db_xref="EnsemblGenomes-Gn:MT0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44685"
FT                   /db_xref="GOA:Q7D9T2"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9T2"
FT                   /protein_id="AAK44685.1"
FT   gene            complement(536673..538121)
FT                   /gene="cfa-1"
FT                   /locus_tag="MT0463"
FT   CDS_pept        complement(536673..538121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa-1"
FT                   /locus_tag="MT0463"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:21564; match to
FT                   protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:MT0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44686"
FT                   /db_xref="GOA:Q7D9T1"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9T1"
FT                   /protein_id="AAK44686.1"
FT   gene            complement(537953..538684)
FT                   /locus_tag="MT0464"
FT   CDS_pept        complement(537953..538684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:132661"
FT                   /db_xref="EnsemblGenomes-Gn:MT0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44687"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9T0"
FT                   /protein_id="AAK44687.1"
FT   gene            complement(538678..539997)
FT                   /locus_tag="MT0465"
FT   CDS_pept        complement(538678..539997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0465"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44688"
FT                   /db_xref="GOA:L7N4S7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4S7"
FT                   /protein_id="AAK44688.1"
FT   gene            complement(540037..542940)
FT                   /locus_tag="MT0466"
FT   CDS_pept        complement(540037..542940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0466"
FT                   /product="membrane protein, MmpL family"
FT                   /note="identified by similarity to EGAD:39019; match to
FT                   protein family HMM PF03176; match to protein family HMM
FT                   TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MT0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44689"
FT                   /db_xref="GOA:P9WJV2"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJV2"
FT                   /protein_id="AAK44689.2"
FT   gene            complement(542937..543359)
FT                   /locus_tag="MT0467"
FT   CDS_pept        complement(542937..543359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:35271; match to
FT                   protein family HMM PF05423"
FT                   /db_xref="EnsemblGenomes-Gn:MT0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44690"
FT                   /db_xref="GOA:P9WJS8"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJS8"
FT                   /protein_id="AAK44690.1"
FT   gene            543540..544301
FT                   /locus_tag="MT0468"
FT   CDS_pept        543540..544301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2815319; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44691"
FT                   /db_xref="GOA:Q7D9S8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041483"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9S8"
FT                   /protein_id="AAK44691.1"
FT   gene            544623..546179
FT                   /locus_tag="MT0469"
FT   CDS_pept        544623..546179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0469"
FT                   /product="PPE family protein"
FT                   /note="identified by similarity to EGAD:160385; match to
FT                   protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MT0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44692"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI38"
FT                   /protein_id="AAK44692.1"
FT                   D"
FT   gene            complement(546185..546739)
FT                   /locus_tag="MT0470"
FT   CDS_pept        complement(546185..546739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL1"
FT                   /protein_id="AAK44693.1"
FT   gene            complement(546824..547351)
FT                   /locus_tag="MT0471"
FT   CDS_pept        complement(546824..547351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0471"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44694"
FT                   /db_xref="InterPro:IPR031702"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9S6"
FT                   /protein_id="AAK44694.1"
FT                   YPAGDMSVWNWA"
FT   gene            complement(547338..548252)
FT                   /locus_tag="MT0472"
FT   CDS_pept        complement(547338..548252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0472"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by similarity to EGAD:104828; match to
FT                   protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MT0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44695"
FT                   /db_xref="GOA:L7N536"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:L7N536"
FT                   /protein_id="AAK44695.1"
FT   gene            548472..548942
FT                   /locus_tag="MT0472.1"
FT   CDS_pept        548472..548942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0472.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0472.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44696"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKL0"
FT                   /protein_id="AAK44696.1"
FT   gene            complement(549035..551056)
FT                   /locus_tag="MT0473"
FT   CDS_pept        complement(549035..551056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0473"
FT                   /product="prolyl oligopeptidase family protein"
FT                   /note="identified by similarity to EGAD:97287; match to
FT                   protein family HMM PF00326; match to protein family HMM
FT                   PF02897"
FT                   /db_xref="EnsemblGenomes-Gn:MT0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44697"
FT                   /db_xref="GOA:Q7D9S4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9S4"
FT                   /protein_id="AAK44697.1"
FT   gene            551124..552647
FT                   /locus_tag="MT0474"
FT   CDS_pept        551124..552647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0474"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by similarity to EGAD:30222; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MT0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44698"
FT                   /db_xref="GOA:P9WNY0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNY0"
FT                   /protein_id="AAK44698.1"
FT   gene            552647..553138
FT                   /locus_tag="MT0475"
FT   CDS_pept        552647..553138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:20407; match to
FT                   protein family HMM PF05610"
FT                   /db_xref="EnsemblGenomes-Gn:MT0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44699"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4E8"
FT                   /protein_id="AAK44699.1"
FT                   "
FT   gene            553159..553437
FT                   /locus_tag="MT0476"
FT   CDS_pept        553159..553437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:35286"
FT                   /db_xref="EnsemblGenomes-Gn:MT0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44700"
FT                   /db_xref="GOA:Q7D9S2"
FT                   /db_xref="InterPro:IPR031614"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9S2"
FT                   /protein_id="AAK44700.1"
FT   gene            553397..553999
FT                   /locus_tag="MT0477"
FT   CDS_pept        553397..553999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44701"
FT                   /db_xref="GOA:Q7D9S1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9S1"
FT                   /protein_id="AAK44701.1"
FT   gene            554063..555457
FT                   /gene="lpdA-1"
FT                   /locus_tag="MT0478"
FT   CDS_pept        554063..555457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA-1"
FT                   /locus_tag="MT0478"
FT                   /product="alpha keto acid dehydrogenase complex, E3
FT                   component, lipoamide dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:39022; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF02852; match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:MT0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44702"
FT                   /db_xref="GOA:P9WHH8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHH8"
FT                   /protein_id="AAK44702.1"
FT                   GHMINF"
FT   gene            555465..555758
FT                   /locus_tag="MT0479"
FT   CDS_pept        555465..555758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:35279"
FT                   /db_xref="EnsemblGenomes-Gn:MT0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44703"
FT                   /db_xref="GOA:L7N522"
FT                   /db_xref="UniProtKB/TrEMBL:L7N522"
FT                   /protein_id="AAK44703.1"
FT   gene            complement(555762..556334)
FT                   /locus_tag="MT0480"
FT   CDS_pept        complement(555762..556334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0480"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44704"
FT                   /db_xref="GOA:L7N635"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:L7N635"
FT                   /protein_id="AAK44704.1"
FT   gene            complement(556331..557755)
FT                   /locus_tag="MT0481"
FT   CDS_pept        complement(556331..557755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0481"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MT0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44705"
FT                   /db_xref="GOA:P9WMI0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMI0"
FT                   /protein_id="AAK44705.1"
FT                   LDEHRSTVSPYLVKQL"
FT   gene            557907..558701
FT                   /locus_tag="MT0482"
FT   CDS_pept        557907..558701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44706"
FT                   /db_xref="GOA:L7N4C8"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4C8"
FT                   /protein_id="AAK44706.1"
FT   gene            558976..560262
FT                   /gene="aceA-1"
FT                   /locus_tag="MT0483"
FT   CDS_pept        558976..560262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceA-1"
FT                   /locus_tag="MT0483"
FT                   /product="isocitrate lyase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P41554; match to
FT                   protein family HMM PF00463; match to protein family HMM
FT                   TIGR01346"
FT                   /db_xref="EnsemblGenomes-Gn:MT0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44707"
FT                   /db_xref="GOA:P9WKK6"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKK6"
FT                   /protein_id="AAK44707.1"
FT   gene            560344..561204
FT                   /locus_tag="MT0484"
FT   CDS_pept        560344..561204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0484"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase family protein"
FT                   /note="identified by similarity to EGAD:41319; match to
FT                   protein family HMM PF00725; match to protein family HMM
FT                   PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:MT0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44708"
FT                   /db_xref="GOA:P9WNP6"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNP6"
FT                   /protein_id="AAK44708.1"
FT                   GFYTY"
FT   gene            561319..562196
FT                   /pseudo
FT                   /locus_tag="MT0485"
FT                   /note="mycolic acid synthase, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error;identified by similarity to EGAD:137729"
FT   gene            complement(562296..563159)
FT                   /gene="cmaC"
FT                   /locus_tag="MT0486"
FT   CDS_pept        complement(562296..563159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmaC"
FT                   /locus_tag="MT0486"
FT                   /product="mycolic acid synthase"
FT                   /note="identified by similarity to EGAD:136767; match to
FT                   protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:MT0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44709"
FT                   /db_xref="GOA:P9WPB2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPB2"
FT                   /protein_id="AAK44709.1"
FT                   QFTLEK"
FT   gene            complement(563302..563742)
FT                   /locus_tag="MT0487"
FT   CDS_pept        complement(563302..563742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0487"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44710"
FT                   /db_xref="GOA:Q8VKK9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKK9"
FT                   /protein_id="AAK44710.1"
FT   gene            complement(563673..564161)
FT                   /locus_tag="MT0488"
FT   CDS_pept        complement(563673..564161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44711"
FT                   /db_xref="UniProtKB/TrEMBL:L7N589"
FT                   /protein_id="AAK44711.1"
FT   gene            complement(564171..564941)
FT                   /locus_tag="MT0489"
FT   CDS_pept        complement(564171..564941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0489"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:3063879; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MT0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44712"
FT                   /db_xref="GOA:P9WMD8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMD8"
FT                   /protein_id="AAK44712.1"
FT   gene            565156..566382
FT                   /locus_tag="MT0490"
FT   CDS_pept        565156..566382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:18506; match to
FT                   protein family HMM PF04286"
FT                   /db_xref="EnsemblGenomes-Gn:MT0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44713"
FT                   /db_xref="GOA:Q7D9R2"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9R2"
FT                   /protein_id="AAK44713.1"
FT                   IYAIAQLLF"
FT   gene            566469..566891
FT                   /locus_tag="MT0491"
FT   CDS_pept        566469..566891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0491"
FT                   /product="transcriptional regulator, PbsX family"
FT                   /note="identified by similarity to EGAD:19777; match to
FT                   protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MT0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44714"
FT                   /db_xref="GOA:P9WMH8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMH8"
FT                   /protein_id="AAK44714.1"
FT   gene            complement(566930..567067)
FT                   /locus_tag="MT0492"
FT   CDS_pept        complement(566930..567067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44715"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKK8"
FT                   /protein_id="AAK44715.1"
FT                   "
FT   gene            567230..567844
FT                   /locus_tag="MT0493"
FT   CDS_pept        567230..567844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:164850"
FT                   /db_xref="EnsemblGenomes-Gn:MT0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44716"
FT                   /db_xref="GOA:P9WIP8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIP8"
FT                   /protein_id="AAK44716.1"
FT   gene            complement(567857..568009)
FT                   /locus_tag="MT0494"
FT   CDS_pept        complement(567857..568009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44717"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKK7"
FT                   /protein_id="AAK44717.1"
FT                   TRSRW"
FT   gene            568125..568670
FT                   /locus_tag="MT0495"
FT   CDS_pept        568125..568670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0495"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44718"
FT                   /db_xref="InterPro:IPR019719"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKV8"
FT                   /protein_id="AAK44718.1"
FT                   DSEMLASGCNPGSPEESF"
FT   gene            568670..569344
FT                   /gene="deoC"
FT                   /locus_tag="MT0496"
FT   CDS_pept        568670..569344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="MT0496"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:30357; match to
FT                   protein family HMM PF01791; match to protein family HMM
FT                   TIGR00126"
FT                   /db_xref="EnsemblGenomes-Gn:MT0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44719"
FT                   /db_xref="GOA:P9WP02"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP02"
FT                   /protein_id="AAK44719.1"
FT                   LS"
FT   gene            complement(569369..570415)
FT                   /locus_tag="MT0497"
FT   CDS_pept        complement(569369..570415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44720"
FT                   /db_xref="GOA:P9WKV6"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKV6"
FT                   /protein_id="AAK44720.1"
FT                   QNPCFSHI"
FT   gene            complement(570412..571434)
FT                   /locus_tag="MT0498"
FT   CDS_pept        complement(570412..571434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0498"
FT                   /product="carbon-nitrogen hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:MT0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44721"
FT                   /db_xref="GOA:P9WJ00"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ00"
FT                   /protein_id="AAK44721.1"
FT                   "
FT   gene            complement(571436..571960)
FT                   /locus_tag="MT0499"
FT   CDS_pept        complement(571436..571960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44722"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKV4"
FT                   /protein_id="AAK44722.1"
FT                   RFTTLWITNNV"
FT   gene            571987..573096
FT                   /gene="murB"
FT                   /locus_tag="MT0500"
FT   CDS_pept        571987..573096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="MT0500"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:28912; match to
FT                   protein family HMM PF01565; match to protein family HMM
FT                   PF02873; match to protein family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:MT0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44723"
FT                   /db_xref="GOA:P9WJL8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJL8"
FT                   /protein_id="AAK44723.1"
FT   gene            573158..574513
FT                   /locus_tag="MT0501"
FT   CDS_pept        573158..574513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:132223; match to
FT                   protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:MT0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44724"
FT                   /db_xref="GOA:P9WKV2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="PDB:4ZFQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKV2"
FT                   /protein_id="AAK44724.1"
FT   gene            complement(574494..575249)
FT                   /locus_tag="MT0502"
FT   CDS_pept        complement(574494..575249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0502"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by similarity to EGAD:151906; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MT0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44725"
FT                   /db_xref="GOA:P9WGR4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGR4"
FT                   /protein_id="AAK44725.1"
FT   gene            575432..576748
FT                   /locus_tag="MT0503"
FT   CDS_pept        575432..576748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0503"
FT                   /product="NagC-related protein"
FT                   /note="identified by similarity to GP:2541902; match to
FT                   protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:MT0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44726"
FT                   /db_xref="GOA:P9WKV0"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKV0"
FT                   /protein_id="AAK44726.1"
FT   gene            576796..578238
FT                   /locus_tag="MT0504"
FT   CDS_pept        576796..578238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0504"
FT                   /product="glycosyl transferase"
FT                   /note="identified by similarity to GP:4455730; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MT0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44727"
FT                   /db_xref="GOA:P9WMY6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMY6"
FT                   /protein_id="AAK44727.1"
FT   gene            578235..578786
FT                   /locus_tag="MT0505"
FT   CDS_pept        578235..578786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:21593"
FT                   /db_xref="EnsemblGenomes-Gn:MT0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44728"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKU8"
FT                   /protein_id="AAK44728.1"
FT   gene            578896..579003
FT                   /locus_tag="MT0506"
FT   CDS_pept        578896..579003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKK6"
FT                   /protein_id="AAK44729.1"
FT   gene            579054..579659
FT                   /locus_tag="MT0507"
FT   CDS_pept        579054..579659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0507"
FT                   /product="transporter, LysE/YggA family"
FT                   /note="identified by similarity to EGAD:149911; match to
FT                   protein family HMM PF01810; match to protein family HMM
FT                   TIGR00948"
FT                   /db_xref="EnsemblGenomes-Gn:MT0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44730"
FT                   /db_xref="GOA:P9WK32"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WK32"
FT                   /protein_id="AAK44730.1"
FT   gene            579816..580565
FT                   /gene="gpm"
FT                   /locus_tag="MT0508"
FT   CDS_pept        579816..580565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm"
FT                   /locus_tag="MT0508"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by similarity to EGAD:19642; match to
FT                   protein family HMM PF00300; match to protein family HMM
FT                   TIGR01258"
FT                   /db_xref="EnsemblGenomes-Gn:MT0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44731"
FT                   /db_xref="GOA:P9WIC8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIC8"
FT                   /protein_id="AAK44731.1"
FT   gene            580739..581971
FT                   /gene="senX3"
FT                   /locus_tag="MT0509"
FT   CDS_pept        580739..581971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="senX3"
FT                   /locus_tag="MT0509"
FT                   /product="sensor histidine kinase SenX3"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to EGAD:152934; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MT0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44732"
FT                   /db_xref="GOA:P9WGK4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGK4"
FT                   /protein_id="AAK44732.1"
FT                   NRSQREEELSR"
FT   gene            582167..582859
FT                   /gene="regX3"
FT                   /locus_tag="MT0510"
FT   CDS_pept        582167..582859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regX3"
FT                   /locus_tag="MT0510"
FT                   /product="DNA-binding response regulator RegX3"
FT                   /note="identified by similarity to EGAD:152483; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:MT0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44733"
FT                   /db_xref="GOA:P9WGL8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGL8"
FT                   /protein_id="AAK44733.1"
FT                   GLGYKLEG"
FT   gene            complement(582856..584298)
FT                   /locus_tag="MT0511"
FT   CDS_pept        complement(582856..584298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0511"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by similarity to EGAD:97292"
FT                   /db_xref="EnsemblGenomes-Gn:MT0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44734"
FT                   /db_xref="GOA:P9WMV6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMV6"
FT                   /protein_id="AAK44734.1"
FT   gene            complement(584234..584911)
FT                   /locus_tag="MT0512"
FT   CDS_pept        complement(584234..584911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0512"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44735"
FT                   /db_xref="GOA:P9WMV6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMV6"
FT                   /protein_id="AAK44735.1"
FT                   GRP"
FT   gene            complement(585069..586058)
FT                   /locus_tag="MT0513"
FT   CDS_pept        complement(585069..586058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKU6"
FT                   /protein_id="AAK44736.1"
FT   gene            586063..586791
FT                   /locus_tag="MT0514"
FT   CDS_pept        586063..586791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0514"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by similarity to EGAD:37331; match to
FT                   protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:MT0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44737"
FT                   /db_xref="GOA:P9WMG6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMG6"
FT                   /protein_id="AAK44737.1"
FT   gene            complement(586792..587682)
FT                   /locus_tag="MT0515"
FT   CDS_pept        complement(586792..587682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:38875"
FT                   /db_xref="EnsemblGenomes-Gn:MT0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44738"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKU4"
FT                   /protein_id="AAK44738.1"
FT                   QLGLIAVHPATRAAQ"
FT   gene            587714..588748
FT                   /locus_tag="MT0516"
FT   CDS_pept        587714..588748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4803694; match to
FT                   protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:MT0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44739"
FT                   /db_xref="GOA:P9WHV4"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHV4"
FT                   /protein_id="AAK44739.1"
FT                   GSKP"
FT   gene            588745..589677
FT                   /locus_tag="MT0517"
FT   CDS_pept        588745..589677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:24128"
FT                   /db_xref="EnsemblGenomes-Gn:MT0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44740"
FT                   /db_xref="GOA:P9WKU2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKU2"
FT                   /protein_id="AAK44740.1"
FT   gene            589693..590535
FT                   /locus_tag="MT0518"
FT   CDS_pept        589693..590535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:23111; match to
FT                   protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:MT0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44741"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKU0"
FT                   /protein_id="AAK44741.1"
FT   gene            590551..591426
FT                   /locus_tag="MT0519"
FT   CDS_pept        590551..591426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0519"
FT                   /product="diacylglycerol kinase catalytic domain-containing
FT                   protein"
FT                   /note="identified by similarity to GP:3402249; match to
FT                   protein family HMM PF00781"
FT                   /db_xref="EnsemblGenomes-Gn:MT0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44742"
FT                   /db_xref="GOA:P9WKT8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKT8"
FT                   /protein_id="AAK44742.1"
FT                   TRQLAMVPAQ"
FT   gene            591451..592338
FT                   /gene="proC"
FT                   /locus_tag="MT0520"
FT   CDS_pept        591451..592338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="MT0520"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:17913; match to
FT                   protein family HMM PF01089; match to protein family HMM
FT                   TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:MT0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44743"
FT                   /db_xref="GOA:P9WHU6"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHU6"
FT                   /protein_id="AAK44743.1"
FT                   AAKSRSEQLRITPE"
FT   gene            592479..592715
FT                   /locus_tag="MT0521"
FT   CDS_pept        592479..592715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0521"
FT                   /product="excisionase, putative"
FT                   /note="identified by similarity to EGAD:22602; match to
FT                   protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:MT0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44744"
FT                   /db_xref="GOA:P9WKT6"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKT6"
FT                   /protein_id="AAK44744.1"
FT   gene            593022..594152
FT                   /locus_tag="MT0522"
FT   CDS_pept        593022..594152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0522"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by similarity to GP:5123671"
FT                   /db_xref="EnsemblGenomes-Gn:MT0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44745"
FT                   /db_xref="GOA:P9WKT2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKT2"
FT                   /protein_id="AAK44745.1"
FT   gene            594159..595235
FT                   /locus_tag="MT0523"
FT   CDS_pept        594159..595235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0523"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MT0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44746"
FT                   /db_xref="GOA:P9WKT0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKT0"
FT                   /protein_id="AAK44746.1"
FT                   IQQTLYRLLAGRRNIFFG"
FT   gene            complement(595239..596207)
FT                   /gene="cma2"
FT                   /locus_tag="MT0524"
FT   CDS_pept        complement(595239..596207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cma2"
FT                   /locus_tag="MT0524"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase 2"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:38761; match to
FT                   protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:MT0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44747"
FT                   /db_xref="GOA:P9WPB4"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPB4"
FT                   /protein_id="AAK44747.1"
FT   gene            596107..596703
FT                   /locus_tag="MT0525"
FT   CDS_pept        596107..596703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44748"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKK4"
FT                   /protein_id="AAK44748.1"
FT   gene            complement(596831..597757)
FT                   /locus_tag="MT0526"
FT   CDS_pept        complement(596831..597757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0526"
FT                   /product="SerB family protein"
FT                   /note="identified by similarity to EGAD:13641; match to
FT                   protein family HMM PF00702; match to protein family HMM
FT                   TIGR01488; match to protein family HMM TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:MT0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44749"
FT                   /db_xref="GOA:P9WGJ2"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGJ2"
FT                   /protein_id="AAK44749.1"
FT   gene            598132..598569
FT                   /locus_tag="MT0527"
FT   CDS_pept        598132..598569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:35271; match to
FT                   protein family HMM PF05423"
FT                   /db_xref="EnsemblGenomes-Gn:MT0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44750"
FT                   /db_xref="GOA:P9WJT2"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJT2"
FT                   /protein_id="AAK44750.1"
FT   gene            598566..601472
FT                   /locus_tag="MT0528"
FT   CDS_pept        598566..601472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0528"
FT                   /product="membrane protein, MmpL family"
FT                   /note="identified by similarity to EGAD:39019; match to
FT                   protein family HMM PF03176; match to protein family HMM
FT                   TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MT0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44751"
FT                   /db_xref="GOA:P9WJV6"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJV6"
FT                   /protein_id="AAK44751.1"
FT   gene            601465..601758
FT                   /locus_tag="MT0529"
FT   CDS_pept        601465..601758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5123666"
FT                   /db_xref="EnsemblGenomes-Gn:MT0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44752"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKS8"
FT                   /protein_id="AAK44752.1"
FT   gene            601727..603214
FT                   /gene="hemA"
FT                   /locus_tag="MT0530"
FT   CDS_pept        601727..603214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="MT0530"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by similarity to EGAD:24728; match to
FT                   protein family HMM PF00745; match to protein family HMM
FT                   PF05200; match to protein family HMM PF05201; match to
FT                   protein family HMM TIGR01035"
FT                   /db_xref="EnsemblGenomes-Gn:MT0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44753"
FT                   /db_xref="GOA:P9WMP6"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMP6"
FT                   /protein_id="AAK44753.1"
FT   gene            603215..604153
FT                   /gene="hemC"
FT                   /locus_tag="MT0531"
FT   CDS_pept        603215..604153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="MT0531"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:15661; match to
FT                   protein family HMM PF01379; match to protein family HMM
FT                   PF03900; match to protein family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:MT0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44754"
FT                   /db_xref="GOA:P9WMP2"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMP2"
FT                   /protein_id="AAK44754.1"
FT   gene            604177..605883
FT                   /locus_tag="MT0532"
FT   CDS_pept        604177..605883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0532"
FT                   /product="uroporphyrin-III
FT                   C-methyltransferase/uroporphyrinogen-III synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:14346; match to
FT                   protein family HMM PF00590; match to protein family HMM
FT                   PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:MT0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44755"
FT                   /db_xref="GOA:Q7D9R0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9R0"
FT                   /protein_id="AAK44755.1"
FT   gene            605969..606958
FT                   /gene="hemB"
FT                   /locus_tag="MT0533"
FT   CDS_pept        605969..606958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="MT0533"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:24833; match to
FT                   protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:MT0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44756"
FT                   /db_xref="GOA:P9WMP4"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMP4"
FT                   /protein_id="AAK44756.1"
FT   gene            606971..607519
FT                   /locus_tag="MT0534"
FT   CDS_pept        606971..607519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:21827"
FT                   /db_xref="EnsemblGenomes-Gn:MT0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44757"
FT                   /db_xref="GOA:L7N604"
FT                   /db_xref="InterPro:IPR016844"
FT                   /db_xref="UniProtKB/TrEMBL:L7N604"
FT                   /protein_id="AAK44757.1"
FT   gene            607516..607815
FT                   /locus_tag="MT0535"
FT   CDS_pept        607516..607815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44758"
FT                   /db_xref="GOA:L7N4H7"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4H7"
FT                   /protein_id="AAK44758.1"
FT   gene            607825..609429
FT                   /locus_tag="MT0536"
FT   CDS_pept        607825..609429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44759"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Q7"
FT                   /protein_id="AAK44759.1"
FT                   TDTHGPPPDHNDDPPPF"
FT   gene            complement(609426..609905)
FT                   /locus_tag="MT0537"
FT   CDS_pept        complement(609426..609905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0537"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44760"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Q6"
FT                   /protein_id="AAK44760.1"
FT   gene            610191..611423
FT                   /locus_tag="MT0538"
FT   CDS_pept        610191..611423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0538"
FT                   /product="acyltransferase, putative"
FT                   /note="identified by similarity to EGAD:19187; match to
FT                   protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:MT0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44761"
FT                   /db_xref="GOA:Q7D9Q5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Q5"
FT                   /protein_id="AAK44761.1"
FT                   DALEGVSARAV"
FT   gene            611555..612250
FT                   /locus_tag="MT0539"
FT   CDS_pept        611555..612250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44762"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:L7N573"
FT                   /protein_id="AAK44762.1"
FT                   PLISMELVG"
FT   gene            complement(612302..612418)
FT                   /locus_tag="MT0540"
FT   CDS_pept        complement(612302..612418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0540"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKK3"
FT                   /protein_id="AAK44763.1"
FT   gene            complement(612539..613441)
FT                   /locus_tag="MT0541"
FT   CDS_pept        complement(612539..613441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44764"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5N9"
FT                   /protein_id="AAK44764.1"
FT   gene            613622..613972
FT                   /locus_tag="MT0542"
FT   CDS_pept        613622..613972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0542"
FT                   /product="methyltransferase-related protein"
FT                   /note="identified by similarity to GP:2792343"
FT                   /db_xref="EnsemblGenomes-Gn:MT0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44765"
FT                   /db_xref="GOA:L7N5V4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5V4"
FT                   /protein_id="AAK44765.1"
FT                   NLRDLGSMRFYA"
FT   gene            613965..614270
FT                   /locus_tag="MT0543"
FT   CDS_pept        613965..614270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44766"
FT                   /db_xref="InterPro:IPR023143"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKK2"
FT                   /protein_id="AAK44766.1"
FT   gene            614405..615709
FT                   /locus_tag="MT0544"
FT   CDS_pept        614405..615709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0544"
FT                   /product="amino acid permease"
FT                   /note="identified by similarity to EGAD:30208; match to
FT                   protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MT0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44767"
FT                   /db_xref="GOA:Q8VKK1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKK1"
FT                   /protein_id="AAK44767.1"
FT   gene            complement(615693..616097)
FT                   /locus_tag="MT0545"
FT   CDS_pept        complement(615693..616097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44768"
FT                   /db_xref="GOA:Q7D9Q1"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9Q1"
FT                   /protein_id="AAK44768.1"
FT   gene            616202..617590
FT                   /gene="hemL"
FT                   /locus_tag="MT0546"
FT   CDS_pept        616202..617590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="MT0546"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:23999; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:MT0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44769"
FT                   /db_xref="GOA:P9WMN8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMN8"
FT                   /protein_id="AAK44769.1"
FT                   ERPA"
FT   gene            617590..618198
FT                   /locus_tag="MT0547"
FT   CDS_pept        617590..618198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0547"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:MT0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44770"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VKK0"
FT                   /protein_id="AAK44770.1"
FT   gene            618213..618863
FT                   /locus_tag="MT0548"
FT   CDS_pept        618213..618863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:19684"
FT                   /db_xref="EnsemblGenomes-Gn:MT0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44771"
FT                   /db_xref="GOA:L7N507"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:L7N507"
FT                   /protein_id="AAK44771.1"
FT   gene            618860..619639
FT                   /locus_tag="MT0549"
FT   CDS_pept        618860..619639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0549"
FT                   /product="cytochrome c biogenesis protein, putative"
FT                   /note="identified by similarity to EGAD:90374; match to
FT                   protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:MT0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44772"
FT                   /db_xref="GOA:Q7D9P9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9P9"
FT                   /protein_id="AAK44772.1"
FT   gene            619672..621261
FT                   /locus_tag="MT0550"
FT   CDS_pept        619672..621261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:23675; match to
FT                   protein family HMM PF05140"
FT                   /db_xref="EnsemblGenomes-Gn:MT0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44773"
FT                   /db_xref="GOA:Q7D9P8"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9P8"
FT                   /protein_id="AAK44773.1"
FT                   AEAAAGTGRDVD"
FT   gene            621258..622232
FT                   /locus_tag="MT0551"
FT   CDS_pept        621258..622232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0551"
FT                   /product="cytochrome c assembly family protein"
FT                   /note="identified by match to protein family HMM PF01578"
FT                   /db_xref="EnsemblGenomes-Gn:MT0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44774"
FT                   /db_xref="GOA:L7N637"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:L7N637"
FT                   /protein_id="AAK44774.1"
FT   gene            622274..623491
FT                   /locus_tag="MT0552"
FT   CDS_pept        622274..623491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:132749"
FT                   /db_xref="EnsemblGenomes-Gn:MT0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44775"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ9"
FT                   /protein_id="AAK44775.1"
FT                   CKPSFT"
FT   gene            complement(623488..623649)
FT                   /locus_tag="MT0553"
FT   CDS_pept        complement(623488..623649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44776"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ8"
FT                   /protein_id="AAK44776.1"
FT                   GHGDNNRS"
FT   gene            623696..624013
FT                   /locus_tag="MT0554"
FT   CDS_pept        623696..624013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:129296"
FT                   /db_xref="EnsemblGenomes-Gn:MT0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44777"
FT                   /db_xref="GOA:L7N571"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:L7N571"
FT                   /protein_id="AAK44777.1"
FT                   Q"
FT   gene            623985..624167
FT                   /locus_tag="MT0555"
FT   CDS_pept        623985..624167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0555"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44778"
FT                   /db_xref="GOA:Q8VKJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ7"
FT                   /protein_id="AAK44778.1"
FT                   TLAAPGVGCGKVCDV"
FT   gene            624160..626028
FT                   /locus_tag="MT0556"
FT   CDS_pept        624160..626028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0556"
FT                   /product="PE_PGRS family protein"
FT                   /note="identified by similarity to EGAD:160916; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44779"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ6"
FT                   /protein_id="AAK44779.1"
FT   gene            complement(625924..626931)
FT                   /gene="fabH"
FT                   /locus_tag="MT0557"
FT   CDS_pept        complement(625924..626931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="MT0557"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:39782; match to
FT                   protein family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:MT0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44780"
FT                   /db_xref="GOA:P9WNG2"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNG2"
FT                   /protein_id="AAK44780.1"
FT   gene            complement(627013..627891)
FT                   /gene="menA"
FT                   /locus_tag="MT0558"
FT   CDS_pept        complement(627013..627891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="MT0558"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by similarity to EGAD:129297; match to
FT                   protein family HMM PF01040; match to protein family HMM
FT                   TIGR00751"
FT                   /db_xref="EnsemblGenomes-Gn:MT0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44781"
FT                   /db_xref="GOA:P9WIP2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIP2"
FT                   /protein_id="AAK44781.1"
FT                   VAGALAFGQLS"
FT   gene            627926..628702
FT                   /gene="mtaP"
FT                   /locus_tag="MT0559"
FT   CDS_pept        627926..628702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaP"
FT                   /locus_tag="MT0559"
FT                   /product="5'-methylthioadenosine phosphorylase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:26390; match to
FT                   protein family HMM PF00896; match to protein family HMM
FT                   TIGR01694"
FT                   /db_xref="EnsemblGenomes-Gn:MT0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44782"
FT                   /db_xref="GOA:Q7D9P5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9P5"
FT                   /protein_id="AAK44782.1"
FT   gene            628699..629739
FT                   /locus_tag="MT0560"
FT   CDS_pept        628699..629739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0560"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by similarity to GP:5524312; match to
FT                   protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MT0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44783"
FT                   /db_xref="GOA:Q7D9P4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9P4"
FT                   /protein_id="AAK44783.1"
FT                   AFAPLR"
FT   gene            complement(629749..631182)
FT                   /locus_tag="MT0562"
FT   CDS_pept        complement(629749..631182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0562"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44784"
FT                   /db_xref="GOA:L7N5S3"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5S3"
FT                   /protein_id="AAK44784.1"
FT   gene            631491..633137
FT                   /locus_tag="MT0563"
FT   CDS_pept        631491..633137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2271518"
FT                   /db_xref="EnsemblGenomes-Gn:MT0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44785"
FT                   /db_xref="GOA:Q7D9P2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9P2"
FT                   /protein_id="AAK44785.1"
FT   gene            633170..633826
FT                   /locus_tag="MT0564"
FT   CDS_pept        633170..633826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0564"
FT                   /product="glycosyl transferase"
FT                   /note="identified by similarity to GP:2271519; match to
FT                   protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MT0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44786"
FT                   /db_xref="GOA:P9WMY0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMY0"
FT                   /protein_id="AAK44786.1"
FT   gene            633850..634485
FT                   /locus_tag="MT0565"
FT   CDS_pept        633850..634485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:7211010; match to
FT                   protein family HMM PF05143"
FT                   /db_xref="EnsemblGenomes-Gn:MT0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44787"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ5"
FT                   /protein_id="AAK44787.1"
FT   gene            complement(634375..635856)
FT                   /locus_tag="MT0566"
FT   CDS_pept        complement(634375..635856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0566"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44788"
FT                   /db_xref="GOA:Q8VKJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ4"
FT                   /protein_id="AAK44788.1"
FT   gene            complement(635868..636956)
FT                   /gene="menE"
FT                   /locus_tag="MT0567"
FT   CDS_pept        complement(635868..636956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="MT0567"
FT                   /product="o-succinylbenzoate--CoA ligase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:108449; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44789"
FT                   /db_xref="GOA:P9WQ38"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ38"
FT                   /protein_id="AAK44789.1"
FT   gene            636909..637436
FT                   /locus_tag="MT0568"
FT   CDS_pept        636909..637436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44790"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ3"
FT                   /protein_id="AAK44790.1"
FT                   WRPGRPSRCDAR"
FT   gene            complement(637387..637665)
FT                   /locus_tag="MT0569"
FT   CDS_pept        complement(637387..637665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0569"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44791"
FT                   /db_xref="GOA:L7N5M9"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5M9"
FT                   /protein_id="AAK44791.1"
FT   gene            complement(637662..638915)
FT                   /locus_tag="MT0570"
FT   CDS_pept        complement(637662..638915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0570"
FT                   /product="phosphate transport protein"
FT                   /note="identified by similarity to GP:2393906; match to
FT                   protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:MT0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44792"
FT                   /db_xref="GOA:P9WIA6"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIA6"
FT                   /protein_id="AAK44792.1"
FT                   PPPNHRAPQFGVTTRNAP"
FT   gene            complement(639035..639421)
FT                   /locus_tag="MT0571"
FT   CDS_pept        complement(639035..639421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:35329; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MT0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44793"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5Y0"
FT                   /protein_id="AAK44793.1"
FT   gene            complement(639484..640368)
FT                   /locus_tag="MT0572"
FT   CDS_pept        complement(639484..640368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0572"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by similarity to EGAD:129576; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MT0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44794"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4N9"
FT                   /protein_id="AAK44794.1"
FT                   NALMQRRNEQLNP"
FT   gene            complement(640464..641408)
FT                   /gene="menB"
FT                   /locus_tag="MT0573"
FT   CDS_pept        complement(640464..641408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="MT0573"
FT                   /product="naphthoate synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:48092; match to
FT                   protein family HMM PF00378; match to protein family HMM
FT                   TIGR01929"
FT                   /db_xref="EnsemblGenomes-Gn:MT0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44795"
FT                   /db_xref="GOA:P9WNP4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNP4"
FT                   /protein_id="AAK44795.1"
FT   gene            complement(641424..641558)
FT                   /locus_tag="MT0573.1"
FT   CDS_pept        complement(641424..641558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0573.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0573.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ2"
FT                   /protein_id="AAK44796.1"
FT   gene            complement(641680..642093)
FT                   /locus_tag="MT0574"
FT   CDS_pept        complement(641680..642093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0574"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44797"
FT                   /db_xref="GOA:P9WFB6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFB6"
FT                   /protein_id="AAK44797.1"
FT   gene            complement(642090..642356)
FT                   /locus_tag="MT0575"
FT   CDS_pept        complement(642090..642356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0575"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44798"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ58"
FT                   /protein_id="AAK44798.1"
FT   gene            642340..642495
FT                   /locus_tag="MT0576"
FT   CDS_pept        642340..642495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0576"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44799"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKJ1"
FT                   /protein_id="AAK44799.1"
FT                   PGRRPG"
FT   gene            complement(642548..644263)
FT                   /locus_tag="MT0577"
FT   CDS_pept        complement(642548..644263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0577"
FT                   /product="substrate--CoA ligase"
FT                   /note="identified by similarity to GP:5881868; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MT0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44800"
FT                   /db_xref="GOA:L7N4Z0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4Z0"
FT                   /protein_id="AAK44800.1"
FT   gene            644227..645945
FT                   /locus_tag="MT0578"
FT   CDS_pept        644227..645945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108151; match to
FT                   protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:MT0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44801"
FT                   /db_xref="GOA:Q7D9N3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9N3"
FT                   /protein_id="AAK44801.1"
FT   gene            645942..646922
FT                   /locus_tag="MT0579"
FT   CDS_pept        645942..646922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0579"
FT                   /product="muconate cycloisomerase I, putative"
FT                   /note="identified by similarity to SP:O33946; match to
FT                   protein family HMM PF01188"
FT                   /db_xref="EnsemblGenomes-Gn:MT0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44802"
FT                   /db_xref="GOA:P9WJP2"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJP2"
FT                   /protein_id="AAK44802.1"
FT   gene            646919..647707
FT                   /locus_tag="MT0580"
FT   CDS_pept        646919..647707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0580"
FT                   /product="bromoperoxidase, putative"
FT                   /note="identified by similarity to GP:2894177; match to
FT                   protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MT0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44803"
FT                   /db_xref="GOA:P9WNH0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNH0"
FT                   /protein_id="AAK44803.1"
FT   gene            647750..649414
FT                   /gene="menD"
FT                   /locus_tag="MT0581"
FT   CDS_pept        647750..649414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="MT0581"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by similarity to EGAD:19018; match to
FT                   protein family HMM PF02776; match to protein family HMM
FT                   TIGR00173"
FT                   /db_xref="EnsemblGenomes-Gn:MT0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44804"
FT                   /db_xref="GOA:P9WK10"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WK10"
FT                   /protein_id="AAK44804.1"
FT   gene            649411..649926
FT                   /locus_tag="MT0582"
FT   CDS_pept        649411..649926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44805"
FT                   /db_xref="GOA:Q7D9N0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9N0"
FT                   /protein_id="AAK44805.1"
FT                   ENSASATG"
FT   gene            649898..651124
FT                   /locus_tag="MT0583"
FT   CDS_pept        649898..651124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0583"
FT                   /product="glycosyl transferase"
FT                   /note="identified by similarity to EGAD:48993; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MT0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44806"
FT                   /db_xref="GOA:P9WMY4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMY4"
FT                   /protein_id="AAK44806.1"
FT                   RGRRTTQAA"
FT   gene            651186..651845
FT                   /gene="ubiE"
FT                   /locus_tag="MT0584"
FT   CDS_pept        651186..651845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="MT0584"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to EGAD:22837; match to
FT                   protein family HMM PF01209; match to protein family HMM
FT                   TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44807"
FT                   /db_xref="GOA:P9WFR2"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFR2"
FT                   /protein_id="AAK44807.1"
FT   gene            complement(651859..652197)
FT                   /locus_tag="MT0585"
FT   CDS_pept        complement(651859..652197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0585"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44808"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKL2"
FT                   /protein_id="AAK44808.1"
FT                   VLQRAGTR"
FT   gene            complement(652231..652956)
FT                   /locus_tag="MT0586"
FT   CDS_pept        complement(652231..652956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2246646"
FT                   /db_xref="EnsemblGenomes-Gn:MT0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44809"
FT                   /db_xref="GOA:P9WKL4"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKL4"
FT                   /protein_id="AAK44809.1"
FT   gene            complement(652981..654207)
FT                   /locus_tag="MT0587"
FT   CDS_pept        complement(652981..654207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0587"
FT                   /product="monooxygenase, FAD-binding, putative"
FT                   /note="identified by similarity to EGAD:141760"
FT                   /db_xref="EnsemblGenomes-Gn:MT0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44810"
FT                   /db_xref="GOA:P9WNY8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNY8"
FT                   /protein_id="AAK44810.1"
FT                   LVDRRPPFS"
FT   gene            654223..655230
FT                   /locus_tag="MT0588"
FT   CDS_pept        654223..655230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0588"
FT                   /product="polyprenyl synthetase"
FT                   /note="identified by similarity to EGAD:40622; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:MT0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44811"
FT                   /db_xref="GOA:L7N620"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:L7N620"
FT                   /protein_id="AAK44811.1"
FT   gene            655331..656191
FT                   /gene="htpX"
FT                   /locus_tag="MT0589"
FT   CDS_pept        655331..656191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="MT0589"
FT                   /product="heat shock protein HtpX"
FT                   /note="identified by similarity to GP:3257674; similarity
FT                   to EGAD:158805; match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:MT0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44812"
FT                   /db_xref="GOA:P9WHS4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHS4"
FT                   /protein_id="AAK44812.1"
FT                   AMARG"
FT   gene            complement(656376..657401)
FT                   /gene="gpdA1"
FT                   /locus_tag="MT0590"
FT   CDS_pept        complement(656376..657401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpdA1"
FT                   /locus_tag="MT0590"
FT                   /product="glycerol-3-phosphate dehydrogenase,
FT                   NAD-dependent"
FT                   /note="identified by similarity to EGAD:130665; match to
FT                   protein family HMM PF01210"
FT                   /db_xref="EnsemblGenomes-Gn:MT0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44813"
FT                   /db_xref="GOA:P9WN74"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WN74"
FT                   /protein_id="AAK44813.1"
FT                   F"
FT   gene            complement(657462..658922)
FT                   /locus_tag="MT0591"
FT   CDS_pept        complement(657462..658922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0591"
FT                   /product="monooxygenase, flavin-binding family"
FT                   /note="identified by similarity to GP:2804298"
FT                   /db_xref="EnsemblGenomes-Gn:MT0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44814"
FT                   /db_xref="GOA:Q7D9M5"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9M5"
FT                   /protein_id="AAK44814.1"
FT   gene            complement(659000..659491)
FT                   /locus_tag="MT0592"
FT   CDS_pept        complement(659000..659491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107280; match to
FT                   protein family HMM PF04461"
FT                   /db_xref="EnsemblGenomes-Gn:MT0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44815"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFK8"
FT                   /protein_id="AAK44815.1"
FT                   "
FT   gene            659770..660792
FT                   /gene="tcmO"
FT                   /locus_tag="MT0593"
FT   CDS_pept        659770..660792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcmO"
FT                   /locus_tag="MT0593"
FT                   /product="tetracenpmycin polyketide synthesis
FT                   8-o-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to EGAD:22411; match to
FT                   protein family HMM PF00891"
FT                   /db_xref="EnsemblGenomes-Gn:MT0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44816"
FT                   /db_xref="GOA:Q7D9M4"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9M4"
FT                   /protein_id="AAK44816.1"
FT                   "
FT   gene            660902..662320
FT                   /locus_tag="MT0594"
FT   CDS_pept        660902..662320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0594"
FT                   /product="P450 heme-thiolate protein"
FT                   /note="identified by similarity to EGAD:40204; match to
FT                   protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:MT0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44817"
FT                   /db_xref="GOA:P9WPM8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPM8"
FT                   /protein_id="AAK44817.1"
FT                   AARGGGPSRAVGSQ"
FT   gene            662317..662721
FT                   /locus_tag="MT0595"
FT   CDS_pept        662317..662721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3581844"
FT                   /db_xref="EnsemblGenomes-Gn:MT0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44818"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM82"
FT                   /protein_id="AAK44818.1"
FT   gene            662618..664825
FT                   /locus_tag="MT0596"
FT   CDS_pept        662618..664825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0596"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit, putative"
FT                   /note="identified by similarity to EGAD:104718; match to
FT                   protein family HMM PF00317; match to protein family HMM
FT                   PF02867; match to protein family HMM PF03477"
FT                   /db_xref="EnsemblGenomes-Gn:MT0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44819"
FT                   /db_xref="GOA:P9WH76"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH76"
FT                   /protein_id="AAK44819.1"
FT   gene            complement(664938..666293)
FT                   /locus_tag="MT0597"
FT   CDS_pept        complement(664938..666293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:35307; match to
FT                   protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:MT0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44820"
FT                   /db_xref="GOA:P9WHK0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHK0"
FT                   /protein_id="AAK44820.1"
FT   gene            complement(666374..666496)
FT                   /locus_tag="MT0598"
FT   CDS_pept        complement(666374..666496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44821"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI8"
FT                   /protein_id="AAK44821.1"
FT   gene            complement(666493..666834)
FT                   /locus_tag="MT0599"
FT   CDS_pept        complement(666493..666834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0599"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44822"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM80"
FT                   /protein_id="AAK44822.1"
FT                   SRSPQSDDL"
FT   gene            complement(666885..667052)
FT                   /locus_tag="MT0600"
FT   CDS_pept        complement(666885..667052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44823"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI7"
FT                   /protein_id="AAK44823.1"
FT                   PHPGEHVPRS"
FT   gene            complement(667302..668693)
FT                   /locus_tag="MT0601"
FT   CDS_pept        complement(667302..668693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0601"
FT                   /product="nicotinate phosphoribosyltransferase, putative"
FT                   /note="identified by similarity to SP:P18133; match to
FT                   protein family HMM PF04095; match to protein family HMM
FT                   TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:MT0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44824"
FT                   /db_xref="GOA:P9WJI6"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJI6"
FT                   /protein_id="AAK44824.1"
FT                   KAKRP"
FT   gene            complement(668703..669845)
FT                   /locus_tag="MT0602"
FT   CDS_pept        complement(668703..669845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0602"
FT                   /product="CapA-related protein"
FT                   /note="identified by similarity to EGAD:107722"
FT                   /db_xref="EnsemblGenomes-Gn:MT0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44825"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM78"
FT                   /protein_id="AAK44825.1"
FT   gene            669938..670042
FT                   /locus_tag="MT0603"
FT   CDS_pept        669938..670042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0603"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44826"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI6"
FT                   /protein_id="AAK44826.1"
FT   gene            complement(670030..671196)
FT                   /locus_tag="MT0604"
FT   CDS_pept        complement(670030..671196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0604"
FT                   /product="monooxygenase, putative"
FT                   /note="identified by similarity to EGAD:144636; match to
FT                   protein family HMM PF01360"
FT                   /db_xref="EnsemblGenomes-Gn:MT0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44827"
FT                   /db_xref="GOA:L7N5L4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:L7N5L4"
FT                   /protein_id="AAK44827.1"
FT   gene            671290..672603
FT                   /locus_tag="MT0605"
FT   CDS_pept        671290..672603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0605"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by similarity to GP:5420000; match to
FT                   protein family HMM PF01022; match to protein family HMM
FT                   PF05146"
FT                   /db_xref="EnsemblGenomes-Gn:MT0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44828"
FT                   /db_xref="GOA:Q7D9L7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9L7"
FT                   /protein_id="AAK44828.1"
FT   gene            672611..673402
FT                   /gene="dnrV"
FT                   /locus_tag="MT0606"
FT   CDS_pept        672611..673402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnrV"
FT                   /locus_tag="MT0606"
FT                   /product="doxorubicin biosynthesis enzyme DnrV"
FT                   /note="identified by similarity to GP:3778996; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MT0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44829"
FT                   /db_xref="GOA:P9WIR2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIR2"
FT                   /protein_id="AAK44829.1"
FT   gene            complement(673447..677367)
FT                   /locus_tag="MT0607"
FT   CDS_pept        complement(673447..677367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0607"
FT                   /product="PE_PGRS family protein"
FT                   /note="identified by similarity to EGAD:129390; match to
FT                   protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MT0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44830"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9L6"
FT                   /protein_id="AAK44830.1"
FT   gene            677282..677761
FT                   /locus_tag="MT0608"
FT   CDS_pept        677282..677761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0608"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44831"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI5"
FT                   /protein_id="AAK44831.1"
FT   gene            677737..678447
FT                   /locus_tag="MT0608.1"
FT   CDS_pept        677737..678447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0608.1"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:165101; match to
FT                   protein family HMM PF01927"
FT                   /db_xref="EnsemblGenomes-Gn:MT0608.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44832"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9L5"
FT                   /protein_id="AAK44832.1"
FT                   RLVERLRDQLTTST"
FT   gene            complement(678576..679154)
FT                   /locus_tag="MT0609"
FT   CDS_pept        complement(678576..679154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0609"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44833"
FT                   /db_xref="InterPro:IPR016791"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9L4"
FT                   /protein_id="AAK44833.1"
FT   gene            complement(679178..679804)
FT                   /locus_tag="MT0610"
FT   CDS_pept        complement(679178..679804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0610"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44834"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI4"
FT                   /protein_id="AAK44834.1"
FT   gene            complement(679840..680526)
FT                   /locus_tag="MT0611"
FT   CDS_pept        complement(679840..680526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0611"
FT                   /product="lipoprotein, MK35"
FT                   /note="identified by similarity to EGAD:39069"
FT                   /db_xref="EnsemblGenomes-Gn:MT0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44835"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:L7N4H0"
FT                   /protein_id="AAK44835.1"
FT                   QTTITP"
FT   gene            680680..683313
FT                   /locus_tag="MT0612"
FT   CDS_pept        680680..683313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6522844; match to
FT                   protein family HMM TIGR01180"
FT                   /db_xref="EnsemblGenomes-Gn:MT0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44836"
FT                   /db_xref="GOA:Q7D9L2"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9L2"
FT                   /protein_id="AAK44836.1"
FT                   VAEAVE"
FT   gene            complement(683336..684904)
FT                   /locus_tag="MT0613"
FT   CDS_pept        complement(683336..684904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2104605; match to
FT                   protein family HMM PF03706; match to protein family HMM
FT                   TIGR00374"
FT                   /db_xref="EnsemblGenomes-Gn:MT0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44837"
FT                   /db_xref="GOA:Q8VKI3"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI3"
FT                   /protein_id="AAK44837.1"
FT                   RHEMI"
FT   gene            685182..685790
FT                   /locus_tag="MT0614"
FT   CDS_pept        685182..685790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0614"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI2"
FT                   /protein_id="AAK44838.1"
FT   gene            685859..686581
FT                   /locus_tag="MT0615"
FT   CDS_pept        685859..686581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0615"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by similarity to EGAD:7086; match to
FT                   protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:MT0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44839"
FT                   /db_xref="GOA:P9WMG4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMG4"
FT                   /protein_id="AAK44839.1"
FT                   ELANTSLMAVLVSQASRQ"
FT   gene            686578..687375
FT                   /locus_tag="MT0616"
FT   CDS_pept        686578..687375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:49445; match to
FT                   protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MT0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44840"
FT                   /db_xref="GOA:O07791"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:O07791"
FT                   /protein_id="AAK44840.1"
FT   gene            687377..688264
FT                   /locus_tag="MT0617"
FT   CDS_pept        687377..688264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:49677; match to
FT                   protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MT0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44841"
FT                   /db_xref="GOA:Q7D9L0"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9L0"
FT                   /protein_id="AAK44841.1"
FT                   LALYGVDPNFNLTV"
FT   gene            688270..689484
FT                   /gene="mce-2"
FT                   /locus_tag="MT0618"
FT   CDS_pept        688270..689484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce-2"
FT                   /locus_tag="MT0618"
FT                   /product="virulence factor"
FT                   /note="identified by similarity to GP:5814111; match to
FT                   protein family HMM PF02470; match to protein family HMM
FT                   TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44842"
FT                   /db_xref="GOA:O07789"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:O07789"
FT                   /protein_id="AAK44842.1"
FT                   NTINP"
FT   gene            689445..690308
FT                   /locus_tag="MT0619"
FT   CDS_pept        689445..690308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0619"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44843"
FT                   /db_xref="GOA:Q8VKI1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI1"
FT                   /protein_id="AAK44843.1"
FT                   ASSSRS"
FT   gene            690257..690511
FT                   /locus_tag="MT0620"
FT   CDS_pept        690257..690511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0620"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44844"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKI0"
FT                   /protein_id="AAK44844.1"
FT   gene            690496..691818
FT                   /locus_tag="MT0621"
FT   CDS_pept        690496..691818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0621"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44845"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKH9"
FT                   /protein_id="AAK44845.1"
FT   gene            691949..693475
FT                   /locus_tag="MT0622"
FT   CDS_pept        691949..693475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0622"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44846"
FT                   /db_xref="GOA:O07786"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:O07786"
FT                   /protein_id="AAK44846.1"
FT   gene            693472..694680
FT                   /locus_tag="MT0623"
FT   CDS_pept        693472..694680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0623"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44847"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:O07785"
FT                   /protein_id="AAK44847.1"
FT                   RAE"
FT   gene            694616..696235
FT                   /locus_tag="MT0624"
FT   CDS_pept        694616..696235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0624"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MT0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44848"
FT                   /db_xref="GOA:Q7D9K7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9K7"
FT                   /protein_id="AAK44848.1"
FT   gene            complement(696287..696682)
FT                   /locus_tag="MT0625"
FT   CDS_pept        complement(696287..696682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:97226; match to
FT                   protein family HMM PF01850"
FT                   /db_xref="EnsemblGenomes-Gn:MT0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44849"
FT                   /db_xref="GOA:Q7D9K6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9K6"
FT                   /protein_id="AAK44849.1"
FT   gene            complement(696676..696933)
FT                   /locus_tag="MT0626"
FT   CDS_pept        complement(696676..696933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0626"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44850"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WF20"
FT                   /protein_id="AAK44850.1"
FT   gene            complement(697116..698351)
FT                   /locus_tag="MT0627"
FT   CDS_pept        complement(697116..698351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44851"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:O07781"
FT                   /protein_id="AAK44851.1"
FT                   LAALPVSTLWAG"
FT   gene            complement(698602..699015)
FT                   /locus_tag="MT0628"
FT   CDS_pept        complement(698602..699015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0628"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44852"
FT                   /db_xref="GOA:P9WF82"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WF82"
FT                   /protein_id="AAK44852.1"
FT   gene            complement(699012..699275)
FT                   /locus_tag="MT0629"
FT   CDS_pept        complement(699012..699275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0629"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44853"
FT                   /db_xref="GOA:Q7D9K2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D9K2"
FT                   /protein_id="AAK44853.1"
FT   gene            complement(699352..700485)
FT                   /locus_tag="MT0630"
FT   CDS_pept        complement(699352..700485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0630"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by similarity to GP:4539211; match to
FT                   protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MT0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44854"
FT                   /db_xref="GOA:Q7D9K1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7D9K1"
FT                   /protein_id="AAK44854.1"
FT   gene            complement(700486..701229)
FT                   /gene="tcrA"
FT                   /locus_tag="MT0631"
FT   CDS_pept        complement(700486..701229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcrA"
FT                   /locus_tag="MT0631"
FT                   /product="DNA-binding response regulator TcrA"
FT                   /note="identified by similarity to GP:1408184; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:MT0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44855"
FT                   /db_xref="GOA:Q7D9K0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7D9K0"
FT                   /protein_id="AAK44855.1"
FT   gene            701687..702637
FT                   /locus_tag="MT0632"
FT   CDS_pept        701687..702637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0632"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44856"
FT                   /db_xref="GOA:O07774"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="UniProtKB/TrEMBL:O07774"
FT                   /protein_id="AAK44856.1"
FT   gene            702854..703462
FT                   /locus_tag="MT0633"
FT   CDS_pept        702854..703462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0633"
FT                   /product="IS1536, resolvase"
FT                   /note="identified by similarity to EGAD:139082; match to
FT                   protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:MT0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44857"
FT                   /db_xref="GOA:O07773"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:O07773"
FT                   /protein_id="AAK44857.1"
FT   gene            703386..704207
FT                   /locus_tag="MT0635"
FT   CDS_pept        703386..704207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0635"
FT                   /product="IS1536, transposase, truncated"
FT                   /note="identified by similarity to EGAD:139329; match to
FT                   protein family HMM PF01385"
FT                   /db_xref="EnsemblGenomes-Gn:MT0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAT90140"
FT                   /protein_id="AAT90140.1"
FT   gene            704245..704688
FT                   /locus_tag="MT0636"
FT   CDS_pept        704245..704688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0636"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44858"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKH8"
FT                   /protein_id="AAK44858.1"
FT   gene            704690..704935
FT                   /locus_tag="MT0637"
FT   CDS_pept        704690..704935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0637"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44859"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ38"
FT                   /protein_id="AAK44859.1"
FT   gene            704932..705333
FT                   /locus_tag="MT0638"
FT   CDS_pept        704932..705333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44860"
FT                   /db_xref="GOA:P9WF80"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WF80"
FT                   /protein_id="AAK44860.1"
FT   gene            705330..705503
FT                   /locus_tag="MT0638.1"
FT   CDS_pept        705330..705503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0638.1"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0638.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44861"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKH7"
FT                   /protein_id="AAK44861.1"
FT                   GSGRLPKPLRHS"
FT   gene            705870..706205
FT                   /locus_tag="MT0639"
FT   CDS_pept        705870..706205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44862"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VKH6"
FT                   /protein_id="AAK44862.1"
FT                   GAAASFT"
FT   gene            complement(706198..707355)
FT                   /locus_tag="MT0640"
FT   CDS_pept        complement(706198..707355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0640"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44863"
FT                   /db_xref="UniProtKB/TrEMBL:O07767"
FT                   /protein_id="AAK44863.1"
FT   gene            complement(707407..707790)
FT                   /locus_tag="MT0641"
FT   CDS_pept        complement(707407..707790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0641"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44864"
FT                   /db_xref="InterPro:IPR032568"
FT                   /db_xref="UniProtKB/TrEMBL:O07766"
FT                   /protein_id="AAK44864.1"
FT   gene            707770..708375
FT                   /locus_tag="MT0642"
FT   CDS_pept        707770..708375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MT0642"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MT0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAK44865"
FT                   /db_xref="UniProtKB/TrEMBL:O07765"
FT                   /protein_id="AAK44865.1"
FT   gene            complement(708394..710961)
FT                   /locus_tag="MT0643"
FT   CDS_pept        complement(708394..710961)