(data stored in SCRATCH zone)

EMBL: AE000657

ID   AE000657; SV 1; circular; genomic DNA; STD; PRO; 1551335 BP.
XX
AC   AE000657; AE000669-AE000777;
XX
PR   Project:PRJNA215;
XX
DT   28-DEC-2005 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Aquifex aeolicus VF5, complete genome.
XX
KW   .
XX
OS   Aquifex aeolicus VF5
OC   Bacteria; Aquificae; Aquificales; Aquificaceae; Aquifex.
XX
RN   [1]
RP   1-1551335
RX   DOI; 10.1038/32831.
RX   PUBMED; 9537320.
RA   Deckert G., Warren P.V., Gaasterland T., Young W.G., Lenox A.L.,
RA   Graham D.E., Overbeek R., Snead M.A., Keller M., Aujay M., Huber R.,
RA   Feldman R.A., Short J.M., Olson G.J., Swanson R.V.;
RT   "The complete genome of the hyperthermophilic bacterium Aquifex aeolicus";
RL   Nature 392(6674):353-358(1998).
XX
RN   [2]
RP   1-1551335
RA   Deckert G., Warren P.V., Gaasterland T., Young W.G., Lenox A.L.,
RA   Graham D.E., Overbeek R., Snead M.A., Keller M., Aujay M., Huber R.,
RA   Feldman R.A., Short J.M., Olson G.J., Swanson R.V.;
RT   ;
RL   Submitted (25-JUL-1997) to the INSDC.
RL   Diversa Corporation, Genomics, San Diego, CA 92121, USA
XX
DR   MD5; 99ffe925fe98d86c7a2cb0708a07b3ad.
DR   BioSample; SAMN02603207.
DR   EnsemblGenomes-Gn; EBG00001182225.
DR   EnsemblGenomes-Gn; EBG00001182226.
DR   EnsemblGenomes-Gn; EBG00001182227.
DR   EnsemblGenomes-Gn; EBG00001182229.
DR   EnsemblGenomes-Gn; EBG00001182230.
DR   EnsemblGenomes-Gn; EBG00001182231.
DR   EnsemblGenomes-Gn; EBG00001182232.
DR   EnsemblGenomes-Gn; EBG00001182233.
DR   EnsemblGenomes-Gn; EBG00001182234.
DR   EnsemblGenomes-Gn; EBG00001182235.
DR   EnsemblGenomes-Gn; EBG00001182236.
DR   EnsemblGenomes-Gn; EBG00001182237.
DR   EnsemblGenomes-Gn; EBG00001182238.
DR   EnsemblGenomes-Gn; EBG00001182239.
DR   EnsemblGenomes-Gn; EBG00001182240.
DR   EnsemblGenomes-Gn; EBG00001182241.
DR   EnsemblGenomes-Gn; EBG00001182242.
DR   EnsemblGenomes-Gn; EBG00001182244.
DR   EnsemblGenomes-Gn; EBG00001182245.
DR   EnsemblGenomes-Gn; EBG00001182246.
DR   EnsemblGenomes-Gn; EBG00001182247.
DR   EnsemblGenomes-Gn; EBG00001182248.
DR   EnsemblGenomes-Gn; EBG00001182249.
DR   EnsemblGenomes-Gn; EBG00001182250.
DR   EnsemblGenomes-Gn; EBG00001182251.
DR   EnsemblGenomes-Gn; EBG00001182252.
DR   EnsemblGenomes-Gn; EBG00001182253.
DR   EnsemblGenomes-Gn; EBG00001182254.
DR   EnsemblGenomes-Gn; EBG00001182255.
DR   EnsemblGenomes-Gn; EBG00001182256.
DR   EnsemblGenomes-Gn; EBG00001182257.
DR   EnsemblGenomes-Gn; EBG00001182258.
DR   EnsemblGenomes-Gn; EBG00001182259.
DR   EnsemblGenomes-Gn; EBG00001182260.
DR   EnsemblGenomes-Gn; EBG00001182261.
DR   EnsemblGenomes-Gn; EBG00001182262.
DR   EnsemblGenomes-Gn; EBG00001182263.
DR   EnsemblGenomes-Gn; EBG00001182264.
DR   EnsemblGenomes-Gn; EBG00001182265.
DR   EnsemblGenomes-Gn; EBG00001182266.
DR   EnsemblGenomes-Gn; EBG00001182267.
DR   EnsemblGenomes-Gn; EBG00001182268.
DR   EnsemblGenomes-Gn; EBG00001182269.
DR   EnsemblGenomes-Gn; EBG00001182270.
DR   EnsemblGenomes-Gn; EBG00001182271.
DR   EnsemblGenomes-Gn; EBG00001182272.
DR   EnsemblGenomes-Gn; EBG00001182273.
DR   EnsemblGenomes-Gn; EBG00001182274.
DR   EnsemblGenomes-Gn; EBG00001182275.
DR   EnsemblGenomes-Gn; EBG00001182276.
DR   EnsemblGenomes-Gn; EBG00001182277.
DR   EnsemblGenomes-Gn; EBG00001182278.
DR   EnsemblGenomes-Gn; EBG00001182279.
DR   EnsemblGenomes-Gn; EBG00001182280.
DR   EnsemblGenomes-Gn; EBG00001182281.
DR   EnsemblGenomes-Gn; EBG00001182282.
DR   EnsemblGenomes-Gn; EBG00001182283.
DR   EnsemblGenomes-Gn; EBG00001182284.
DR   EnsemblGenomes-Gn; EBG00001182285.
DR   EnsemblGenomes-Gn; aq_r01.
DR   EnsemblGenomes-Gn; aq_r02.
DR   EnsemblGenomes-Gn; aq_r03.
DR   EnsemblGenomes-Gn; aq_r04.
DR   EnsemblGenomes-Gn; aq_r05.
DR   EnsemblGenomes-Gn; aq_r06.
DR   EnsemblGenomes-Gn; aq_s01.
DR   EnsemblGenomes-Gn; aq_t01.
DR   EnsemblGenomes-Gn; aq_t02.
DR   EnsemblGenomes-Gn; aq_t03.
DR   EnsemblGenomes-Gn; aq_t04.
DR   EnsemblGenomes-Gn; aq_t05.
DR   EnsemblGenomes-Gn; aq_t06.
DR   EnsemblGenomes-Gn; aq_t07.
DR   EnsemblGenomes-Gn; aq_t08.
DR   EnsemblGenomes-Gn; aq_t09.
DR   EnsemblGenomes-Gn; aq_t10.
DR   EnsemblGenomes-Gn; aq_t11.
DR   EnsemblGenomes-Gn; aq_t12.
DR   EnsemblGenomes-Gn; aq_t13.
DR   EnsemblGenomes-Gn; aq_t14.
DR   EnsemblGenomes-Gn; aq_t15.
DR   EnsemblGenomes-Gn; aq_t16.
DR   EnsemblGenomes-Gn; aq_t17.
DR   EnsemblGenomes-Gn; aq_t18.
DR   EnsemblGenomes-Gn; aq_t19.
DR   EnsemblGenomes-Gn; aq_t20.
DR   EnsemblGenomes-Gn; aq_t21.
DR   EnsemblGenomes-Gn; aq_t22.
DR   EnsemblGenomes-Gn; aq_t23.
DR   EnsemblGenomes-Gn; aq_t24.
DR   EnsemblGenomes-Gn; aq_t25.
DR   EnsemblGenomes-Gn; aq_t26.
DR   EnsemblGenomes-Gn; aq_t27.
DR   EnsemblGenomes-Gn; aq_t28.
DR   EnsemblGenomes-Gn; aq_t29.
DR   EnsemblGenomes-Gn; aq_t30.
DR   EnsemblGenomes-Gn; aq_t31.
DR   EnsemblGenomes-Gn; aq_t32.
DR   EnsemblGenomes-Gn; aq_t33.
DR   EnsemblGenomes-Gn; aq_t34.
DR   EnsemblGenomes-Gn; aq_t35.
DR   EnsemblGenomes-Gn; aq_t36.
DR   EnsemblGenomes-Gn; aq_t37.
DR   EnsemblGenomes-Gn; aq_t38.
DR   EnsemblGenomes-Gn; aq_t39.
DR   EnsemblGenomes-Gn; aq_t40.
DR   EnsemblGenomes-Gn; aq_t41.
DR   EnsemblGenomes-Gn; aq_t42.
DR   EnsemblGenomes-Gn; aq_t43.
DR   EnsemblGenomes-Gn; aq_t44.
DR   EnsemblGenomes-Tr; EBT00001760621.
DR   EnsemblGenomes-Tr; EBT00001760622.
DR   EnsemblGenomes-Tr; EBT00001760623.
DR   EnsemblGenomes-Tr; EBT00001760624.
DR   EnsemblGenomes-Tr; EBT00001760625.
DR   EnsemblGenomes-Tr; EBT00001760626.
DR   EnsemblGenomes-Tr; EBT00001760627.
DR   EnsemblGenomes-Tr; EBT00001760628.
DR   EnsemblGenomes-Tr; EBT00001760629.
DR   EnsemblGenomes-Tr; EBT00001760630.
DR   EnsemblGenomes-Tr; EBT00001760631.
DR   EnsemblGenomes-Tr; EBT00001760632.
DR   EnsemblGenomes-Tr; EBT00001760633.
DR   EnsemblGenomes-Tr; EBT00001760634.
DR   EnsemblGenomes-Tr; EBT00001760635.
DR   EnsemblGenomes-Tr; EBT00001760636.
DR   EnsemblGenomes-Tr; EBT00001760637.
DR   EnsemblGenomes-Tr; EBT00001760638.
DR   EnsemblGenomes-Tr; EBT00001760639.
DR   EnsemblGenomes-Tr; EBT00001760640.
DR   EnsemblGenomes-Tr; EBT00001760641.
DR   EnsemblGenomes-Tr; EBT00001760642.
DR   EnsemblGenomes-Tr; EBT00001760643.
DR   EnsemblGenomes-Tr; EBT00001760644.
DR   EnsemblGenomes-Tr; EBT00001760645.
DR   EnsemblGenomes-Tr; EBT00001760646.
DR   EnsemblGenomes-Tr; EBT00001760647.
DR   EnsemblGenomes-Tr; EBT00001760648.
DR   EnsemblGenomes-Tr; EBT00001760649.
DR   EnsemblGenomes-Tr; EBT00001760650.
DR   EnsemblGenomes-Tr; EBT00001760652.
DR   EnsemblGenomes-Tr; EBT00001760653.
DR   EnsemblGenomes-Tr; EBT00001760654.
DR   EnsemblGenomes-Tr; EBT00001760655.
DR   EnsemblGenomes-Tr; EBT00001760656.
DR   EnsemblGenomes-Tr; EBT00001760657.
DR   EnsemblGenomes-Tr; EBT00001760658.
DR   EnsemblGenomes-Tr; EBT00001760659.
DR   EnsemblGenomes-Tr; EBT00001760660.
DR   EnsemblGenomes-Tr; EBT00001760661.
DR   EnsemblGenomes-Tr; EBT00001760663.
DR   EnsemblGenomes-Tr; EBT00001760664.
DR   EnsemblGenomes-Tr; EBT00001760665.
DR   EnsemblGenomes-Tr; EBT00001760666.
DR   EnsemblGenomes-Tr; EBT00001760667.
DR   EnsemblGenomes-Tr; EBT00001760668.
DR   EnsemblGenomes-Tr; EBT00001760669.
DR   EnsemblGenomes-Tr; EBT00001760670.
DR   EnsemblGenomes-Tr; EBT00001760671.
DR   EnsemblGenomes-Tr; EBT00001760672.
DR   EnsemblGenomes-Tr; EBT00001760673.
DR   EnsemblGenomes-Tr; EBT00001760674.
DR   EnsemblGenomes-Tr; EBT00001760675.
DR   EnsemblGenomes-Tr; EBT00001760676.
DR   EnsemblGenomes-Tr; EBT00001760677.
DR   EnsemblGenomes-Tr; EBT00001760678.
DR   EnsemblGenomes-Tr; EBT00001760679.
DR   EnsemblGenomes-Tr; EBT00001760680.
DR   EnsemblGenomes-Tr; EBT00001760681.
DR   EnsemblGenomes-Tr; aq_r01-1.
DR   EnsemblGenomes-Tr; aq_r02-1.
DR   EnsemblGenomes-Tr; aq_r03-1.
DR   EnsemblGenomes-Tr; aq_r04-1.
DR   EnsemblGenomes-Tr; aq_r05-1.
DR   EnsemblGenomes-Tr; aq_r06-1.
DR   EnsemblGenomes-Tr; aq_s01-1.
DR   EnsemblGenomes-Tr; aq_t01-1.
DR   EnsemblGenomes-Tr; aq_t02-1.
DR   EnsemblGenomes-Tr; aq_t03-1.
DR   EnsemblGenomes-Tr; aq_t04-1.
DR   EnsemblGenomes-Tr; aq_t05-1.
DR   EnsemblGenomes-Tr; aq_t06-1.
DR   EnsemblGenomes-Tr; aq_t07-1.
DR   EnsemblGenomes-Tr; aq_t08-1.
DR   EnsemblGenomes-Tr; aq_t09-1.
DR   EnsemblGenomes-Tr; aq_t10-1.
DR   EnsemblGenomes-Tr; aq_t11-1.
DR   EnsemblGenomes-Tr; aq_t12-1.
DR   EnsemblGenomes-Tr; aq_t13-1.
DR   EnsemblGenomes-Tr; aq_t14-1.
DR   EnsemblGenomes-Tr; aq_t15-1.
DR   EnsemblGenomes-Tr; aq_t16-1.
DR   EnsemblGenomes-Tr; aq_t17-1.
DR   EnsemblGenomes-Tr; aq_t18-1.
DR   EnsemblGenomes-Tr; aq_t19-1.
DR   EnsemblGenomes-Tr; aq_t20-1.
DR   EnsemblGenomes-Tr; aq_t21-1.
DR   EnsemblGenomes-Tr; aq_t22-1.
DR   EnsemblGenomes-Tr; aq_t23-1.
DR   EnsemblGenomes-Tr; aq_t24-1.
DR   EnsemblGenomes-Tr; aq_t25-1.
DR   EnsemblGenomes-Tr; aq_t26-1.
DR   EnsemblGenomes-Tr; aq_t27-1.
DR   EnsemblGenomes-Tr; aq_t28-1.
DR   EnsemblGenomes-Tr; aq_t29-1.
DR   EnsemblGenomes-Tr; aq_t30-1.
DR   EnsemblGenomes-Tr; aq_t31-1.
DR   EnsemblGenomes-Tr; aq_t32-1.
DR   EnsemblGenomes-Tr; aq_t33-1.
DR   EnsemblGenomes-Tr; aq_t34-1.
DR   EnsemblGenomes-Tr; aq_t35-1.
DR   EnsemblGenomes-Tr; aq_t36-1.
DR   EnsemblGenomes-Tr; aq_t37-1.
DR   EnsemblGenomes-Tr; aq_t38-1.
DR   EnsemblGenomes-Tr; aq_t39-1.
DR   EnsemblGenomes-Tr; aq_t40-1.
DR   EnsemblGenomes-Tr; aq_t41-1.
DR   EnsemblGenomes-Tr; aq_t42-1.
DR   EnsemblGenomes-Tr; aq_t43-1.
DR   EnsemblGenomes-Tr; aq_t44-1.
DR   EuropePMC; PMC1574309; 16869956.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC3753655; 23804766.
DR   EuropePMC; PMC4817684; 26251872.
DR   EuropePMC; PMC555942; 15757509.
DR   EuropePMC; PMC5981063; 29625980.
DR   EuropePMC; PMC90818; 11600392.
DR   EuropePMC; PMC93828; 10348873.
DR   EuropePMC; PMC94815; 11092850.
DR   GOA; D0VWU4.
DR   GOA; P56613.
DR   GOA; P58413.
DR   GOA; P59799.
DR   InterPro; IPR001854; Ribosomal_L29/L35.
DR   InterPro; IPR001901; Translocase_SecE/Sec61-g.
DR   InterPro; IPR002150; Ribosomal_L31.
DR   InterPro; IPR005807; SecE_bac.
DR   InterPro; IPR018254; Ribosomal_L29_CS.
DR   InterPro; IPR027491; Ribosomal_L31_A.
DR   InterPro; IPR034704; L28p-like.
DR   InterPro; IPR036049; Ribosomal_L29/L35_sf.
DR   InterPro; IPR038379; SecE_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; AE000657.
DR   SILVA-SSU; AE000657.
DR   UniProtKB/Swiss-Prot; D0VWU4; SECE_AQUAE.
DR   UniProtKB/Swiss-Prot; P56613; RL29_AQUAE.
DR   UniProtKB/Swiss-Prot; P58413; RL31_AQUAE.
DR   UniProtKB/Swiss-Prot; P59799; FER5_AQUAE.
XX
CC   On or before Dec 22, 2005 this sequence version replaced
CC   gi:2982762, gi:2982779, gi:2982793, gi:2982810, gi:2982834,
CC   gi:2982850, gi:2982863, gi:2982884, gi:2982900, gi:2982921,
CC   gi:2982936, gi:2982948, gi:2982963, gi:2982979, gi:2982996,
CC   gi:2983009, gi:2983026, gi:2983038, gi:2983050, gi:2983063,
CC   gi:2983082, gi:2983100, gi:2983118, gi:2983130, gi:2983148,
CC   gi:2983162, gi:2983180, gi:2983196, gi:2983212, gi:2983224,
CC   gi:2983238, gi:2983248, gi:2983260, gi:2983276, gi:2983287,
CC   gi:2983301, gi:2983310, gi:2983327, gi:2983342, gi:2983356,
CC   gi:2983373, gi:2983385, gi:2983401, gi:2983411, gi:2983424,
CC   gi:2983446, gi:2983460, gi:2983478, gi:2983492, gi:2983504,
CC   gi:2983517, gi:2983529, gi:2983544, gi:2983559, gi:2983569,
CC   gi:2983585, gi:2983598, gi:2983612, gi:2983623, gi:2983641,
CC   gi:2983659, gi:2983674, gi:2983691, gi:2983704, gi:2983720,
CC   gi:2983733, gi:2983749, gi:2983763, gi:2983782, gi:2983801,
CC   gi:2983813, gi:2983826, gi:2983841, gi:2983858, gi:2983875,
CC   gi:2983891, gi:2983907, gi:2983925, gi:2983944, gi:2983960,
CC   gi:2983975, gi:2983999, gi:2984013, gi:2984021, gi:2984035,
CC   gi:2984047, gi:2984063, gi:2984076, gi:2984092, gi:2984111,
CC   gi:2984125, gi:2984138, gi:2984149, gi:2984163, gi:2984178,
CC   gi:2984190, gi:2984199, gi:2984216, gi:2984235, gi:2984249,
CC   gi:2984262, gi:2984274, gi:2984286, gi:2984299, gi:2984313,
CC   gi:2984324, gi:2984342, gi:2984355, gi:2984377.
CC   Putative indicates no similarity to known proteins
CC   Hypothetical indicates similarity to a protein of unknown function.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1551335
FT                   /organism="Aquifex aeolicus VF5"
FT                   /strain="VF5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:224324"
FT   gene            1..2100
FT                   /gene="fusA"
FT                   /locus_tag="aq_001"
FT   CDS_pept        1..2100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="aq_001"
FT                   /product="elongation factor EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:aq_001"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06402"
FT                   /db_xref="GOA:O66428"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66428"
FT                   /protein_id="AAC06402.1"
FT                   /translation="MAREVPIEKLRNIGIVAHIDAGKTTTTERILYYTGKTYKIGEVHE
FT                   GAATMDWMPQEKERGITITVATTACYWTRNGERYQINIIDTPGHVDFSVEVVRSMKVLD
FT                   GIVFIFSAVEGVQPQSEANWRWADRFQVPRIAFINKMDRLGADFYRVFKEIEEKLTIKP
FT                   VAIQIPLGAEDQFEGVIDLMEMKAIRWLEETLGAKYEVVDIPPEYQEKAQEWREKMIET
FT                   IVETDDELMEKYLEGQEISIDELRKALRKATIERKLVPVLCGSAFKNKGVQPLLDAVID
FT                   YLPSPIDLPPVKGTNPKTGEEEVRHPSDDEPFCAYAFKVMSDPYAGQLTYIRVFSGTLK
FT                   AGSYVYNATKDEKQRAGRLLLMHANSREEIQQVSAGEICAVVGLDAATGDTLCDEKHPI
FT                   ILEKLEFPDPVISMAIEPKTKKDQEKLSQVLNKFMKEDPTFRATTDPETGQILIHGMGE
FT                   LHLEIMVDRMKREYGIEVNVGKPQVAYKETIRKKAIGEGKFIKQTGGRGQYGHAIIEIE
FT                   PLPRGAGFEFIDDIHGGVIPKEFIPSVEKGVKEAMQNGILAGYPVVDVRVRLFDGSYHE
FT                   VDSSDIAFQVAGSLAFKDAAKKADPVLLEPIMEVEVETPEKYVGDVIGDLNSRRGKIMG
FT                   MENKGVITVIKAHVPLAEMFGYATTLRSLTQGRGTFIMKFSHYDEVPQQIAEKIIGERM
FT                   AGKSS"
FT   gene            2117..3334
FT                   /gene="tufA1"
FT                   /locus_tag="aq_005"
FT   CDS_pept        2117..3334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA1"
FT                   /locus_tag="aq_005"
FT                   /product="elongation factor EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:aq_005"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06403"
FT                   /db_xref="GOA:O66429"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66429"
FT                   /protein_id="AAC06403.1"
FT                   /translation="MAKEKFERTKEHVNVGTIGHVDHGKSTLTSAITCVLAAGLVEGGK
FT                   AKCFKYEEIDKAPEEKERGITINITHVEYETAKRHYAHVDCPGHADYIKNMITGAAQMD
FT                   GAILVVSAADGPMPQTREHVLLARQVNVPYIVVFMNKCDMVDDEELLELVELEVRELLS
FT                   KYEYPGDEVPVIRGSALGALQELEQNSPGKWVESIKELLNAMDEYIPTPQREVDKPFLM
FT                   PIEDVFSISGRGTVVTGRVERGVLRPGDEVEIVGLREEPLKTVATSIEMFRKVLDEALP
FT                   GDNIGVLLRGVGKDDVERGQVLAQPGSVKAHKRFRAQVYVLSKEEGGRHTPFFVNYRPQ
FT                   FYFRTADVTGTVVKLPEGVEMVMPGDNVELEVELIAPVALEEGLRFAIREGGRTVGAGV
FT                   VTKILD"
FT   gene            3346..3660
FT                   /gene="rpsJ"
FT                   /locus_tag="aq_008"
FT   CDS_pept        3346..3660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="aq_008"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:aq_008"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06399"
FT                   /db_xref="GOA:O66430"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="PDB:3R2C"
FT                   /db_xref="PDB:3R2D"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66430"
FT                   /protein_id="AAC06399.1"
FT                   /translation="MEQEKIRIKLRAYDHRLLDQSVKQIIETVKRTGGVVKGPIPLPTR
FT                   KRKWCVLRSPHKFDQSREHFEIREFSRILDIIRFTPQTIEALMEISLPAGVDVEVKMRG
FT                   "
FT   gene            3665..4390
FT                   /gene="rplC"
FT                   /locus_tag="aq_009"
FT   CDS_pept        3665..4390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="aq_009"
FT                   /product="ribosomal protein L03"
FT                   /db_xref="EnsemblGenomes-Gn:aq_009"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06393"
FT                   /db_xref="GOA:O66431"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66431"
FT                   /protein_id="AAC06393.1"
FT                   /translation="MPLGLIGEKVGMTRVLLKDGTAIPVTVIKFPVNYVVQVKSQNTKD
FT                   GYNALQIGAYEAKEKHLTKPLIGHFKKHGVPLLRRLWEFRVDNPEEFQSGQQLKVEDVF
FT                   KPGDLVDVWGISKGRGFAGAMKRWDFAGFPKSHGHRYHRAVGAIGQRTDPGRVWKGKRM
FT                   PGHYGAKPVRVQGLFVVDVLPEENAILVKGSVPGHNKGIVVVEQSTIAYRKSQKLKQKR
FT                   YQFIIENLAKEESQEVAES"
FT   gene            4387..4986
FT                   /gene="rplD"
FT                   /locus_tag="aq_011"
FT   CDS_pept        4387..4986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="aq_011"
FT                   /product="ribosomal protein L04"
FT                   /db_xref="EnsemblGenomes-Gn:aq_011"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06394"
FT                   /db_xref="GOA:O66432"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66432"
FT                   /protein_id="AAC06394.1"
FT                   /translation="MKIGDVEVRDDVFNVKVKKHVLWEVVKWQLAKRRQGTHSTKTRGE
FT                   VAYSGRKILPQKGTGNARHGERGVNIFVGGGVAHGPKPRDYEYPLPKRVRKLGLKMALS
FT                   DKARNNAIIFVDNIDLGKKPKTKKAIEFLKNLGVEKEKVLVVIPEKADVLYKSFRNLPN
FT                   VRVLLPEGLNVYDVLWANKLVIQKDCLDRIYKKVEA"
FT   gene            4990..5301
FT                   /gene="rplW"
FT                   /locus_tag="aq_012"
FT   CDS_pept        4990..5301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="aq_012"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:aq_012"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06397"
FT                   /db_xref="GOA:O66433"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66433"
FT                   /protein_id="AAC06397.1"
FT                   /translation="MSQRKPWEIIIRPIITEKSNRLMEDYNKYTFEVALDASKPEIKYA
FT                   VEKLFNVKVKKVNTMIVKPKKKRVWNKFRQYGTTKKWKKAIVTLEKGHKIDILEFAQK"
FT   gene            5313..6227
FT                   /gene="rplB"
FT                   /locus_tag="aq_013"
FT   CDS_pept        5313..6227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="aq_013"
FT                   /product="ribosomal protein L02"
FT                   /db_xref="EnsemblGenomes-Gn:aq_013"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06392"
FT                   /db_xref="GOA:O66434"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66434"
FT                   /protein_id="AAC06392.1"
FT                   /translation="MGVRKLKPVTNGTRHAVLYDFEEIEKLVRKGKEWVLLKKNQVEPE
FT                   KSLLKWWHRAKGRSRQRGNITARHRGGGHKKLYRIIDFKRDKSLVPAKVVSIEYDPFRS
FT                   ARICLLHYADGEKRYIIWPEGLKVGDTVMSISWEDAEAGKPLPEIKPGNAMPLKYIPEG
FT                   TIVHNIEFIPGKGGQIARAAGTWAQVLGRSTRKGYVLVRMPSGEVRMIHERCMATVGRV
FT                   GLAEHELVKLGKAGRARWLGWRPHTRGTAMNPVDHPHGGGEGRTRGKHPESPWGWKTKG
FT                   YKTRRGKKYSDQFIVTRRDGRPL"
FT   gene            6340..6900
FT                   /gene="rpsS"
FT                   /locus_tag="aq_015"
FT   CDS_pept        6340..6900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="aq_015"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:aq_015"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06401"
FT                   /db_xref="GOA:O66435"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66435"
FT                   /protein_id="AAC06401.1"
FT                   /translation="MREAIKRYGSFELLKGKNTLPELEALLEERKLVLENLKKQLKEAH
FT                   KGKPKIEAEGDEKLKELIREVNKAQAEVRALEIIVNRVRKYEELYAQYKQMTEKKAYVD
FT                   PKLWVRIRKMNETGERKVVRTYSRATTIIPEFVGHTIAVHNGKTFVPVYITQDMVGHKL
FT                   GEFAPTRTFKGHPEKTAKVVKKK"
FT   gene            7018..7314
FT                   /gene="rplV"
FT                   /locus_tag="aq_016a"
FT   CDS_pept        7018..7314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="aq_016a"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:aq_016a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06396"
FT                   /db_xref="GOA:O66436"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66436"
FT                   /protein_id="AAC06396.1"
FT                   /translation="MFSGKFREKTWETPFTCFAVIPKKAARIAEKVLKSVIANAEQKGL
FT                   DLDRLYIKKAVADDGPILKKWIPRAHGRATMVRKRLSHITIVLEEKPEGKEEE"
FT   gene            7317..7955
FT                   /gene="rpsC"
FT                   /locus_tag="aq_017"
FT   CDS_pept        7317..7955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="aq_017"
FT                   /product="ribosomal protein S03"
FT                   /db_xref="EnsemblGenomes-Gn:aq_017"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06398"
FT                   /db_xref="GOA:O66437"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66437"
FT                   /protein_id="AAC06398.1"
FT                   /translation="MGQKTHPIGFRLGVIKEWPSKWYAPKKEYSKLLHEDLKIKNYIKE
FT                   RYKVAGVSKVEIERIVDKVRVKIHTARPAIVIGRRGQEVENLKKTLEKMLPGKEITISV
FT                   VEVRVPELDAQLVAQDIATQIERRVSHRRAMKRAIDNALKAGAKGVKVQVKGRIGGAEL
FT                   ARKEWFLVGRMPLQTLRADIDYGFATAYTKYGILSVKVWIYKGDVLNGR"
FT   gene            8017..8445
FT                   /gene="rplP"
FT                   /locus_tag="aq_018"
FT   CDS_pept        8017..8445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="aq_018"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:aq_018"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06395"
FT                   /db_xref="GOA:O66438"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66438"
FT                   /protein_id="AAC06395.1"
FT                   /translation="MYLQPKKVRWRKQRRGTLKGKAFRGNKLAFGEYGIQALDRAWITQ
FT                   QQIEAVRVALVRSLKKGAKVWIRIFPDKPYTKKPNEVRMGGGKGDPEGFVAVVKPGRIL
FT                   FEFTGVPEEVAQEAFTIAASKLPIPVRLVKYGEFTFKY"
FT   gene            8678..9001
FT                   /gene="rpsQ"
FT                   /locus_tag="aq_020"
FT   CDS_pept        8678..9001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="aq_020"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:aq_020"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06400"
FT                   /db_xref="GOA:O66439"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66439"
FT                   /protein_id="AAC06400.1"
FT                   /translation="MTEQKQQKKWHEKRKHLVGVVVSDKMDKTVVVKVDRKVPHPIYGK
FT                   HIIKSKKYHAHDEHNECRVGDIVMIRETRPLSKTKRWVVVKILQRARRPEEEIQKQQEG
FT                   QEQ"
FT   gene            9001..9660
FT                   /gene="aroD"
FT                   /locus_tag="aq_021"
FT   CDS_pept        9001..9660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="aq_021"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_021"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06389"
FT                   /db_xref="GOA:O66440"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="PDB:2EGZ"
FT                   /db_xref="PDB:2YSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66440"
FT                   /protein_id="AAC06389.1"
FT                   /translation="MLIAVPLDDTNFSENLKKAKEKGADIVELRVDQFSDTSLNYVKEK
FT                   LEEVHSQGLKTILTIRSPEEGGREVKNREELFEELSPLSDYTDIELSSRGLLVKLYNIT
FT                   KEAGKKLIISYHNFELTPPNWIIREVLREGYRYGGIPKIAVKANSYEDVARLLCISRQV
FT                   EGEKILISMGDYGKISRLAGYVFGSVITYCSLEKAFAPGQIPLEEMVELRKKFYRL"
FT   gene            complement(9657..10157)
FT                   /locus_tag="aq_022"
FT   CDS_pept        complement(9657..10157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_022"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_022"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06404"
FT                   /db_xref="GOA:O66441"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:O66441"
FT                   /protein_id="AAC06404.1"
FT                   /translation="MYALLVISLYLQRFYNLSIIPQLILLSPLLFQDEKSLGFKNFKKG
FT                   LTYGSLFLPFSVPYLLSAQCYALVLNQLGIALAEEIFFRGFLMQKFSNFTVSLMSTSAH
FT                   LAYWANLNALLTFFPSLFFGWLYRKTDSVIAPAFAHFSANMFYFFFIERFPELGELLQR
FT                   SLI"
FT   gene            complement(10169..11299)
FT                   /gene="argD"
FT                   /locus_tag="aq_023"
FT   CDS_pept        complement(10169..11299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="aq_023"
FT                   /product="N-acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_023"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06390"
FT                   /db_xref="GOA:O66442"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:2EH6"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66442"
FT                   /protein_id="AAC06390.1"
FT                   /translation="MTYLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGH
FT                   AYPKLTEALKEQVEKLLHVSNLYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAI
FT                   KLARKYWRDKGKNKWKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDI
FT                   DSVYKLLDEETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRT
FT                   GEFYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEVAQSFTPGSHGSTFGGNPLACRA
FT                   GTVVVDEVEKLLPHVREVGNYFKEKLKELGKGKVKGRGLMLGLELERECKDYVLKALEK
FT                   GLLINCTAGKVLRFLPPLIIQKEHIDRAISVLREIL"
FT   gene            complement(11296..12609)
FT                   /gene="nsd"
FT                   /locus_tag="aq_024"
FT   CDS_pept        complement(11296..12609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nsd"
FT                   /locus_tag="aq_024"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_024"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06391"
FT                   /db_xref="GOA:O66443"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O66443"
FT                   /protein_id="AAC06391.1"
FT                   /translation="MKLSVIGGGYVGLVTAACFSHLGHEVLVVEKIPEKVELLRRGKSP
FT                   IYEPGLEELLREGINEGRLSFTTDIKEGIEFSEVIFICVGTPSNPDGSADLSQVEEVAR
FT                   FTAKYMDSYKLLVNKSTVPVGTQRKVKRTVRLYLKNKELEFDVASNPEFLREGHAVKDF
FT                   LEPDRIVVGVESERAKEVLLEIYKPITDKGFPILITNPPTAEIIKYASNTFLATKISFI
FT                   NMISDLCEKVGANVEEVAQGMGYDKRIGKEFLRAGLGWGGSCLPKDTKAFIRILEELGV
FT                   DATILKGALGINESRVDRLLQKLKDALWILKGKTIAIWGLSFKPNTDDIREAPSLKVVE
FT                   RLLREGAKIRAYDPKATENFKRVFIEGEDLRYFDDKYKAVEGAEALLILTEWDEFKRAN
FT                   LERVKRLMELPIIIDGRNIYDPQEVRNLGFEYYSMGRP"
FT   gene            complement(12887..14005)
FT                   /gene="rodA"
FT                   /locus_tag="aq_025"
FT   CDS_pept        complement(12887..14005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="aq_025"
FT                   /product="rod shape determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:aq_025"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06406"
FT                   /db_xref="GOA:O66444"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:O66444"
FT                   /protein_id="AAC06406.1"
FT                   /translation="MRFLEELRELDFFLLLILLCIQGFGLVAVYSATYDGGTSPFFYKH
FT                   LTYVILGWLLIIFLSFEKFENLLDLSFYIYLFNLLLLMAVLLYGKEVYGAKRWLHLGFF
FT                   NVQPSELMKFSLILVSAYLLPAIKSIKDRKVFLLFLIYAIPSLVTLKQPDLGTTVSYYV
FT                   PLVFMLFVRGVPLRYFILAGMAFLAFLPLAWKYFLKPYQKKRILAVIDPMSDYYGSGYQ
FT                   LIQSKIAIGSGMLTGKGLLSGTQTHLFFLPEKHTDFIFAVIGEELGFIGTFILCSLFLL
FT                   LFLRLIQYHEMAQRLSEKLFIAGTFSLILFQFTVNTLMTMGMFPVVGIPLPFVSVGGSA
FT                   TITFSAMIGVTQYIYKKYRYPYMKLEKDGIYE"
FT   gene            complement(14174..14656)
FT                   /locus_tag="aq_026"
FT   CDS_pept        complement(14174..14656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_026"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_026"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06410"
FT                   /db_xref="GOA:O66445"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:O66445"
FT                   /protein_id="AAC06410.1"
FT                   /translation="MKKLLAGVLVSAIAFAKPVFMDAEWAKQFCEVWNNTPELVEKLGK
FT                   SESWTEVPERKLFLYRKDCGPEKQIQLTIKNENGRAVCVYGGWKKDEKTDNDFLMYADT
FT                   KRWLEMGRKEYGPMKAMLFGRLKFEGPRFVAMKNMGPFEAFLDKIDEVEADTSRCP"
FT   gene            complement(14676..16454)
FT                   /locus_tag="aq_027"
FT   CDS_pept        complement(14676..16454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_027"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06414"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:O66446"
FT                   /protein_id="AAC06414.1"
FT                   /translation="MQTVYRLRKKDGSYVWIYANAKVVSKEGNLYRVAGYWVDITNLKE
FT                   LEEKLKEEKKLFETLAQNLPAGLLLLKGGKIIFVNDYTLKLFGYTRHEVMNKSPFEFLP
FT                   FHYRKRAQKVLNEAGTCIEKPKEYTLKLKTKKGEDKYVRLYIISFKKDEECIVLILFTD
FT                   VTNEILLRKKVYYLAFFDQLTGLPNRHLFIMLLQRFIHDEETNNLHVCMLNLKNFGEIN
FT                   FLFGFDKGDEILKEIANRLRTLVKEGAAARLSGKAFGIALRNKEREEVVELVEKLSKEK
FT                   VDSVDLNIKAGISSYPQDGENPKELLEKAELALLFAKNTVNFYKKEYEEKLKKELRIKE
FT                   FLEESIEKKEFGVVYQPIVSLKDFRPVGAEALVRWYHPELGEVPPSIFVPVAEKYGLVS
FT                   QINYIVMEKAFRELSDFVKEREFYLSINVNAEQFYSVELIQKLIEFEEKFKFPLRNVIL
FT                   ELTERALMAKSEKAVEILSELKKLGVKIAIDDFGTGYSSMHYLVEFDVDEIKIDKSFID
FT                   KMLENVNAWQVVRNIIELTHNLNALALAEGVENEEQIRELKKLLCDEAQGYYFSPPLPF
FT                   KKLIEFVENERQNLIK"
FT   gene            complement(16527..17006)
FT                   /locus_tag="aq_028"
FT   CDS_pept        complement(16527..17006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_028"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_028"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06411"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="UniProtKB/TrEMBL:O66447"
FT                   /protein_id="AAC06411.1"
FT                   /translation="MYSKIIERELETLKTIFQEASRANTHYEFISVVGKAVSEFLGSEG
FT                   YRIEWDGRGSAKGNEVVLEIRINTYAKVNLYFPLKKGRKLSKVEEEFLKFVKEVSERIA
FT                   EKITSYTIYKTLLDSYPFVAYLVEAEPPYPQKILYVTPSLEKWLGWKPEEISKDW"
FT   gene            17053..18261
FT                   /gene="moeA1"
FT                   /locus_tag="aq_030"
FT   CDS_pept        17053..18261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA1"
FT                   /locus_tag="aq_030"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:aq_030"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06407"
FT                   /db_xref="GOA:O66448"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:O66448"
FT                   /protein_id="AAC06407.1"
FT                   /translation="MKNLTPLEEALKIVLENVKPLESERVFIHEALGRVLAEDVVSDTD
FT                   KPLFDNSAMDGYAVRWEDIKEVPAKLKVIGEYAAGTGENLKVEKGTAVKIFTGAPIPEG
FT                   ADTVVPVEYTETQDGYVIVKKSFKQGANVRRRGEDVKKGEVVIPKGKEIRPYEMGMLAS
FT                   VNRAVVSVYRKPHVGILSTGDEILDVCEEQTKPSQIRTSNNYTVYGQVLQAGGIPHNLG
FT                   IAPDEPQKLKEIMRSIHKYDIFITTGGVSMGEKDYVQYLVEDLGIDVKFHKLRIKPAKP
FT                   VLFGVYGENKLFFGLPGNPVSAAVAFDLLVYPAIKAMQGHREVFKQKVTAILEGDYRRK
FT                   NADRREFARCRVWFENGRYHCEPYPKQDSHMLTSLVNSNAYMVVYEGVNELKKGQEVEV
FT                   ILF"
FT   gene            18275..19615
FT                   /gene="trnS"
FT                   /locus_tag="aq_031"
FT   CDS_pept        18275..19615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trnS"
FT                   /locus_tag="aq_031"
FT                   /product="transporter (Pho87 family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_031"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06409"
FT                   /db_xref="GOA:O66449"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:O66449"
FT                   /protein_id="AAC06409.1"
FT                   /translation="MNKNVFLVLAILVFFGVLITSPFEGNVNKGIAILLLAAILWITEA
FT                   LPLPVTALLIPVSGVLLGVFDVKTALSYFAHPLIFLFFGGFVLAVALSKYQIDEYIAHK
FT                   IVSVAQGKFLPSVFLLMLATSLISMWISNTSTTAMMLPLALGILAGVRETEREKVFPFV
FT                   LLGIAYSASVGGIGTLVGSPPNGIAAGILGLSFPDWLKFGIPVFLILFPLLFAILFLVF
FT                   RPTSDLKVERVQEIKFEFTPQRVLVLLIFLFTALAWIFSKKIAPIFEVKKYFDTVVALL
FT                   AVVALFIFRLLDWRDVKEGVSWGTLLLFGGGIALSGIMKKTGTAKFISQELVDVLHGLP
FT                   TFLFLLTIVLFVIFLTELMSNTATTALIAPILFSTAQMIGKPPEMLVIPAAVAASCAFM
FT                   LPVATPPNAIVYGTGYIKQSQMMRVGLILNIVFSIVLAAFFTVYVGG"
FT   gene            19620..21062
FT                   /locus_tag="aq_032"
FT   CDS_pept        19620..21062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_032"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06415"
FT                   /db_xref="GOA:O66450"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:O66450"
FT                   /protein_id="AAC06415.1"
FT                   /translation="MGLKEKLIRKGKYIWELPKETIEGQRVPVILYLSDALFELLEEDA
FT                   LRQAANAATLPGVEKAIYVMPDVHVGYGFPVGGVMATNTETGIISPGSIGYDINCGVRL
FT                   IATNLKAVDVAPRIKEIMNNMLKNVPAGVGSTSEIKLSKSQMKEVLVKGAGWAVEHGFG
FT                   FPEDLQHIEGFGALPNADPEKASHEAYERGSDELGTVGSGNHFVEVQAVEQIYEPEIAE
FT                   KLGIWEGQVMVMVHSGSRGFGHQVCTDYLRVALKVRDKYKIKLPDPQLACMPFNSPEGQ
FT                   AYFKAMNAAANYAFANRQILGFKAANTVRKTLGISWEEFGYRLIYDHAHNIGKVEKHEV
FT                   DGKKVEVIVHRKGATRAFPPYNPEVPPAYREVGQPVIIPGDMGRASFLLVGQTNSMKMS
FT                   FGTACHGAGRVMSRRQAKKYVKEVGLEKVIGNLVVVARGKGTIMEEIPQAYKDVTEVVR
FT                   VIDELGIAKAVARLKPLGTLKG"
FT   gene            complement(21051..22346)
FT                   /locus_tag="aq_035"
FT   CDS_pept        complement(21051..22346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_035"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06416"
FT                   /db_xref="GOA:O66451"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:O66451"
FT                   /protein_id="AAC06416.1"
FT                   /translation="MSIKKKITSYSVIFFVLYIIFVSVVVYLDFKALNNKKSREFYENL
FT                   VVTCTEIKKLMYGKEENPLVFFYKFSNIVLKILRSEGVILYDNSKYGKFNQNLHKVSLI
FT                   YGDFVVIGNIKPDFLEKIFPVEPYGNVGSVINPVFVARYPLLWEGKVFGYLITWKEFNN
FT                   LNFTVFGIFGTSLVFFLVYVLVISRYLSSISKDLKFLSGIIKGVAKKEFSKTDLLRENA
FT                   MRSKDKDSEIYELKVAVIKMIETLKKILIETSKEKTLYERMALTDPLTGLYNRRVFTEM
FT                   AEKELAKAKRYGYNFSILMIDIDNFKKINDTYGHDVGDLVLKKISEILKRNVRGADLVA
FT                   RFGGEEFIVMLSNTNLNGAVKKAEQLRRMIEQTPIELPNGEKLRVTVSIGVSTYRGHES
FT                   LEELIKEADQALYEAKRKGKNRVEVFRESLTL"
FT   gene            22379..22885
FT                   /locus_tag="aq_036"
FT   CDS_pept        22379..22885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_036"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06417"
FT                   /db_xref="GOA:O66452"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66452"
FT                   /protein_id="AAC06417.1"
FT                   /translation="MRIVFGGSFDPVHVGHIILARDVCEHFNAKEVIFVPTYQAPLKEK
FT                   HKASAQDRLNMLKLALEREEKFTIEDYEIRRKGISYTVYTLKYLKEKYGGEELYLLLGS
FT                   DSFLKFHKWKEPREILKLAKIIVVEREGMLEKVKEYIKEYFPELRKNEDIFFYKGRRID
FT                   ISSTE"
FT   gene            22998..23525
FT                   /locus_tag="aq_037"
FT   CDS_pept        22998..23525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_037"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_037"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06412"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:O66453"
FT                   /protein_id="AAC06412.1"
FT                   /translation="MKLKSKLSYEDIRRLPEGSYEVINGEVVELVPTGFEHGEYELDLG
FT                   AFLREKLKNKGYVAVGEVGVLISKEPLRIRSADVVYISKKRTPERPKGILDVPPEIVIE
FT                   IVSPNNTYSEIEEKVFDYLSAGVDRVLIVDPKVRKATLFEKGKREAKIYDFDEEFELLE
FT                   GLKLRLSEVLSS"
FT   gene            23541..24407
FT                   /gene="hibD"
FT                   /locus_tag="aq_038"
FT   CDS_pept        23541..24407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hibD"
FT                   /locus_tag="aq_038"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_038"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06408"
FT                   /db_xref="GOA:O66454"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O66454"
FT                   /protein_id="AAC06408.1"
FT                   /translation="MKVGFIGLGHLGRAIAKRLIEQGVELIVWNRTLSKAHEFAKETGA
FT                   EVTSSPADLINKVDRVFVIVFDSQASEEVIFGEKGLVKGDIKGKTVIDMTTNHYLYAQK
FT                   AYEELKKLGAFYLDAPVLGSVIPALKGELTIVVGGDKEKFEENKPLFEKFCRAIYYLGE
FT                   AGMGSKMKLVNNIVLGGIMEVLAEAIAIGEKAGIDKETLINVLNDGAGKSYILDVKKKK
FT                   LLEEDFSTHFSVNLIYKDLHYAQDLIKDLGLFSFTTAAVKETYGLARKEGFGNLDFSAV
FT                   YKLFKED"
FT   gene            complement(24404..24982)
FT                   /gene="hisB"
FT                   /locus_tag="aq_039"
FT   CDS_pept        complement(24404..24982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="aq_039"
FT                   /product="imidazoleglycerolphosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_039"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06405"
FT                   /db_xref="GOA:O66455"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66455"
FT                   /protein_id="AAC06405.1"
FT                   /translation="MREAEVFRETRETKIKLYINLDGSGNYEVNTPVGFLTHMLESFAK
FT                   HGRFDLKVEAEGDVHVSHHHTVEDCGIVLGQAVLKALGDKKGIRRYGYSIIPMDEALVL
FT                   SSIDISGRPLFFYEDKDLRGKITEFDFELIWEFFKGFALESRSTLHIKVLDGKILHHVA
FT                   EACFKSFAITLKEAVKVEGSGVPSTKGVI"
FT   gene            complement(24997..26217)
FT                   /locus_tag="aq_040"
FT   CDS_pept        complement(24997..26217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_040"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_040"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06413"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:O66456"
FT                   /protein_id="AAC06413.1"
FT                   /translation="MSVQELKEIFSELKIYEYLTVLKKGKPIGIVFRKDVEGITRKDLL
FT                   TGELSRLAVKVKDLNLSKEGLIGIMELLPIVKEPIIITDKKGNYLGVLTYDVLLHYITK
FT                   YKEFVIPLIQHIRESLGTDQYLYIFGIKNFKGFRDKFGYEKAKGLLKILKEDIQESISG
FT                   EVEEIEEKEEIWAVSKEPPEKERIKHLFEEFFREYTVLFADYPHIALYGMSINLKLFES
FT                   LDKLNEKIKELRERAKNVSGYIFIVQGLQPKLILYDPRRKKVLKNIKEKIMSDFEKVLN
FT                   EVVNAPKELWEFTLYDAFKKYPYFELFYIMSSSGLQISNNVINPNASYFIAQGKKGTDR
FT                   SEKPYFKEAMEKGEYISDIYLSKATDDFCITVSKKFQYEGKVYVLAGDINFKEIHKLIK
FT                   ETPRKRR"
FT   gene            complement(26274..26585)
FT                   /locus_tag="aq_041"
FT   CDS_pept        complement(26274..26585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_041"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_041"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06429"
FT                   /db_xref="GOA:O66457"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66457"
FT                   /protein_id="AAC06429.1"
FT                   /translation="MKGREYEDLAARYLKSKGYQILGRNLRSPYGEIDILAEFEGRKVI
FT                   VEVKGSETFFPAEKVTPHKLSKIIRTAYEVLGEEPFSIEVVVVYRGKVYHYKDLGLEL"
FT   gene            complement(26618..27340)
FT                   /gene="cyc"
FT                   /locus_tag="aq_042"
FT   CDS_pept        complement(26618..27340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyc"
FT                   /locus_tag="aq_042"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:aq_042"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06422"
FT                   /db_xref="GOA:O66458"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:O66458"
FT                   /protein_id="AAC06422.1"
FT                   /translation="MNTWGLIKTIFFAGSTLVFFFLLWFYNPFKHVEHYEVDEEVKAII
FT                   DNPWKKTESGKTIAEEGRELFIASCSSCHSLRYDGIYIMSVAANPKWKNIEKTSGRPVY
FT                   RFGTLYKDRFFVPKDVYEAFAHDDIQGLKASLGQVPPDLSSMYLARGEGYLYQFILNPQ
FT                   KVLPGTTMPQLFNPQFDPQAKEKVAKIVAYMKSVNTPPPKESAKRTVMGVIVIAYFIVM
FT                   GLLLWKYRENLLKRLGYH"
FT   gene            complement(27337..28566)
FT                   /gene="petB"
FT                   /locus_tag="aq_044"
FT   CDS_pept        complement(27337..28566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="aq_044"
FT                   /product="cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:aq_044"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06424"
FT                   /db_xref="GOA:O66459"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:O66459"
FT                   /protein_id="AAC06424.1"
FT                   /translation="MGLIEKIVDWIDERAHVREIYRTQMVEYKVAKNLTFPYVFGILAL
FT                   VTFAIQIISGMVLILYYNLQSQTLLTVHLLDNGRNSLRMALQAHTRTGANFFMAIVYLH
FT                   MFTGIYYNAYKRPRELVWIVGWLIYFVLILTALSGYLLPWGQLSYWGFIVTTEIPGSLA
FT                   DAPILKPIFKAIAETIVLWMKGGYVVTDVTLGRVFGSHVLIYPLILLALVGIHLYLVRA
FT                   AGISNPEGIEYDKKKNPDKFVPFHPYMTLKEGAYVMWYLAVFFFFVFFHISHFLPPENF
FT                   EPANPLKTPAHIAPEWYLLGYYEVFRSIPSKFWGFVAFNALLLLLLLLPFLDFSPLKSA
FT                   RRRPLFFVMFVIFMISSMALTILGTMPPTPQNAKLGLIFAALVFAFFISLPIISFIEYG
FT                   WYKAKGGQQE"
FT   gene            complement(28580..29125)
FT                   /gene="petA"
FT                   /locus_tag="aq_045"
FT   CDS_pept        complement(28580..29125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="aq_045"
FT                   /product="Rieske-I iron sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_045"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06423"
FT                   /db_xref="GOA:O66460"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:O66460"
FT                   /protein_id="AAC06423.1"
FT                   /translation="MEASRRDFISIGIGALGAVGGLGALYALVRVMLEPSEIAALGAKT
FT                   EIDVSKIQPMQVRVTSWKGKTLFAIRLPKDFKPEGYTLKKGALNSKGTTNYEILKGHDV
FT                   FALVGVCTHLGCIPLWKPQGEGGINKPVFHCPCHGGLYTPYGDVIGGPPPRPLFIPPQK
FT                   LEGNKLIVGVEGFVKELI"
FT   gene            29251..30171
FT                   /gene="pyrD"
FT                   /locus_tag="aq_046"
FT   CDS_pept        29251..30171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="aq_046"
FT                   /product="dihydroorotase dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_046"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06426"
FT                   /db_xref="GOA:O66461"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66461"
FT                   /protein_id="AAC06426.1"
FT                   /translation="MDLSVELFGIRFKNPVWVASGTFGYGVEAAEIYDISKLGAVVTKG
FT                   LSLKERLGNETPRIVETPCGMLNSIGLQNPGVEKFLKEIYPKIKDVDTHFIANVFGETE
FT                   EEYVEVCMALEDADKIVAYELNVSCPNVKKGGILFGHDPVILGNLVDRIKAKIKKPLLV
FT                   KLSPNVTDVTEFAKVCIENGADGLVLINTLMGMKINIWKRKPDLATKTGGLSGPAILPI
FT                   AVRMIYQVYEKFGDRIPIIGVGGITTWEDAMEHVMAGASAVQVGTANFYEPLAPLKVIE
FT                   GIENFMKSQNIKDFKELIGIAHRVE"
FT   gene            30179..30478
FT                   /gene="phhB"
FT                   /locus_tag="aq_049"
FT   CDS_pept        30179..30478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phhB"
FT                   /locus_tag="aq_049"
FT                   /product="pterin-4a-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_049"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06420"
FT                   /db_xref="GOA:O66462"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66462"
FT                   /protein_id="AAC06420.1"
FT                   /translation="MVRKLSEEEVKRELENLEGWEFCKDYIQKEFSTKNWKTTIFVVNA
FT                   IASLAEAQWHHPDLEVSFKKVKVKLTTHEAGGITERDIKLAKSIDELVKEILKH"
FT   gene            30475..33036
FT                   /locus_tag="aq_050"
FT   CDS_pept        30475..33036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_050"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_050"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06430"
FT                   /db_xref="GOA:O66463"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:O66463"
FT                   /protein_id="AAC06430.1"
FT                   /translation="MIFFLFLIFSLSFGFEVYIKSNYPLKKDNLRHVINEKNYAKILEM
FT                   LKQIPEIREVRYEKRKDKLLIYVERYPIIKEIKIKGNVFLRDEDVKNVLGIEEGIPLIE
FT                   DNPKTYEEILEKYYKEIGFLNADTKVNISLDDKGNAIFYINIREGNLYFLEDIQFEGVK
FT                   KLQKKELIKASGLVIGSIFDIDKVEDAEENLENFYRKKGFFESFVYLKGIKKEKLKRKF
FT                   REALFPETDSFLKSLSIGLKNLVNHPLATLKALIGKGKVGIPVYEVYEGERYELKFLGN
FT                   KFFSDEYLYSLFDINTVGVDILVLEGFKDKIEEEYRKKGFFDVNVEYELEDHRILIKIK
FT                   EGERYKAKVYINGKKIEIPYDEEKIQDLISKEIQYLEKMGYVTATYELKKKINKDKKEV
FT                   NVHVKINKGMRYIVWSFKIESELFEDLNEKISLKFPKALDYETLDEIYKEINKRLREKG
FT                   YFDAKVFTDIRMQKVKDALLMFYKVKVIPGERYEYGDTLIYGLEKTRLKEAEYVLEKEK
FT                   YFSKEVEERSVWNAIESEIFKSLRLEDYVDRESKKVHRLAYFQEKKRGVIGLSAGFNTF
FT                   EGFKLSAELSLRNLLGIGLINTNTFSISEKYELYRVSFKDNFLFSRRFFGETSLFKDYE
FT                   EHDTYELFTEGFAFSLGYRLKPFTFVGISFSNFEAKTTGAERDKGTYRKLGLSFSVKER
FT                   FRLVLFRGYGHRNYSKIELEGKIKKEFFEKFGSRLKFSYGYATKKAPIFERFFLGGYKR
FT                   MKGYTYESIGSPLGGRQMLYISPEIYYLLNRNLELITFLELGKVENKFPSLYKNMKKDI
FT                   GFSAGFRTPVGLIRGDIAYPLEDFKVKPSRLKFYLSVEFFF"
FT   gene            complement(33033..33887)
FT                   /gene="ubiA"
FT                   /locus_tag="aq_052"
FT   CDS_pept        complement(33033..33887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="aq_052"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_052"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06421"
FT                   /db_xref="GOA:O66464"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:O66464"
FT                   /protein_id="AAC06421.1"
FT                   /translation="MMKKVRAYAELVKFEHTIFALPFALASVLLLAEEFPSLWKIFWIL
FT                   VALVSARTVGMAFNRLIDEPYDRLNPRTKNWPLVKGEVSKEEVRKIILVGSILFVFASL
FT                   MLNFLAFLLSPVVLFLLWFYPQAKRITYYPHLVLGLVYFLIPVAVDVALNERISLTAVI
FT                   LGIAMAFWVAGFDVLYALQDYEFDKEVGLKSIPVKYGVEKAIKIARLFHSITFVSLLIL
FT                   GFTHKELGFIYFLGLFLIAGFLVYEHSLIKPWDLSKINKAFFTVNGWISVIFFIVVLID
FT                   YYL"
FT   gene            complement(33884..34963)
FT                   /gene="mraY"
FT                   /locus_tag="aq_053"
FT   CDS_pept        complement(33884..34963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="aq_053"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_053"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06418"
FT                   /db_xref="GOA:O66465"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="PDB:4J72"
FT                   /db_xref="PDB:5CKR"
FT                   /db_xref="PDB:6OYH"
FT                   /db_xref="PDB:6OYZ"
FT                   /db_xref="PDB:6OZ6"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66465"
FT                   /protein_id="AAC06418.1"
FT                   /translation="MLYQLALLLKDYWFAFNVLKYITFRSFTAVLIAFFLTLVLSPSFI
FT                   NRLRKIQRLFGGYVREYTPESHEVKKYTPTMGGIVILIVVTLSTLLLMRWDIKYTWVVL
FT                   LSFLSFGTIGFWDDYVKLKNKKGISIKTKFLLQVLSASLISVLIYYWADIDTILYFPFF
FT                   KELYVDLGVLYLPFAVFVIVGSANAVNLTDGLDGLAIGPAMTTATALGVVAYAVGHSKI
FT                   AQYLNIPYVPYAGELTVFCFALVGAGLGFLWFNSFPAQMFMGDVGSLSIGASLATVALL
FT                   TKSEFIFAVAAGVFVFETISVILQIIYFRWTGGKRLFKRAPFHHHLELNGLPEPKIVVR
FT                   MWIISILLAIIAISMLKLR"
FT   gene            complement(34963..35580)
FT                   /locus_tag="aq_054"
FT   CDS_pept        complement(34963..35580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_054"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_054"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06431"
FT                   /db_xref="GOA:O66466"
FT                   /db_xref="InterPro:IPR019230"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66466"
FT                   /protein_id="AAC06431.1"
FT                   /translation="MNTEIIVLFIIHFIMINENVFIALLHYPAMDKDGKIIVTSFTTMD
FT                   LHDIARPARAYEINKYYIVQPIDAQRIVIQRQINYWLSEEGRKANPTRYEIVQLVRLAY
FT                   TLDEVIEDIEKERGRRPLLVGTDARTYPNTVKYSWLRNEIQKRDRDWLIVFGTGHGIPP
FT                   DLMNTFDYILEPIYGAGDWNHLSVRNAVAIILDRLFSRNRCD"
FT   gene            35564..36322
FT                   /gene="hemX1"
FT                   /locus_tag="aq_055"
FT   CDS_pept        35564..36322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemX1"
FT                   /locus_tag="aq_055"
FT                   /product="cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_055"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06427"
FT                   /db_xref="GOA:O66467"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:O66467"
FT                   /protein_id="AAC06427.1"
FT                   /translation="MISVFISLLAYIFAFFSFLLKNFSKKEIKFLPNFFLTLGFIFYIL
FT                   TLLERFVQTKTFPVGDVYGMISLVGNLSVLLFLTFSRKYEFSPFGAFVSFFAFLSTLLL
FT                   IPSKELGFSNPLYALHITSAGFSYAFLIFAGFTSTARLLIERKLREKKVDFSFAPLKIL
FT                   KKLERVFIIAGFVGLTLTLIFGSLWAKVYLGTHWVNDPKLLVTLILWLYYGFLAHMFIF
FT                   KHFKPSQISYLSILGMFLSLIALLFFRHSF"
FT   gene            complement(36306..36758)
FT                   /gene="fabZ"
FT                   /locus_tag="aq_056"
FT   CDS_pept        complement(36306..36758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="aq_056"
FT                   /product="(3R)-hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_056"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06425"
FT                   /db_xref="GOA:O66468"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66468"
FT                   /protein_id="AAC06425.1"
FT                   /translation="MDIQEIMEILPHRYPILLVDKILEIEEGKRIIGLKNVSVNEPVFQ
FT                   GHFPGFPLFPGVYILEAMAQVGGILMIKSLNLEIGKYAVVFAGIDDARFKKPVYPGDQL
FT                   ILELEVISLKKALSKMKGVAKVDGEVVAQATLMAAARKLEDIKRNA"
FT   gene            36782..37426
FT                   /gene="sfsA"
FT                   /locus_tag="aq_057"
FT   CDS_pept        36782..37426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="aq_057"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_057"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06428"
FT                   /db_xref="GOA:O66469"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66469"
FT                   /protein_id="AAC06428.1"
FT                   /translation="MKLPPLMPAIFVKRLNRFVGKVFLNGKIERALIRNTGRLSELLKF
FT                   GNTVFVREKEGGKYRYEIILARAEKSLVCVESHYANKIFEEYIRRNWKFKELKREVKLE
FT                   NERFDFLIDNTLVEVKSVNLVKNGVAMFPDAPTKRGTGHIRTLIKLSDKFKPLLVFVVQ
FT                   RSDFLSFEPNCETDPEFCKAYYEYVSKGFEVLVLKCRVSLEEINVVEVFFT"
FT   gene            37923..38273
FT                   /locus_tag="aq_058"
FT   CDS_pept        37923..38273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_058"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_058"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06432"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66470"
FT                   /protein_id="AAC06432.1"
FT                   /translation="MGDVNFLEQMLLKSTMKEIEERYDDVITIYKYDYEIRGIAEKLYR
FT                   LSKIVEEVFKEIPNPEKKLDESLYTTLYSVLKDINSILYDLSIATNEQISYVLMQAYRK
FT                   LDNIDNLLSKLK"
FT   gene            38395..38922
FT                   /locus_tag="aq_059"
FT   CDS_pept        38395..38922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_059"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06433"
FT                   /db_xref="GOA:O66471"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:O66471"
FT                   /protein_id="AAC06433.1"
FT                   /translation="MAERFNIPMSVVLVRKLGLPWNEEAGFGAIDPDGTPYYDKSVLSY
FT                   LSEEDIKQVVEKELKELRERERKFVPRGYPDLRGRQVIIVDDGVATGYTAIAAANWAKK
FT                   KGASEVIIAVPVCPSDAKERLERYADKFVCYYSSDAPSFAVGMFYRDFHQLSDEEAKEY
FT                   LRRAEEKGLLEP"
FT   gene            complement(38923..39459)
FT                   /gene="mog"
FT                   /locus_tag="aq_061"
FT   CDS_pept        complement(38923..39459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="aq_061"
FT                   /product="molybdenum cofactor biosynthesis MOG"
FT                   /db_xref="EnsemblGenomes-Gn:aq_061"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06419"
FT                   /db_xref="GOA:O66472"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="PDB:2PBQ"
FT                   /db_xref="PDB:2QQ1"
FT                   /db_xref="PDB:3MCI"
FT                   /db_xref="PDB:3MCJ"
FT                   /db_xref="UniProtKB/TrEMBL:O66472"
FT                   /protein_id="AAC06419.1"
FT                   /translation="MSEKKAVIGVVTISDRASKGIYEDISGKAIIDYLKDVIITPFEVE
FT                   YRVIPDERDLIEKTLIELADEKGCSLILTTGGTGPAPRDVTPEATEAVCEKMLPGFGEL
FT                   MRQVSLKQVPTAILSRQTAGIRGSCLIVNLPGKPQSIKVCLDAVMPAIPYCIDLIGGAY
FT                   IDTDPNKVKAFRPKK"
FT   gene            39496..40338
FT                   /gene="speE"
FT                   /locus_tag="aq_062"
FT   CDS_pept        39496..40338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="aq_062"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_062"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06436"
FT                   /db_xref="GOA:O66473"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66473"
FT                   /protein_id="AAC06436.1"
FT                   /translation="MRDIVFIERDPYAPIRHCYTVSKILYQGKSPYQEIQVIESPEFGR
FT                   MLILDGVVQLDEKYEFLYHEYLAHVPLHAHPNPRNVLIIGGGDGGTLREVLKHDIVERA
FT                   VLVDIDKEVIEVSKKYLPTLSVGFQDPRAIVVNEDGYKYVQDYENEFDVIIVDSTDPVG
FT                   FAHVLTTEDFFRHVYKALKEDGIFVAQTESIHYHLEMVSNIQQRLKKVFPIVDLYTSVI
FT                   PIYAGYWWTFSIASKKYPVRTPAREVKVQTKIYDADMHEYAFLPESFYNKIVNGEYKY"
FT   gene            40413..40745
FT                   /gene="rpsF"
FT                   /locus_tag="aq_063"
FT   CDS_pept        40413..40745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="aq_063"
FT                   /product="ribosomal protein S06"
FT                   /db_xref="EnsemblGenomes-Gn:aq_063"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06443"
FT                   /db_xref="GOA:O66474"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="PDB:2J5A"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66474"
FT                   /protein_id="AAC06443.1"
FT                   /translation="MRHYKTLRYYETVFAVKPTLSEEEMKKKFEQVKEFIKQKGGEILY
FT                   EEDWGMRQLAYPIQKFNNARYFLVQFKTENPQLPNELDFQLKIDEDVIRWLNFQIKESE
FT                   VKKNAQ"
FT   gene            40735..41178
FT                   /gene="ssb"
FT                   /locus_tag="aq_064"
FT   CDS_pept        40735..41178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="aq_064"
FT                   /product="single stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_064"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06439"
FT                   /db_xref="GOA:O66475"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66475"
FT                   /protein_id="AAC06439.1"
FT                   /translation="MLNKVFIIGRLTGDPVITYLPSGTPVVEFTLAYNRRYKNQNGEFQ
FT                   EESHFFDVKAYGKMAEDWATRFSKGYLVLVEGRLSQEKWEKEGKKFSKVRIIAENVRLI
FT                   NRPKGAELQAEEEEEVPPIEEEIEKLGKEEEKPFTDEEDEIPF"
FT   gene            41197..41415
FT                   /gene="rpsR"
FT                   /locus_tag="aq_064a"
FT   CDS_pept        41197..41415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="aq_064a"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:aq_064a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06446"
FT                   /db_xref="GOA:O66476"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66476"
FT                   /protein_id="AAC06446.1"
FT                   /translation="MVVRAPKKKVCMYCEQKREPDYKNYEELRNFLTERGRIKDRKQTG
FT                   LCAKHQRRLAVQIKRARQLGLLPYVVY"
FT   gene            41470..41649
FT                   /locus_tag="aq_064b"
FT   CDS_pept        41470..41649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_064b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_064b"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06450"
FT                   /db_xref="GOA:O66477"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66477"
FT                   /protein_id="AAC06450.1"
FT                   /translation="MHFPLPWQLILILLVILVIFGASKLPEVGKGLGEGIRNFKKALSG
FT                   EEEEKGKEVKKEGE"
FT   gene            41650..41883
FT                   /locus_tag="aq_064c"
FT   CDS_pept        41650..41883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_064c"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_064c"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06451"
FT                   /db_xref="GOA:O66478"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66478"
FT                   /protein_id="AAC06451.1"
FT                   /translation="MFPGGISMTELIIILAVILLLFGAGRLPEAGRALGEGIRNFRKAL
FT                   SGETEVKEVKAEDVKTEERKEEKKEEKEKVEA"
FT   gene            complement(41880..42773)
FT                   /locus_tag="aq_065"
FT   CDS_pept        complement(41880..42773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_065"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06452"
FT                   /db_xref="GOA:O66479"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66479"
FT                   /protein_id="AAC06452.1"
FT                   /translation="MLCYVNYKRVKRPVEIPNLEVEIGFGRGDFIVKLAKENPDKNFFG
FT                   IEISQISIEKLMKRVGKKGLKNVYCTNVDAYWGFYFLFRDNYVENIYMNYPDPWFKKRH
FT                   HKRRLTKPERLYMFAKKLKLGGEIRIRTDNYEFLEFTKESAKVLDCFEVEEGTLNVKEP
FT                   LTKYEQKWLSMGKTLYKLILRKVKEPKFVEHPEVEEVRELFPVKVKVESVDPKKIESRE
FT                   IKLDEEVYFKTFKVWQRDKDFLVECLLSEKGYLQKFFIQIKRKEDGYVIDVSPYSEVLR
FT                   TRNLQRSIQTVAQLLS"
FT   gene            42795..43763
FT                   /locus_tag="aq_066"
FT   CDS_pept        42795..43763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_066"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06453"
FT                   /db_xref="GOA:O66480"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:O66480"
FT                   /protein_id="AAC06453.1"
FT                   /translation="MLTDLGLLTLGFFLLVKGADMLIEGAGGLARRFGIPEFVIGLTLV
FT                   AFGTSLPEFTVNVSAALKDASGISLGNVIGSNIANILLILGVASLIKPLTVHATFVKKE
FT                   IPVNFFLTLTLIVMANDVILNHAPVSLISRGDGLVLIITFLGYMYFLVAYLERDSILEG
FT                   EMKESISPFKGFIYFILGLTGLSLGADWTVDGAVGLAKALGVSEAVIGLFVVAIGTSLP
FT                   ELFASAVSAYKGNPDIALGNVAGSNIFNATLVLGTSSVIRDIPVPERANVDLGVLFIAT
FT                   LLLLISSIWGKRKYTLDRMEGGIFLLAYFIYVIASWYRELS"
FT   gene            complement(43756..44268)
FT                   /gene="dmsB2"
FT                   /locus_tag="aq_067"
FT   CDS_pept        complement(43756..44268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmsB2"
FT                   /locus_tag="aq_067"
FT                   /product="dimethylsulfoxide reductase chain B"
FT                   /db_xref="EnsemblGenomes-Gn:aq_067"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06437"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:O66481"
FT                   /protein_id="AAC06437.1"
FT                   /translation="MKRPIMLIDLDRCIGCLSCEVACVQEKGLESLYIRPMKVFRVEGI
FT                   SEEPGAFYYPMNCFHCDPAPCVVACPTSAMRKREKDGIVYVEQTLCIGCKACIIACPYG
FT                   AITFNPATQKVEKCDYCYKRVDKGLLPSCVEKCVTNCLYFVEVDEVPKERHKLKRIDEK
FT                   LYEEIFS"
FT   gene            complement(44501..44857)
FT                   /gene="rplQ"
FT                   /locus_tag="aq_069"
FT   CDS_pept        complement(44501..44857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="aq_069"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:aq_069"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06441"
FT                   /db_xref="GOA:O66482"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66482"
FT                   /protein_id="AAC06441.1"
FT                   /translation="MRHRVKKKHFDRTKEQRLALYRSLARALIFDERIETTVERAKALR
FT                   SFIEPLVELAKEGTLHARRQALSRLPDKPAIKKLFEDIAPRFEGRNGGYVRIIKLPYRR
FT                   RGDGAEMAIIEWVE"
FT   gene            complement(44863..45816)
FT                   /gene="rpoA"
FT                   /locus_tag="aq_070"
FT   CDS_pept        complement(44863..45816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="aq_070"
FT                   /product="RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_070"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06440"
FT                   /db_xref="GOA:O66483"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66483"
FT                   /protein_id="AAC06440.1"
FT                   /translation="MLNEFIYPDKIFWEEKTDTYGRLVVEPLERGFGTTVGNSLRRVLL
FT                   SSISGTAITAVKIYGIYHEFSAIEGVQEDAIELIANLKKIKFLMKGDSDVEILYLQKKG
FT                   EGEVKASDIKTPPNVEILNPDQYIATITDPNKELNIEIRVERGRGYVPVEEMEAIGEVG
FT                   WILVDADFSPVKKVGFRVDNVRVGKKSTYERLTLEIFTNGIKTPDQCMQEAIEILKKHY
FT                   ELLENIFTEKPTVPQKVAVDELAEKLSLSIEELDISQRALNSLKRIGITTIGDLVRMTE
FT                   DELKSTKNIGRKALAEIKEALHKLGLELGMNIETQR"
FT   gene            complement(45829..46464)
FT                   /gene="rpsD"
FT                   /locus_tag="aq_072"
FT   CDS_pept        complement(45829..46464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="aq_072"
FT                   /product="ribosomal protein S04"
FT                   /db_xref="EnsemblGenomes-Gn:aq_072"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06442"
FT                   /db_xref="GOA:O66484"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66484"
FT                   /protein_id="AAC06442.1"
FT                   /translation="MGRYIGPWVKLDRRFGVVVSGKKSAPKILARRNYPPGQHGRKYGR
FT                   RKKLTEYGLRLMEKQKLKFLYGGLREKQFKKYFDMASKSKENTGEMLLQYLERRLDNVV
FT                   YRLGFASTRRQARQLVAHGHVLVNGKKVNIPSYLVEPGDVIEIKEKSRDIPFIKENLEN
FT                   VDPRSIPSWLELDKDNFRGRVVRLPENVQEYLEIPINLQYIVEFYSKV"
FT   gene            complement(46465..46842)
FT                   /gene="rpsK"
FT                   /locus_tag="aq_073"
FT   CDS_pept        complement(46465..46842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="aq_073"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:aq_073"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06444"
FT                   /db_xref="GOA:O66485"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66485"
FT                   /protein_id="AAC06444.1"
FT                   /translation="MAKKKKKQKRQVTKAIVHIHTTFNNTIVNVTDTQGNTIAWASGGT
FT                   VGFKGTRKSTPYAAQLAAQKAMKEAKEHGVQEVEIWVKGPGAGRESAVRAVFASGVKVT
FT                   AIRDVTPIPHNGCRPPARRRV"
FT   gene            complement(46858..47238)
FT                   /gene="rpsM"
FT                   /locus_tag="aq_074"
FT   CDS_pept        complement(46858..47238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="aq_074"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:aq_074"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06445"
FT                   /db_xref="GOA:O66486"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66486"
FT                   /protein_id="AAC06445.1"
FT                   /translation="MARIAGVDLPNNKRLEVALTYIYGIGWSRAREICEKTGIPCTKRV
FT                   GELTPDELNTLRKFIDENYKVEGDLRREVQLNIKKLKDMGCYRGIRHARGLPVRGQQTR
FT                   TNARTRKGKRKTVGGTKKAKAK"
FT   gene            complement(47216..47365)
FT                   /gene="rpmJ"
FT                   /locus_tag="aq_075"
FT   CDS_pept        complement(47216..47365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="aq_075"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:aq_075"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06456"
FT                   /db_xref="GOA:O66487"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66487"
FT                   /protein_id="AAC06456.1"
FT                   /translation="MKVRSSVKKRCAKCKIIRRKGRVMVICEIPSHKQKTGVTEVRNGE
FT                   NSGR"
FT   gene            complement(47426..47668)
FT                   /gene="infA"
FT                   /locus_tag="aq_075a"
FT   CDS_pept        complement(47426..47668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="aq_075a"
FT                   /product="initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:aq_075a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06447"
FT                   /db_xref="GOA:O66488"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66488"
FT                   /protein_id="AAC06447.1"
FT                   /translation="MGKKKRKQEHEKERGILLEGEVVEALPNGMFRVKLETGQEVLAHI
FT                   AGKLRVNFIRILPGDKVKVELSPYDLTRGRIVYRL"
FT   gene            complement(47671..48447)
FT                   /gene="map"
FT                   /locus_tag="aq_076"
FT   CDS_pept        complement(47671..48447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="aq_076"
FT                   /product="methionyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_076"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06448"
FT                   /db_xref="GOA:O66489"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66489"
FT                   /protein_id="AAC06448.1"
FT                   /translation="MAIELYSQREIEKIRKASQIVAEVLHIVAENVKPGVSTWDLEMIA
FT                   RKETEKRGAKPAFLGYKPPFSDVRYPAALCISINDEVVHGLPKKEKVIKEGDVVSIDFG
FT                   AIYDGYAGDSAITVIAGKGSPEAQKLLEATKEALYNAIEKALPGKKVGDITKAIHETAE
FT                   KYGFKTILRYGGHGVGRKVHQEPFVPNNVKDIGKKNPRLRQGMVIAIEPMLSIGTEETV
FT                   EDGDGWTVKTKDGSLAAHFEHTVAITKKGPVILTEL"
FT   gene            complement(48437..49057)
FT                   /gene="kad"
FT                   /locus_tag="aq_078"
FT   CDS_pept        complement(48437..49057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kad"
FT                   /locus_tag="aq_078"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_078"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06438"
FT                   /db_xref="GOA:O66490"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="InterPro:IPR036193"
FT                   /db_xref="PDB:2RGX"
FT                   /db_xref="PDB:2RH5"
FT                   /db_xref="PDB:3SR0"
FT                   /db_xref="PDB:4CF7"
FT                   /db_xref="PDB:4IKE"
FT                   /db_xref="PDB:4JKY"
FT                   /db_xref="PDB:4JL5"
FT                   /db_xref="PDB:4JL6"
FT                   /db_xref="PDB:4JL8"
FT                   /db_xref="PDB:4JLA"
FT                   /db_xref="PDB:4JLB"
FT                   /db_xref="PDB:4JLD"
FT                   /db_xref="PDB:4JLO"
FT                   /db_xref="PDB:4JLP"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66490"
FT                   /protein_id="AAC06438.1"
FT                   /translation="MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPL
FT                   GKKAKEYMERGELVPDDLIIALIEEVFPKHGNVIFDGFPRTVKQAEALDEMLEKKGLKV
FT                   DHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVIQREDDKPEVIKKRLE
FT                   VYREQTAPLIEYYKKKGILRIIDASKPVEEVYRQVLEVIGDGN"
FT   gene            complement(49062..50351)
FT                   /gene="secY"
FT                   /locus_tag="aq_079"
FT   CDS_pept        complement(49062..50351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="aq_079"
FT                   /product="preprotein translocase SecY"
FT                   /db_xref="EnsemblGenomes-Gn:aq_079"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06435"
FT                   /db_xref="GOA:O66491"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="PDB:3DL8"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66491"
FT                   /protein_id="AAC06435.1"
FT                   /translation="MSEYLKALFELKELRQKFIFTLLMFVIYRLGSHIPIPGINPEALR
FT                   DFLKAFEGSVFALYDIFSGGNLGRLTVFALGVMPYISASIMMQLLTVAIPSLQRLAKEE
FT                   GDYGRYKINEYTKYLTLFVATVQSLGIAFWIRGQVSPKGIPVVENPGISFILITVLTLV
FT                   AGTMFLVWIADRITEKGIGNGASLIIFAGIVANFPNAVIQFYEKVKTGDIGPLTLLLII
FT                   ALIIAIIVGIVYVQEAERRIPIQYPGRQVGRQLYAGRKTYLPIKINPAGVIPIIFAQAL
FT                   LLIPSTLLNFVQNPFIKVIADMFQPGAIFYNFLYVTFIVFFTYFYTAVLINPVELAENL
FT                   HKAGAFIPGVRPGQDTVKYLERIINRLIFFGALFLSVIALIPILISVWFNIPFYFGGTT
FT                   ALIVVGVALDTFRQIETYLIQKKYKSYVRR"
FT   gene            50396..50605
FT                   /gene="rpmB"
FT                   /locus_tag="aq_080"
FT   CDS_pept        50396..50605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="aq_080"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:aq_080"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06455"
FT                   /db_xref="GOA:O66492"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66492"
FT                   /protein_id="AAC06455.1"
FT                   /translation="MADSEICGKRPVVGRRVTLSGERNRRIFKPNVHKMRVMLPDGTVK
FT                   RMYVCTKCLKAGKVMKAPRIPKEG"
FT   gene            50605..51801
FT                   /gene="aroC"
FT                   /locus_tag="aq_081"
FT   CDS_pept        50605..51801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="aq_081"
FT                   /product="chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_081"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06434"
FT                   /db_xref="GOA:O66493"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="PDB:1Q1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66493"
FT                   /protein_id="AAC06434.1"
FT                   /translation="MSLRYLRFLTAGESHGKGLTAILEGIPANLPLSEEEINHELRRRQ
FT                   RGYGRGGRMKIEKDTAEILSGVRFGKTLGSPIALFIRNRDWENWKEKMAIEGEPSPSVV
FT                   PFTRPRPGHADLSGGIKYNQRDLRNILERASARETAARVAVGAVCKKFLSEFGIKIGSF
FT                   VVSIGQKEVEELKDKSYFANPEKLLSYHEKAEDSELRIPFPEKDEEFKTYIDEVKEKGE
FT                   SLGGVFEVFALNVPPGLGSHIQWDRRIDGRIAQAMMSIQAIKGVEIGLGFEAARRFGSQ
FT                   VHDEIGWSEGKGYFRHSNNLGGTEGGITNGMPIVVRVAMKPIPTLKNPLRSVDIETKEE
FT                   MKAGKERTDIVAVPAASVVGEAMLAIVLADALLEKLGGDFMEEVKKRFEDYVNHVKSF"
FT   gene            51803..52405
FT                   /locus_tag="aq_082"
FT   CDS_pept        51803..52405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_082"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_082"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06449"
FT                   /db_xref="GOA:O66494"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:O66494"
FT                   /protein_id="AAC06449.1"
FT                   /translation="MKILSIDTSFSFINFSVIEEEKVTFLHYLKSNKKTLELLPKIFEE
FT                   LCIRPENFDAFAVSVGVGYLTSLRIGVTFVKTWAYTLGKPVVSYKNLELLAKKTPVPFP
FT                   KIPYLKVGSNVFYQIFEESSSSEVKVFKGEELRGYGISLKEFEDIKLGEKQFFHDIFPF
FT                   SAYGGIYAYEFLKENPEGENVFEIEPIYVKPPYHVKD"
FT   gene            complement(52390..53406)
FT                   /locus_tag="aq_083"
FT   CDS_pept        complement(52390..53406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_083"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06454"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:O66495"
FT                   /protein_id="AAC06454.1"
FT                   /translation="MEEILFLFKDEEKAREFEESLHSTGAKTRRTGTAVITAGLKDEEI
FT                   LYLLSEMDENTLKDLKVYQGEVGNDCENIVKAISKAEPVTNLIDKVIYHSLGNIFIDTK
FT                   TLFHPIVDVKEKRVKAFEALCRPPIKIVDLINMGKSTSEFSENFCRYMALKNARKFLKE
FT                   DMWLFLNFHPRFLREPLKVFGDFISTLYMHDVSPRQVVVELTEYEELEISAVKSLISFL
FT                   KSEGVKIALDDVGSGYSGLFYLSELGPDIIKIDMELIRDIHKHSMKKVIVNYLIRLAHE
FT                   NNIKVVSEGVETLEELKTVLYMGTDFVQGFIFSKPLENPNLEELNEKIEKIISQSLT"
FT   gene            53671..54474
FT                   /gene="kdsA"
FT                   /locus_tag="aq_085"
FT   CDS_pept        53671..54474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="aq_085"
FT                   /product="3-deoxy-d-manno-octulosonic acid 8-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_085"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06457"
FT                   /db_xref="GOA:O66496"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:1FWN"
FT                   /db_xref="PDB:1FWS"
FT                   /db_xref="PDB:1FWT"
FT                   /db_xref="PDB:1FWW"
FT                   /db_xref="PDB:1FX6"
FT                   /db_xref="PDB:1FXP"
FT                   /db_xref="PDB:1FXQ"
FT                   /db_xref="PDB:1FY6"
FT                   /db_xref="PDB:1JCX"
FT                   /db_xref="PDB:1JCY"
FT                   /db_xref="PDB:1LRN"
FT                   /db_xref="PDB:1LRO"
FT                   /db_xref="PDB:1LRQ"
FT                   /db_xref="PDB:1PCK"
FT                   /db_xref="PDB:1PCW"
FT                   /db_xref="PDB:1PE1"
FT                   /db_xref="PDB:1T8X"
FT                   /db_xref="PDB:1T96"
FT                   /db_xref="PDB:1T99"
FT                   /db_xref="PDB:1ZHA"
FT                   /db_xref="PDB:1ZJI"
FT                   /db_xref="PDB:2A21"
FT                   /db_xref="PDB:2A2I"
FT                   /db_xref="PDB:2EF9"
FT                   /db_xref="PDB:2NWR"
FT                   /db_xref="PDB:2NWS"
FT                   /db_xref="PDB:2NX1"
FT                   /db_xref="PDB:2NX3"
FT                   /db_xref="PDB:2NXG"
FT                   /db_xref="PDB:2NXH"
FT                   /db_xref="PDB:2NXI"
FT                   /db_xref="PDB:3E0I"
FT                   /db_xref="PDB:3E12"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66496"
FT                   /protein_id="AAC06457.1"
FT                   /translation="MEKFLVIAGPCAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFD
FT                   KANRSSIHSFRGHGLEYGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFL
FT                   CRQTDLLLAAAKTGRAVNVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNL
FT                   VVDFRSLPIMKQWAKVIYDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFME
FT                   THPEPEKALSDASTQLPLSQLEGIIEAILEIREVASKYYETIPVK"
FT   gene            54471..55133
FT                   /gene="modC"
FT                   /locus_tag="aq_086"
FT   CDS_pept        54471..55133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="aq_086"
FT                   /product="Molybdenum transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:aq_086"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06461"
FT                   /db_xref="GOA:O66497"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:O66497"
FT                   /protein_id="AAC06461.1"
FT                   /translation="MKEALFLSLKLSFFTTLILLLISLVLSPLLAFKEFKGKSLVVALV
FT                   TLPLVLPPTVLGFYLILLFSPESPFGKLVQSILGKTLLFSFEGLVVASVIYSLPLAVLP
FT                   LTSAMEKIPKELIYTSYVFGYGKVETFFRVILPLSLNGLITSVVMSFANTMGEFGVVLM
FT                   VGGNIPGETQTLSIFIYDAVQALDYKTAHRASVLLVGVSLLVMFIVLKVRGRVRVDV"
FT   gene            55256..55597
FT                   /locus_tag="aq_087"
FT   CDS_pept        55256..55597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_087"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_087"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06465"
FT                   /db_xref="InterPro:IPR018685"
FT                   /db_xref="UniProtKB/TrEMBL:O66498"
FT                   /protein_id="AAC06465.1"
FT                   /translation="MATLSKLKELMSIPGAVAAGEFSDDGRLLAYYGDIDEKSAEIAAM
FT                   MCAANKMMGNMQAKGWSAYTGKDGFYPVIGFAVAGGKYAACIMGNVGVFVELDKADFDK
FT                   IFETLSKFI"
FT   gene            55612..55947
FT                   /locus_tag="aq_088"
FT   CDS_pept        55612..55947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_088"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_088"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06466"
FT                   /db_xref="InterPro:IPR018685"
FT                   /db_xref="UniProtKB/TrEMBL:O66499"
FT                   /protein_id="AAC06466.1"
FT                   /translation="MANLDKLLQIKGVFAAGEFSDDGKLVAYKGDITEEEAAMAAEMCA
FT                   ANNAMAKMQADGYTAFSGKEWTPLVGWALTGPKYSVCVVGNVGVFVKNDEVSFNEVFKA
FT                   LREEAGK"
FT   gene            55975..56379
FT                   /locus_tag="aq_090"
FT   CDS_pept        55975..56379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_090"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_090"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06467"
FT                   /db_xref="GOA:O66500"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:O66500"
FT                   /protein_id="AAC06467.1"
FT                   /translation="MEDRMAYKFLSEDWIKAYAEEWNKNEKLMNDLKNFSASIKYYVEG
FT                   KENDAVELIIEKGKAVSAGKADPNKRYDFELWASLENWKKLATGEMGPRAAMLTKRLKF
FT                   KGSMITAMKYMGAFEESLKMMGRVPTVWDV"
FT   gene            56372..57268
FT                   /locus_tag="aq_091"
FT   CDS_pept        56372..57268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_091"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_091"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06468"
FT                   /db_xref="GOA:O66501"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:O66501"
FT                   /protein_id="AAC06468.1"
FT                   /translation="MFKFINKVDFKTFDEIFDGVLVIDKNRRIVFANKKAKEILGEVKE
FT                   GESCRGLFSICEHCPMELVEDSEQGVQVYDVLTKRKNHVCLSMSPLFEGGEFTGVLEVF
FT                   RDVSKVIHYMEEVKRQKEFVEVVLDSIVEAVLVLDEKGNVINHNGNASKVLCSRFESIT
FT                   GKNLKEITSLSLEDLPPEGERADIYIETPCGRQKASVLLSKLKQGKGWVLSLYIVPEIF
FT                   AGEGNKLKIVTKSPKFLKVLEKVKTISEMNVNVLITGETGTGKSLLARYIHYLSPRRDK
FT                   PFVKINCGAIPENLLEA"
FT   gene            57332..57964
FT                   /gene="hth"
FT                   /locus_tag="aq_093"
FT   CDS_pept        57332..57964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hth"
FT                   /locus_tag="aq_093"
FT                   /product="transcriptional regulator (H-T-H)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_093"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06459"
FT                   /db_xref="GOA:O66502"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66502"
FT                   /protein_id="AAC06459.1"
FT                   /translation="MANGGTLFLDEIGELPLHLQVKLLGLIQDKEFERIGDLKPRKADV
FT                   RIIAATNKNLKKLVEEGKFREDLYYRLNVVNVELPPLRERKEDIPHLVSYFLEKFSKIH
FT                   GKKVKGVSPEAMKLLLEYDYPGNVRELENAIEHAVVVSSTSLIGPDDLPEEIRIGSKVK
FT                   KKFRENEELEKIKEALERAGGNKSLAAKLLGIHRTTLWRKLKEYGLA"
FT   gene            complement(57961..60366)
FT                   /gene="nrdA"
FT                   /locus_tag="aq_094"
FT   CDS_pept        complement(57961..60366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="aq_094"
FT                   /product="ribonucleotide reductase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:aq_094"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06460"
FT                   /db_xref="GOA:O66503"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66503"
FT                   /protein_id="AAC06460.1"
FT                   /translation="MTMYVIKRSGRKEKLDINKIRIAIKFACEGLNVDPLELEADAQIQ
FT                   FRDGITTKEIQQLLIKTAAEKVSAERPDWTYTAARLLLYDLYKDVAHLRGYSLRDDLGK
FT                   YKPYNRKNFYSFVKEYVEKGIYGEYLLENYSEEDFNKLANYIKPERDLYFTYTGIKILY
FT                   DRYLVRDEEGRVIELPQEMYMLIAMTLAVPEKPEERLKWAKKFYDVLSEHKVTVATPTL
FT                   MNARRPFTQLSSCFVLTVDDDLFDIFDNVKKAGMISKFAGGLGVYLGKIRATGAPIRKF
FT                   KGASSGVIPVVKLINDTMTYVDQLGMRKGSASITLDIWHKDILDFLEVKTNVGDERKKA
FT                   HDIHPAVSIPDLFMKRLKNREDWTLIDPYWARQYITRKIYDGKYKEVKPLPGSHYYVGI
FT                   KEDGTQDILEPKGLEDFYGEEFEKWYLELEENLPSYAKKKVNSFELWKRLLTVAFETGE
FT                   PYIFFRDEANRKNPNKHTGMVYSSNLCHEIVQTMSPSKHEKPVLDPETGEITYKKEAGD
FT                   LPVCNLGSVNLGKVHTEEEIKEVLPLLVRMLDNVIEMNFYAIPEAEYTNKRYRAIGIGV
FT                   SNYHYCLVKNGIKWESEEHLKFADKLFELIAFYALKGSLELAKERGRYKLFDGSNWSKG
FT                   ILFGRSVEEIEENSRQNGNNLPWRELAEEIKKYGIRNAYLLALMPTGSTSLILGATPSI
FT                   DPIFARFYKEENMSGILPQVPPEVDRFYWHYKTAYTIDHEWTIRAAAVRQKWIDQAQSL
FT                   NLFVDPQNIDGPRLSRLYELAWELGLKTIYYLRSRSAMDIEECEACSV"
FT   gene            complement(60452..61675)
FT                   /locus_tag="aq_097"
FT   CDS_pept        complement(60452..61675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_097"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_097"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06469"
FT                   /db_xref="GOA:O66504"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66504"
FT                   /protein_id="AAC06469.1"
FT                   /translation="MEILNRLTLTDYIVFTSFILYLLFFLSPFLERKRLWTVAVTPLAS
FT                   IIGSGYLVSAPLLYYVLGKYAILGMAGIVILAYLIGGAIRYNIIKAEPILYGSESSKLK
FT                   ALLLDVERFSNLSLAFAYMISIAFYLRLLSSFVFSGFFERNEVYERLLTTGLLLFIGIS
FT                   GFIRRLHFLEFMEKYAVGLKLSIIFSFLTALLYYNYKNFSFAGEVKPFDLHSLEVLGGI
FT                   LLIVQGFETSKYLGEEYTPEERVKSMKLAQWISGFIYVSFMFLITSVFVHNPPKKLDET
FT                   EIIFLASAVSLVLGYLLRFGPLMSQFSAAVADTIGAGGLIYEETNHRVSSRFGYLITTL
FT                   VGVALVWSANVFEIIAYASKAFAFYYLLQTIIAWLVSFEKKDRLQFLVFTLLIPVLIFI
FT                   VLFGKSVE"
FT   gene            61696..61998
FT                   /gene="secG"
FT                   /locus_tag="aq_098"
FT   CDS_pept        61696..61998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="aq_098"
FT                   /product="protein export membrane protein SecG"
FT                   /db_xref="EnsemblGenomes-Gn:aq_098"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06462"
FT                   /db_xref="GOA:O66505"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="PDB:3DL8"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66505"
FT                   /protein_id="AAC06462.1"
FT                   /translation="MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVG
FT                   GVETILTKATYWLGALFLVLALLLSVIPKEKGSVVEKSVQTEQSEGKGTTQESGK"
FT   gene            61934..62779
FT                   /gene="hemK"
FT                   /locus_tag="aq_099"
FT   CDS_pept        61934..62779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="aq_099"
FT                   /product="protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_099"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06458"
FT                   /db_xref="GOA:O66506"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66506"
FT                   /protein_id="AAC06458.1"
FT                   /translation="MRKVFKLNKVKVKELLKKVESEYRRDAEIILSYLLKVSPSQIPLM
FT                   YAREIPEEIVKRFFKQMKERKKGIPTAYVIGEWECMGRVFKVKKGVLVPRPETEILIER
FT                   TLELIPQDREMVGFELGSGTGCISINLLIERPKLVMYATDVNPDAVELTKENAKLHKVD
FT                   DRLFVFLGNAFEPVKGMKFDFIVSNPPYIPENFWEILPEEVKKEGYTSLIGGKKGWEFY
FT                   ELIAEEGTKHLKENGFIALEIGHDQGKVVKELLEKKCFKVNIFKDYAGFDRVVIAQRWS
FT                   "
FT   gene            62770..64020
FT                   /gene="hly3"
FT                   /locus_tag="aq_101"
FT   CDS_pept        62770..64020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hly3"
FT                   /locus_tag="aq_101"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:aq_101"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06463"
FT                   /db_xref="GOA:O66507"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:O66507"
FT                   /protein_id="AAC06463.1"
FT                   /translation="MELIGFLIGVFFFIILEGFFAGSEIALVNADKGFLKAVYKKKKYS
FT                   FLKHFLDSPEEYITLTMLGYTVSIVFASALYTLFLMNLSKYVPEIKGKEVLLAETLVIF
FT                   TIILGEIIPKSLFQHYADKVVIPSLYILDKLRIVLKPFLVLAKAVSRFISSRFAKGESK
FT                   VRREDIIKLLREKKSFSESLGYVISNILSFKERRIGEIVRPLYEVVMIPDTATVLQAIE
FT                   QIKKSGYARIPVYRKRVDDIIGYVSAYDLIDKPLDEPIKSFIRRILIFSEFTPLPKVLE
FT                   VFKEKKEHIALVVDERGVILGIVTLEDIFREILGDFISEKGEEPLVREVSKDTWVADGK
FT                   VEINELRRITGINIPDGPYNTLSGFIAYQLGRIPKKGDVVSYDGYNFKVVDGDTRRVRK
FT                   VLIERKVKKKALSGASA"
FT   gene            complement(63986..64726)
FT                   /locus_tag="aq_103"
FT   CDS_pept        complement(63986..64726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_103"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06470"
FT                   /db_xref="GOA:O66508"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:O66508"
FT                   /protein_id="AAC06470.1"
FT                   /translation="MKLYSIQIRQTTPEENLKKVINFLEKVEENSLVLLPEMWYSGFDY
FT                   ENLEEHAQKTPEVLEVLKKISKEKSLTLCGTLPEKGTEGILNTAFLIEDGRVIGKRSKI
FT                   KLFPIFDEDKYFIPGKENKVFETKLGKAGILICFEIRFTDLIMNFWRERPDVVLVPAQW
FT                   GYARRKHFETLCRARAIELQAYLLASNTWGEYLGTRFAGHSGIYSPWGEVLAFSEKGDT
FT                   LLAADYDKDYIEEVRRTLPIKPSF"
FT   gene            complement(64729..65841)
FT                   /locus_tag="aq_104"
FT   CDS_pept        complement(64729..65841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_104"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06471"
FT                   /db_xref="GOA:O66509"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66509"
FT                   /protein_id="AAC06471.1"
FT                   /translation="MERFDVVVVGAGPSGSSAARYLSEKGLRVLLMERKKLPRFKLCGG
FT                   ALSGRFSKYLPQDFKSKVLNVIHKGYLGFRGDKHKLKEREEVAYIIDRADFDHFLAQKA
FT                   MEKGCELREETELLDLWEEKGKIILDTTKGKVSCDFLIGADGFHSKVAKFLGFKKEKYY
FT                   RSVEVLAEGEMDFNSVVIELGLVKRGYLWVFPKGNKLNIGVASTEKENLLEVLKDYIKR
FT                   QKIVKVKKIYKPKSWFIPFAEGSEELHTGRGRILLVGDAGNFVDPLLGEGIYYGYLSGL
FT                   LAGDAILENPQNPEKTYRKKVKELAKEFTYAGKIAKLAYRFQRVAYKMGGGTSLERYME
FT                   FLKGHTTYEEMYKKGWLDFIKNLILYPLKS"
FT   gene            65727..66446
FT                   /locus_tag="aq_106"
FT   CDS_pept        65727..66446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_106"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_106"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06464"
FT                   /db_xref="GOA:O66510"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66510"
FT                   /protein_id="AAC06464.1"
FT                   /translation="MVAFFSPLREPLSLFRISTSPRSFRKVPHLLLLRQTSPCSSQSFS
FT                   IIFISLSSSNSREGIVFTLSFLIFESNTLLFSSRKSFTLSAFPSGRTVKYTLALLPSLL
FT                   SSTLVMLTTPKSVGAFSTTKLAIISFICSPSLSFFLLILYLLQHIFVLFKLFAVEYVRY
FT                   ELVYFLFLEYRTRQQSSRVLVVLYLPEHEKFRKSVLNLSVSVTILAVLQGILFYEKVIF
FT                   TEFYDVEYSPPSSSYEF"
FT   gene            66706..66903
FT                   /gene="fdx4"
FT                   /locus_tag="aq_108a"
FT   CDS_pept        66706..66903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx4"
FT                   /locus_tag="aq_108a"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:aq_108a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06474"
FT                   /db_xref="GOA:O66511"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:1F37"
FT                   /db_xref="PDB:1M2A"
FT                   /db_xref="PDB:1M2B"
FT                   /db_xref="PDB:1M2D"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66511"
FT                   /protein_id="AAC06474.1"
FT                   /translation="MTTVITPTGCMNACMMGPVVVVYPDGVWYGQVKPEDVDEIVEKHL
FT                   KGGEPVERLVISKGKPPGMF"
FT   gene            complement(66900..67142)
FT                   /gene="hfq"
FT                   /locus_tag="aq_108b"
FT   CDS_pept        complement(66900..67142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="aq_108b"
FT                   /product="host factor I"
FT                   /db_xref="EnsemblGenomes-Gn:aq_108b"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06479"
FT                   /db_xref="GOA:O66512"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="PDB:5SZD"
FT                   /db_xref="PDB:5SZE"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66512"
FT                   /protein_id="AAC06479.1"
FT                   /translation="MPYKLQESFLNTARKKRVKVSVYLVNGVRLQGRIRSFDLFTILLE
FT                   DGKQQTLVYKHAITTIVPHERLEIEFEEAGVPGQG"
FT   gene            67339..67677
FT                   /gene="glnB"
FT                   /locus_tag="aq_109"
FT   CDS_pept        67339..67677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="aq_109"
FT                   /product="nitrogen regulatory PII protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_109"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06473"
FT                   /db_xref="GOA:O66513"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="PDB:2EG1"
FT                   /db_xref="PDB:2EG2"
FT                   /db_xref="PDB:2Z0G"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66513"
FT                   /protein_id="AAC06473.1"
FT                   /translation="MKKIEAIIKPFKLDEVKDALVEIGIGGMTVTEVKGFGQQKGHTEI
FT                   YRGTEYVIDFLPKVKIEVVVRDEDVEKVVETIVKTAQTGRVGDGKIFIIPVEDVIRIRT
FT                   GERGEQAI"
FT   gene            67698..69107
FT                   /gene="glnA"
FT                   /locus_tag="aq_111"
FT   CDS_pept        67698..69107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="aq_111"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_111"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06472"
FT                   /db_xref="GOA:O66514"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66514"
FT                   /protein_id="AAC06472.1"
FT                   /translation="MPKYTPEEVLDLIQKEGVQYVDLRFSDPFGQWQHLTIPAYEISKE
FT                   TFEVGRGFDGSSIRGWQSINESDMLAKPDPNTAFIDPFIEPKTLVMICDIYDPVTGERY
FT                   GRDTRYIAQKAEQYLKQTGIGDTAYFGPEAEFFIFDSVEFGTAANYAFWRVDSEEGWWN
FT                   REVPSSGYKIPHKRGYFPAPPVDKMMQLRNEMVSIMSDLGIIVELHHHEVATAGQGEID
FT                   IRYDSLLNQADKLFLYKYIVRMVAAKHGKYATFMAKVLPNDNGSGMHTHFSIWKNGENL
FT                   FAGSEYAGLSKTALYAIGGILKHGPAIAAFTNPTVNSYHRLVPGYEAPVRLAYSARNRS
FT                   AAIRIPMYSQNPKAKRIEVRFPDATSNPYLAFAAILMAAIDGIENEIDPGEPFDKDIYS
FT                   LPPEELEGIPQLPGSLEEALKALEEDYEFLLKGNVFTEEFIQLWIESKRAEIDELRFIP
FT                   HPKEFELYWDI"
FT   gene            69169..70440
FT                   /gene="amtB"
FT                   /locus_tag="aq_112"
FT   CDS_pept        69169..70440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="aq_112"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:aq_112"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06478"
FT                   /db_xref="GOA:O66515"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66515"
FT                   /protein_id="AAC06478.1"
FT                   /translation="MRALGFIGIILSIFSSFAYASEAKLDTGNTAWMLVASALVVFMTV
FT                   PGLALFYGGLDKSKSILNTIAMSFSAFAVVTLTWIFVGYSVAYGDDIFGFIGNPFQYVL
FT                   GKGISGINSDTGYPALLDLMFQLTFATITTALISGSFVGRMKFSAWILFAILWSVFVYP
FT                   PVAHWVWGGGFLANDGALDFAGGTVVHINAGIAGLVGALILGRRKDTSLIPNNVPLVAL
FT                   GAGILWFGWFGFNAGSALGANESAAWAMINTTVATSTAALAWMFTEWLHVGKPTVVGIS
FT                   SGIVAGLVAITPAAGFVNLIGSIFIGAIASVCAYFMVALVKPKFGYDDALDVFGIHGVR
FT                   GIVGAVLTGVFADPNVGGTPGLLYGNPKQVLIQIEGVIATILYSAILTAVILLVLKAVV
FT                   GLRVSEEEELELDSSLHGEKAYNL"
FT   gene            70454..71500
FT                   /locus_tag="aq_113"
FT   CDS_pept        70454..71500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_113"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_113"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06480"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66516"
FT                   /protein_id="AAC06480.1"
FT                   /translation="MKKYVLPLLFLSSLSLAEEKSLYLKVSQPLELYGGISAGYFYTTN
FT                   EDGKDSSDKLQITNAILGLKAEVGEKIRFGFDLAVGGSLWSTVWDGGQGDFSYYDPDEK
FT                   ELKEGVGLHWGYAYLKPFKGFEVSAGVLTTNIGYELADTYSNPNVTFGAVWYAQPFIYP
FT                   GVRLTLDFSEIADLPVSLYAEYNQEYDLDNYAVGILGELGNLSYALSYYDYRASKNLVD
FT                   LVLGYTIFNVDLGLNFDYQWLDDSAKSAGQDDSAYGVALYVIPKFETKYGEFSLPLRLE
FT                   YFDEGSSGIYFGGADKGYTLTVTPTFRPTPNTYVRAEVSYVNTDNKVFKNGTKDNKTTL
FT                   AVELGFTF"
FT   gene            complement(71803..72243)
FT                   /locus_tag="aq_114"
FT   CDS_pept        complement(71803..72243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_114"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_114"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06481"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:O66517"
FT                   /protein_id="AAC06481.1"
FT                   /translation="MPKFRDIEEVKEFIKTTDKETSIYVGCDSRQLRDKTIFVTVIVVH
FT                   ISSKYGAKVFWNVEKVPKINSLRQRLMEEVNRAVYHALMLMDAVDGRHFEVHLDINPDE
FT                   NTASSVIVKEAVGYVLAQGLTPVLKPDAIAASCAADYITERY"
FT   gene            complement(72560..74122)
FT                   /locus_tag="aq_116"
FT   CDS_pept        complement(72560..74122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_116"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_116"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06482"
FT                   /db_xref="GOA:O66518"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:O66518"
FT                   /protein_id="AAC06482.1"
FT                   /translation="MPLSPTSVPLTVKEFEKALCGICGGCSSACGYIAYLKQDELVDLY
FT                   GHPHDPNGIGSFCTKGITYIQEIPKNPLRITKPLLREGNNFREVEFQETKKLIKENLKG
FT                   KVAFFLDRFAGIEEYLIARSLTEEVFSDSLYLPFKQTSVRAQDWVDKKALFIFEAEPTF
FT                   SEVMLTRWIVDAFEKDAYIFTAGSRYTTVFQKSKEKVLTTPEKTTEILQALSEGRFEGK
FT                   AQKFLEFFGKESVVIVGDTLLRSPFRGKVLKTLKEISEKYGADYSIVGNITPFPVKSLK
FT                   EFLERLGEFDTLVLFGNPFIYLSDEQIQKLKDKFVINFAYFPTITANHSTLIIPRTTFA
FT                   EREFIVKGFGFLAHSPQVLNAPFPQPYEYFESSFDVEDFLKECGVKLEELKEKEGGVDI
FT                   SMKDITEVDINEEDRSESGELWFICDNTLAEELGHWNPWTHALEREQFAYVNQKTKERL
FT                   NIGNLIEINGVKLKVKVNNNLADNVVFVPNSFEEFQPFDPGIRVGRLMKKPFFKLEVLN
FT                   LNV"
FT   gene            complement(74123..75316)
FT                   /gene="pgk"
FT                   /locus_tag="aq_118"
FT   CDS_pept        complement(74123..75316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="aq_118"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_118"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06475"
FT                   /db_xref="GOA:O66519"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66519"
FT                   /protein_id="AAC06475.1"
FT                   /translation="MLRKKTLRDVDVKGKRVLVRVDYNVPLDEQGNIVDDTRIRASLPT
FT                   VEYLLDANAKVILMSHLGRPKNRDPKYSLAPVAKRLSRYINKEVKLAPDCVGEEVKRIV
FT                   NSMKEGDVVLLENLRFHKEETECDENFARELASLGEVYVADAFGTCHRKHASVYLVPKF
FT                   LKPAVMGFLLEKEITYFEKAMVAPQRPVVAILGGAKVSSKLEVIKNLIRRVDKLFIGGA
FT                   MAFTFLKAMGYKVGNSLVEDDLQDVARDLIDVAKKLEIKLYLPVDFVIGQEVSENTPTK
FT                   VVPWQEIPDGWMGLDIGPVSVELVKEIISDAQTIVWNGPMGVFEIDKFKHGTIEVAKLL
FT                   AQSSALTIAGGGDTDHAIHKAGVYHAFDFVSTGGGAFLELLAGKELPCLVNLDDKEA"
FT   gene            complement(75328..75981)
FT                   /gene="talC"
FT                   /locus_tag="aq_119"
FT   CDS_pept        complement(75328..75981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talC"
FT                   /locus_tag="aq_119"
FT                   /product="transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_119"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06476"
FT                   /db_xref="GOA:O66520"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66520"
FT                   /protein_id="AAC06476.1"
FT                   /translation="MKFFLDTANVEEIKKAMEWGILDGVTTNPTLISKTGRPFKEVVKE
FT                   ILELVDGPVSLETVSLDAEGMIREGRMLAELGENVVVKIPMTPEGLKAVIALESEGIPT
FT                   NVTLVFSPTQALLAAKAGASYVSPFVGRLDDISGEGMKLIEEIKTIFSNYEFDTEIIVA
FT                   SVRHPMHVLESALIGADICTMPFKVMEQLFKHPLTDIGLERFLKDWEKVPEKPF"
FT   gene            complement(76010..77038)
FT                   /locus_tag="aq_121"
FT   CDS_pept        complement(76010..77038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_121"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06483"
FT                   /db_xref="GOA:O66521"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66521"
FT                   /protein_id="AAC06483.1"
FT                   /translation="MKYDVAIVGAGPGGSTCAYVLAKKGVRVLLIDSRKEVGYPVQCAE
FT                   FVPVQLSYEFPEFFPEETIAQKVKDMVHYTPWGEIVSMYSEGFILHREKWDKGIAKLAE
FT                   KEGAHLRTKTKFIGFEGKYLILKDLNKREVFKVKADIVVGADGARSLVAKLTGEHTKEF
FT                   LITAQYTLKLKKPLNDLLIFFRDYIPGGYGWIFPKQELANVGVGVDLSYGVNVVEVLNK
FT                   FVKEVKDFVEPEPIYGRTGGFIPGEGIKNPFRGNVLLVGDAGGFCHPITGGGIANAVIT
FT                   GSIAARAILEGDLEEFEEEALDTLGPSINRAAQKRKKLMKEWDNLEWRIPRTWIAFEEY
FT                   YK"
FT   gene            complement(77035..78246)
FT                   /gene="hisS1"
FT                   /locus_tag="aq_122"
FT   CDS_pept        complement(77035..78246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS1"
FT                   /locus_tag="aq_122"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_122"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06477"
FT                   /db_xref="GOA:O66522"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66522"
FT                   /protein_id="AAC06477.1"
FT                   /translation="MNIQSVRGFHDILGKDAKKFRKISDTARKILKLYNFEEIILPVVE
FT                   YAELFQRSVGETTDIVQKEMFVFEDRKGRKLALRPEGTAGTVRAFIQHKLYALRPYVKL
FT                   FYEGPMFRYERPQAGRYRQFHQIGAEVFGVAEPHADAEIIKIVYDILQALGIKGVVVEI
FT                   NSLGCKKDREAYREALLNYLTGVKEELCSDCISRMDRNPLRVLDCKVETCKVAVREAPK
FT                   MIDFLCDECREHYEKLKNYLKALDIPFRENYNLVRGLDYYTRTVFEAVSDELGLTLIAG
FT                   GRYDYLVEELGGPPTPALGFALGVERLMLLLPDEEEKEEVYFVIPFGDVHEYALRVADI
FT                   LRKKGKVVEYSYRKGGLKKQLEFADKLGVKYAVIIGEDEVKNQEVTIKDMETGEQRRVK
FT                   LSEL"
FT   gene            78328..78666
FT                   /gene="rpsP"
FT                   /locus_tag="aq_123"
FT   CDS_pept        78328..78666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="aq_123"
FT                   /product="ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:aq_123"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06492"
FT                   /db_xref="GOA:O66523"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="PDB:3BN0"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66523"
FT                   /protein_id="AAC06492.1"
FT                   /translation="MAVRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDPKRK
FT                   VLINVYPEKVKEWVLKGVELSHRAKAILWNHGILKEVVPEGYEMKRVGDYYVFEKRESK
FT                   KSKGGEAA"
FT   gene            78663..78902
FT                   /locus_tag="aq_124a"
FT   CDS_pept        78663..78902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_124a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_124a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06503"
FT                   /db_xref="GOA:O66524"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66524"
FT                   /protein_id="AAC06503.1"
FT                   /translation="MSALKDIVELTAKELVDNKDKVRVTEIEGEKTVVIELRVDPAELG
FT                   KVIGKQGRIARALRTILTAIGRKIGKRVVLEILE"
FT   gene            78902..79300
FT                   /locus_tag="aq_125"
FT   CDS_pept        78902..79300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_125"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_125"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06497"
FT                   /db_xref="GOA:O66525"
FT                   /db_xref="InterPro:IPR025423"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66525"
FT                   /protein_id="AAC06497.1"
FT                   /translation="MKEKLALALLSFFLGLGSFFSFYVAPTLFKVLERQQAGAVVEKVF
FT                   PVYFGLGIILVGISLFLGRDSGKLFLSLGILNLLLLLLQEFIVIPKLHGLKATNYELFL
FT                   KYHGVSMGINLAILLLTLGKVLILIFKR"
FT   gene            79305..79748
FT                   /locus_tag="aq_126"
FT   CDS_pept        79305..79748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_126"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_126"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06498"
FT                   /db_xref="UniProtKB/TrEMBL:O66526"
FT                   /protein_id="AAC06498.1"
FT                   /translation="MNVKEGVKELILSYGKNLAELEPINTKLIEYKLKLKAQIIKTLSL
FT                   DVDKSTKEEMFKDMLEGVNEAVAEIAKEMDTQNERMIERYMLFFESTSEVLKEFMEGDY
FT                   IEDKHELSQTLGKISKILEKLRLDLKEKQKGILKFIRRLIFRT"
FT   gene            79748..80566
FT                   /locus_tag="aq_127"
FT   CDS_pept        79748..80566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_127"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_127"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06499"
FT                   /db_xref="GOA:O66527"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:O66527"
FT                   /protein_id="AAC06499.1"
FT                   /translation="MLLSFLVYVLAWAFQAFTGFGAGIFIVGILSLFYEPKTVIVSSTV
FT                   VNLLGIISMLLFLGKITRPNFKILFPLIAGSVAGIGVSAKLLMEIDREVLKALIGGFVL
FT                   FLGIYDFLVQTNSLKFRLKASPFVGVFTGFLSGIFAGLIGMGGPPPVVYLNQVCRDLNT
FT                   YKITLSFFFATNVVFRIIFYLLYGGTEYWSYELILPAFLGAPLGVFAGIYLSRYFTPYF
FT                   VKRFISLSVLSLGLFLLLEGLKEFSHDFFKHSVIEESPYGGLKSHKTPGN"
FT   gene            complement(80390..81808)
FT                   /locus_tag="aq_128"
FT   CDS_pept        complement(80390..81808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_128"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06502"
FT                   /db_xref="GOA:O66528"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="PDB:6FV6"
FT                   /db_xref="PDB:6FV7"
FT                   /db_xref="PDB:6FV8"
FT                   /db_xref="UniProtKB/TrEMBL:O66528"
FT                   /protein_id="AAC06502.1"
FT                   /translation="MQRIIVNPNEPYLSVIKKVVKLSIPIIVVNLLYTVENMISMILVS
FT                   SISPSAVAATGFSLSLLWFIYSLMALSYSGTNILIAQFVGAKKDPSPILINGLFLSFLI
FT                   SLPLFFYGKDFVLFLMKVLGASETVRSLAKEYLTPIFWFIPIGFLTNTFYGAYNGAGDT
FT                   KTPMKVAIIMNLTHIGTAYTLINGKFGLPKLGVEGAGWGIAISEILAFFIYTFLLIFFK
FT                   KPFPLHLRLEPKLLFKMVRLGTPTALERAITTLSFNVFVGFLAKFGDKVLAAHQIGLRI
FT                   ESISFMIGFGVMIASTTLAGQNYGARNYRGMVHAVNTSAHFTALVMSLTGLILILFPHY
FT                   LVYPFSRDPEVIEWASYYLQIVGISQPAMAYASIYSGALKGMGKTHIPLFVNISSFWLF
FT                   RIIPSYFLLKVIHSPLVPWGFMTFETAVRALFYYTVFKKVVGKLLQTFQKEEEPEGEDA
FT                   EGDKPLDEVRSKVT"
FT   gene            81823..82287
FT                   /gene="ribH"
FT                   /locus_tag="aq_132"
FT   CDS_pept        81823..82287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="aq_132"
FT                   /product="riboflavin synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_132"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06489"
FT                   /db_xref="GOA:O66529"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="PDB:1HQK"
FT                   /db_xref="PDB:1NQU"
FT                   /db_xref="PDB:1NQV"
FT                   /db_xref="PDB:1NQW"
FT                   /db_xref="PDB:1NQX"
FT                   /db_xref="PDB:5MPP"
FT                   /db_xref="PDB:5MQ3"
FT                   /db_xref="PDB:5MQ7"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66529"
FT                   /protein_id="AAC06489.1"
FT                   /translation="MQIYEGKLTAEGLRFGIVASRFNHALVDRLVEGAIDCIVRHGGRE
FT                   EDITLVRVPGSWEIPVAAGELARKEDIDAVIAIGVLIRGATPHFDYIASEVSKGLANLS
FT                   LELRKPITFGVITADTLEQAIERAGTKHGNKGWEAALSAIEMANLFKSLR"
FT   gene            82284..82730
FT                   /gene="nusB"
FT                   /locus_tag="aq_133"
FT   CDS_pept        82284..82730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="aq_133"
FT                   /product="transcription termination NusB"
FT                   /db_xref="EnsemblGenomes-Gn:aq_133"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06491"
FT                   /db_xref="GOA:O66530"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="PDB:2JR0"
FT                   /db_xref="PDB:3R2C"
FT                   /db_xref="PDB:3R2D"
FT                   /db_xref="PDB:4EYA"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66530"
FT                   /protein_id="AAC06491.1"
FT                   /translation="MRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYE
FT                   YAKKLVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEPGRVF
FT                   IDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSSKEEKPSLKSE"
FT   gene            82932..83387
FT                   /locus_tag="aq_134"
FT   CDS_pept        82932..83387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_134"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_134"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06500"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:O66531"
FT                   /protein_id="AAC06500.1"
FT                   /translation="MRQVSVIGSSKASEEEYEFAYRLGKELAKRNLVVVCGGRTGVMEA
FT                   VCKGAKEEGGLTIGIMPSYDGHEANPYVDIKVNTGMNWNRNPIVVASSEMVLAVGGNYG
FT                   TLSEIAYALILGKYVVGYKTHKVEGVEQVESLEEMLKKVDEFFGGRL"
FT   gene            83384..84331
FT                   /gene="nueM"
FT                   /locus_tag="aq_135"
FT   CDS_pept        83384..84331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nueM"
FT                   /locus_tag="aq_135"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_135"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06490"
FT                   /db_xref="GOA:O66532"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O66532"
FT                   /protein_id="AAC06490.1"
FT                   /translation="MKVFITGATGFVGRHIVRELLNRGYEVHAGVRNLSKLERLFGNQV
FT                   KGYIVNFDEKDSIREALGKVNPDFVIHLIGILYEEKKKGITFERVHYGHTKNLVEVSKG
FT                   FNVKKFLFMSALGTHDEAPSRYHQTKRWAEREVINSGLNYTIFRPSIILGPEQKLFFDM
FT                   YKITKYIPVVALPDFGNYQFQPVDVRDVACAYAEALKNPETDRKIYELCGTKVVTFKEL
FT                   LADIFSYWDRKVLMIPMPKKLMYFAGLIVEKIIEPPPFSSDQIKMMWKPNVCGVLKDEA
FT                   ISNGIKSICKREPIPYEESLKWSLENFDIIIKGK"
FT   gene            84354..85421
FT                   /gene="cpx"
FT                   /locus_tag="aq_136"
FT   CDS_pept        84354..85421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpx"
FT                   /locus_tag="aq_136"
FT                   /product="cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_136"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06485"
FT                   /db_xref="GOA:O66533"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:O66533"
FT                   /protein_id="AAC06485.1"
FT                   /translation="MRKGLLLMAVFAGFVVAKEKIDDKELLKMARQYFKPLPKVAENPQ
FT                   NPVTPEKVKLGKMLYYDPRLSKSGLISCNTCHNLARYGVDNLPTSIGHRWAIGPRNAPT
FT                   VYNAAIHIAQFWDGRAKDVEEQALGPIVNPIEMANTEENAVKTLKSIPEYVELFKKAFP
FT                   NEKDPVKYENIGKAIGAFERTLMTPSRFDEFLKGNTKALTEQEKRGLKTFIEVGCVACH
FT                   NGPGVGGNMFAKFGMITEYWKVTYPYVLVGKPAIKVDFGRFGVTKKEEDMFVFKVPSLR
FT                   NIEHTYPYFHDGSVWSLEDAVRIMAKTQLGKELTDQQVKDIVAFLKALTGKIPKHALEV
FT                   PELPPSTDKTPKPEL"
FT   gene            complement(85418..86488)
FT                   /gene="ribD1"
FT                   /locus_tag="aq_138"
FT   CDS_pept        complement(85418..86488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD1"
FT                   /locus_tag="aq_138"
FT                   /product="riboflavin specific deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_138"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06487"
FT                   /db_xref="GOA:O66534"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66534"
FT                   /protein_id="AAC06487.1"
FT                   /translation="MIREIDKNYMKLALSLAKKRKGYTHPNPTVGAVVVKEGKIVGLGY
FT                   HEKAGKPHAEVMALGQAGEKAKGATLYVTLEPCTHFGRTPPCTDAIIRSGIKRVVVATL
FT                   DPNPLMSGKGVEKLRNAGIEVDVGVCEEEARELNEDFFTYITQERPYITLKWAQTLDGK
FT                   LATLTGSSKWITSKESRKVAHILRREATAVLVGVNTVIKDDPHLTVRFVPTEKQPVRII
FT                   LDPELEVPLSAKVLNTEEAPTIVITKKENEKAEKLKEKGVQVLILKGFNLKNILKKLKE
FT                   LEIMHLMVEGGPRTLTSFLKEGFFDRIVVFIAPKIMGEGLSIGDLGIRSIEESLKVRKK
FT                   KVENLGEDLVIFFKRY"
FT   gene            complement(86485..87429)
FT                   /gene="ribF"
FT                   /locus_tag="aq_139"
FT   CDS_pept        complement(86485..87429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="aq_139"
FT                   /product="riboflavin kinase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_139"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06488"
FT                   /db_xref="GOA:O66535"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:O66535"
FT                   /protein_id="AAC06488.1"
FT                   /translation="MEVFLLKLDSKNCPNKRLKTLEEVPENTAITVGNFDGVHLGHRYL
FT                   IENLKKKAKSENLKTLVLTFCPHPLKVLAPQLLPCELTDINEKIEIFRELGVDYLCFIR
FT                   FDKEFAKIRAREFLEKIIYEKLKCRYLLVGYDWRYGYRREGEIELAKEVGSELGFEVEE
FT                   AKPFKIKGHIVSSTLIRRLLREGRVEEVREYLGHNYWVKRKVVKGDQRGSKIGFPTANL
FT                   QNTENLCLKEGVYAVKVEDKYLGVANYGYRPTFGKKKRVLEVHILDFEGNLRGKRIKVE
FT                   FLKFIREEKKFSSVEELIQQIKKDVEAVKGLSK"
FT   gene            complement(87436..87801)
FT                   /gene="pkcI"
FT                   /locus_tag="aq_141"
FT   CDS_pept        complement(87436..87801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkcI"
FT                   /locus_tag="aq_141"
FT                   /product="protein kinase C inhibitor (HIT family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_141"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06496"
FT                   /db_xref="GOA:O66536"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66536"
FT                   /protein_id="AAC06496.1"
FT                   /translation="MQEKDCIFCKIVRGEVPAKKVYEDDKVLAFHDINPVAPVHILIIP
FT                   KKHIMGIQTLEPEDECLVGHMFYVARKIAEDLGIAPDENLNKGYRLVFNVGKDAGQSVF
FT                   HLHLHLIGGREMSWPPG"
FT   gene            88156..88596
FT                   /locus_tag="aq_142"
FT   CDS_pept        88156..88596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_142"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_142"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06501"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66537"
FT                   /protein_id="AAC06501.1"
FT                   /translation="MRNKVLIVLAVIAGALILKSCGEPYSGAKETVGEFMEEIAEGEGR
FT                   DAIKYLYPAYRDELAKNFKLPVQFTEMKPSEVLACVLSTMGRNIDEVEIKKAIAVNPNT
FT                   ANVVVKVEDKEGIEKFFSFTVVKEGDKWYIAKIEKYIPQVGR"
FT   gene            88593..89546
FT                   /gene="rfaC2"
FT                   /locus_tag="aq_145"
FT   CDS_pept        88593..89546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC2"
FT                   /locus_tag="aq_145"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_145"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06484"
FT                   /db_xref="GOA:O66538"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:O66538"
FT                   /protein_id="AAC06484.1"
FT                   /translation="MKILIWQTAYLGDVVLATPLIQTLKKNFPDAKIGFVGRPFIKELF
FT                   KDEEVELIPYSKKFKESFTVIRKIKNYDVVISPHRSMRTALILFFSGIKERIGFDRSDL
FT                   PFLYTKLVPHRWELHEVDRNLELLKPLGVKEFIRETKLKMKEEEYRKILNKFNLKEKKY
FT                   IVISPFSNFPLKEWSLKNWKELVRKLNTPVVITGTKEDEERSKEIDGKNVVNLVGKTSL
FT                   REFMGVLKGAKFAISNDSSAVHVANAFRVPALTIYTATSPKYGFYPLIGEYIQNPAPCS
FT                   PCSPNPKKCKTGTKECLYFPEPDYVLEKAIPYIKDL"
FT   gene            89543..90421
FT                   /gene="cobW"
FT                   /locus_tag="aq_147"
FT   CDS_pept        89543..90421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="aq_147"
FT                   /product="cobalamin synthesis related protein CobW"
FT                   /db_xref="EnsemblGenomes-Gn:aq_147"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06494"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66539"
FT                   /protein_id="AAC06494.1"
FT                   /translation="MISAFVVTGFLGSGKTSLIINSVKEHLKDKKVAIVVNEFGEVGVD
FT                   GKILKNVYSEVLELSEGCICCKLSAEFESSVRRLIQDYNPEVLIVETSGVAEPFPIVFS
FT                   LKTLGLFVDGVICVIDSKNFPKYKEDDTAKYQLATSNVVVLNKTDLVSKEELEKVKEEV
FT                   KKIKEKYKVVNMFSPEEKESFYKIYEATYGKVPAEVFKGVGKPVELKEHLHFHSHDSRK
FT                   EEVVTFDRELTEEELVNFLKNLPKEVIRAKGIVKLKDYPFPVFVHYVFGDYDYGMPAEN
FT                   YEGESFLVLIR"
FT   gene            90418..91077
FT                   /gene="deoC"
FT                   /locus_tag="aq_148"
FT   CDS_pept        90418..91077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="aq_148"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_148"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06495"
FT                   /db_xref="GOA:O66540"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="PDB:1MZH"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66540"
FT                   /protein_id="AAC06495.1"
FT                   /translation="MIDVRKYIDNAALKPHLSEKEIEEFVLKSEELGIYAVCVNPYHVK
FT                   LASSIAKKVKVCCVIGFPLGLNKTSVKVKEAVEAVRDGAQELDIVWNLSAFKSEKYDFV
FT                   VEELKEIFRETPSAVHKVIVETPYLNEEEIKKAVEICIEAGADFIKTSTGFAPRGTTLE
FT                   EVRLIKSSAKGRIKVKASGGIRDLETAISMIEAGADRIGTSSGISIAEEFLKRHLI"
FT   gene            91085..91864
FT                   /gene="gltA"
FT                   /locus_tag="aq_150"
FT   CDS_pept        91085..91864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="aq_150"
FT                   /product="citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_150"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06486"
FT                   /db_xref="GOA:O66541"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:O66541"
FT                   /protein_id="AAC06486.1"
FT                   /translation="MADKKWKTAISTHVNHEPYVRGYRLLDLVGNLTFSEAIYLLLKGE
FT                   LPSEAEAKMMDAIFVSVIEHSIAPPSVIATRAVISGGNSLNVGVGAGVLAFGSAHGGAL
FT                   EDAMKFMQEGVKSNRPVEEIVKEYLSQKKPIPGYGHRYYKEFDPRTKRLFELAEKYGFC
FT                   KEHCEFAKKVEEEIYKQKGKRIVLNVDGAIAAITSDMGFDWRLGKGFFIIGRVPGLVAH
FT                   AYEELTQEKPFSKRLSEEEYEYTGVEPRELPPERKKV"
FT   gene            91861..92301
FT                   /gene="tlpA"
FT                   /locus_tag="aq_152"
FT   CDS_pept        91861..92301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpA"
FT                   /locus_tag="aq_152"
FT                   /product="thiol disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_152"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06493"
FT                   /db_xref="GOA:O66542"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:O66542"
FT                   /protein_id="AAC06493.1"
FT                   /translation="MKRLLPVFLALILFGLLVYIGLNQDKHDHYTITTQKGQKIPNVTL
FT                   TTPDGKKVSIEEFKGKVLLINFWATWCPPCKEEIPMFKEIYEKYRDRGFEILAINMDPE
FT                   NLTGFLKNNPLPFPVFVINEKWKEPLTFQGFQRRTWLTEEEL"
FT   gene            92881..93771
FT                   /gene="ctaA"
FT                   /locus_tag="aq_153"
FT   CDS_pept        92881..93771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="aq_153"
FT                   /product="heme O oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_153"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06508"
FT                   /db_xref="GOA:O66543"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:O66543"
FT                   /protein_id="AAC06508.1"
FT                   /translation="MNTNLKSSPLKTLVLASVVLTYVLMVFGGIVTSTGSGLGCPDWPL
FT                   CHGQLLPFQLKEQIPTPPAPVVAPTPLQPWIEQTHRILGGITGIVLLATLFYAFKRGTS
FT                   FVKKALVFIFIALILEALLGMRVVITEAPLLRELLHYVYTSAHLILSVFILSTITITYY
FT                   YVKFFGERPKEYIPYADALYVATMFQILLGIFVRYVKALEYNQFVYYLHITYAGFLVIL
FT                   SLFIMFKEFNKYSLITFLLMTAQILAGVATVISGFFLPYLFLHIAIGFFIVLWVSYLVA
FT                   PSVLKTYTEFRGELA"
FT   gene            93768..94646
FT                   /gene="ctaB"
FT                   /locus_tag="aq_154"
FT   CDS_pept        93768..94646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="aq_154"
FT                   /product="cytochrome c oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:aq_154"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06505"
FT                   /db_xref="GOA:O66544"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66544"
FT                   /protein_id="AAC06505.1"
FT                   /translation="MSERVEAGQNVIKEYLVLTKPGIVSLVLITTLGGMYLGSRGELQP
FT                   ELVFWTLLGTGLAAAGSAVLNMVIDKDIDKLMVRTSERPLPKGTVDPTKAFIFGITLQV
FT                   FSLVIMLTFVGVLPALLVALASFSYVILYSLLLKRKSPVATEIGGISGALPPVIGYVAA
FT                   SGSVDINAIALFLLMFMWQPPHFWVLALKYADDYKRAGIPTLPVARGVFITKLKTLLYT
FT                   ASLFPVSLIPYLTGLVENLYFVVAVVMNLIYLGLTLKFFFSKKEESMKLFFFSIIYLAV
FT                   LFGTMIVDMVK"
FT   gene            94648..95808
FT                   /locus_tag="aq_155"
FT   CDS_pept        94648..95808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_155"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_155"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06511"
FT                   /db_xref="GOA:O66545"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66545"
FT                   /protein_id="AAC06511.1"
FT                   /translation="MLWFSLFILSIAIGGSFALLVAIARTPGLADLFPPKYFYHALVGH
FT                   VDSALIVGLYAFLIFLWHRIFEKKENFASFLPALLGFFMIAGSSLFGLGQALWNNYVPT
FT                   IIHPVFFGGVSLFFLGVFLNSLRFLPQAVKNFYIGDTLKSILSTTVINSFLMPLTYLIA
FT                   YFNTPKGENVYEYFEALFWFGGHTHQFVNAGLLISLWLLLLRREVLNLWFLNLLLVVFP
FT                   ITYFFAQIFLNPLSSTGKSLTTWGYMVGIGIPTIVYGLITLVRAVKGLDFYRSILVLSV
FT                   SLYLLGALMGYMIVGMDTRVPAHYHTVIASILVGVIALTFMYLQELGYMEKLGKFEKFI
FT                   PFSTVLVCFFLSSDSSGRESLELQGKLRERITYKTQRFTYSWLSWD"
FT   gene            96008..96406
FT                   /locus_tag="aq_156"
FT   CDS_pept        96008..96406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_156"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06515"
FT                   /db_xref="GOA:O66546"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:O66546"
FT                   /protein_id="AAC06515.1"
FT                   /translation="MYELITILSLVTIGLSGLLILTGIVLIKLGKREWHKRAMLTASFL
FT                   ALIFVVLYLIKSSLYPPKQYTGEYKTLYYFVLWSHTILAIINFPLAVYTVYLGLKGLYD
FT                   KHRKIAPITAAVWIYVAVTGWMIYFFLN"
FT   gene            96408..96896
FT                   /locus_tag="aq_157"
FT   CDS_pept        96408..96896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_157"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_157"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06512"
FT                   /db_xref="GOA:O66547"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66547"
FT                   /protein_id="AAC06512.1"
FT                   /translation="MEGIMKKFFALMTLIAGISFSLDFACVDTNKVIRESKFIAKAQTE
FT                   LRKELEKYQKLIQEKQKKLEALKKSLESKALSEKAKEKKAKEIEQLEDELRKLQVEAQS
FT                   KLSRKKAELEKMVFDKVIKIVESTAKKKKIKAVFDCNSMLYWDKKIDITNEVLKELDK"
FT   gene            96893..97297
FT                   /gene="apfA"
FT                   /locus_tag="aq_158"
FT   CDS_pept        96893..97297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apfA"
FT                   /locus_tag="aq_158"
FT                   /product="AP4A hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_158"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06510"
FT                   /db_xref="GOA:O66548"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="PDB:3I7U"
FT                   /db_xref="PDB:3I7V"
FT                   /db_xref="UniProtKB/TrEMBL:O66548"
FT                   /protein_id="AAC06510.1"
FT                   /translation="MKKEFSAGGVLFKDGEVLLIKTPSNVWSFPKGNIEPGEKPEETAV
FT                   REVWEETGVKGEILDYIGEIHYWYTLKGERIFKTVKYYLMKYKEGEPRPSWEVKDAKFF
FT                   PIKEAKKLLKYKGDKEIFEKALKLKEKFKL"
FT   gene            complement(97287..97835)
FT                   /locus_tag="aq_159"
FT   CDS_pept        complement(97287..97835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_159"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_159"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06513"
FT                   /db_xref="GOA:O66549"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:O66549"
FT                   /protein_id="AAC06513.1"
FT                   /translation="MLEEAKKWGDIPVIVAGGVWSYYDIKKFIDMGASGVQMATRFIAT
FT                   HECDAPQIYKELVTNLNKEDIMLFKSPVGYPLRVIKTPFIERLLSGYNGWKGCVSHCVV
FT                   PCNKGEEAKKVGFCIADRLGLAWLGDYEEGIFISGANGHWLKYQGIIHVKELLDILTGK
FT                   KNDPTLERIEEEQKGTVKV"
FT   gene            98536..99018
FT                   /gene="folK"
FT                   /locus_tag="aq_162"
FT   CDS_pept        98536..99018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="aq_162"
FT                   /product="folate biosynthesis
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_162"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06507"
FT                   /db_xref="GOA:O66550"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66550"
FT                   /protein_id="AAC06507.1"
FT                   /translation="MATVYLGLGSNVGDRISYILKAIEKLEEFLEIEKISTVYESKAWG
FT                   FENQGNFLNFVLKAKTSLLPQELLLKIKKVEKEVGRKERFKWGPREIDIDILLYKDEVI
FT                   RTKLLKVPHPFLEKRDFFVYPLLEIEPNVIHPIYRKPLKEFKPENTLKPFCCILKV"
FT   gene            99015..100343
FT                   /gene="ntrC4"
FT                   /locus_tag="aq_164"
FT   CDS_pept        99015..100343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC4"
FT                   /locus_tag="aq_164"
FT                   /product="transcriptional regulator (NtrC family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_164"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06509"
FT                   /db_xref="GOA:O66551"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:1ZIT"
FT                   /db_xref="PDB:2JRL"
FT                   /db_xref="PDB:3DZD"
FT                   /db_xref="PDB:3E7L"
FT                   /db_xref="PDB:4FTH"
FT                   /db_xref="UniProtKB/TrEMBL:O66551"
FT                   /protein_id="AAC06509.1"
FT                   /translation="MKRVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKELF
FT                   FPVIVLDVWMPDGDGVNFIDFIKENSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPF
FT                   SVERFLLTIKHAFEEYSKKAPPQEEIEFVGEHPKILEIKRLIPKIAKSKAPVLITGESG
FT                   TGKEIVARLIHRYSGRKGAFVDLNCASIPQELAESELFGHEKGAFTGALTRKKGKLELA
FT                   DQGTLFLDEVGELDQRVQAKLLRVLETGSFTRLGGNQKIEVDIRVISATNKNLEEEIKK
FT                   GNFREDLYYRLSVFQIYLPPLRERGKDVILLAEYFLKKFAKEYKKNCFELSEETKEYLM
FT                   KQEWKGNVRELKNLIERAVILCEGEVIKPEDLGLKEKSWRDLSYLLKIKELKEAKKEFE
FT                   KIFIEEKLREYDYDLKRTAEEIGIDLSNLYRKIKSLNIRVKSS"
FT   gene            complement(100330..101019)
FT                   /locus_tag="aq_165"
FT   CDS_pept        complement(100330..101019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_165"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06516"
FT                   /db_xref="GOA:O66552"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="PDB:2EGV"
FT                   /db_xref="PDB:2EGW"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66552"
FT                   /protein_id="AAC06516.1"
FT                   /translation="MHVFYSEERRGNLLILREGEVKHFRVRRIEKDEEFGVIHEGKIYV
FT                   CKVRREDKREISCEIVEELETKLPPKDITLYQSVTVDLKTMDTIVRQATELGVLTFVPI
FT                   ISERSFQKEEAILKKTEKWKRIVIEAMKQSRRPIPMEIKKPVRLSDLIPESEENIILDN
FT                   FYEGVKPKDVNLEAKTYSVVVGPEGGFSKRESQILREKGFKSVLLEPYTLRTETAVVSI
FT                   VSILMNF"
FT   gene            101014..101811
FT                   /gene="proC"
FT                   /locus_tag="aq_166"
FT   CDS_pept        101014..101811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="aq_166"
FT                   /product="pyrroline carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_166"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06504"
FT                   /db_xref="GOA:O66553"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66553"
FT                   /protein_id="AAC06504.1"
FT                   /translation="MHAIILTMRVGIVGFGNMGQAFALCFSKKLGKENIIVTDKVQEKR
FT                   NLATEMGIAFASDVKFLADNSDVVLVAVKPKDSQEVLQKLKDYKGIILSIMAGVSIEKM
FT                   EKILGKDKKIVRVMPNVNVAVGSGVMAITDNGNLSEEERSKVEELLLSCGTLYRIEERL
FT                   FDAFTALAGSGPAFVFSFIDALALAGVHQGFSYEQALRIALDTVMGSAKLLKEFQVNPN
FT                   ELIAKVTSPGGTTIEGIKYLEEKGFKGTVMECINRTSQKAKKL"
FT   gene            101772..102392
FT                   /locus_tag="aq_167"
FT   CDS_pept        101772..102392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_167"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06517"
FT                   /db_xref="GOA:O66554"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66554"
FT                   /protein_id="AAC06517.1"
FT                   /translation="MYKQDFPEGKEALNLEIRLGNKLVRFRKFTGKEKIYLPIQRHTDK
FT                   VIKLIDKDSPPLEGDAVITNLKNVEIGVRTADCVPIILLGKEWVGAVHAGWRGLKKGII
FT                   AKTLKALKEEGEDDITALVFPSAKGCCYEVGKEFKEFFRRNLKERNGKLFFDPQREAVE
FT                   QLRENGIKSILVWEKCTICSPELPSYRRDKTKERMLTSVVILF"
FT   gene            complement(102389..102898)
FT                   /locus_tag="aq_168"
FT   CDS_pept        complement(102389..102898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_168"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06518"
FT                   /db_xref="GOA:O66555"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="PDB:2YV5"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66555"
FT                   /protein_id="AAC06518.1"
FT                   /translation="MDSIYRDAGYDVLKVSAKTGEGIDELVDYLEGFICILAGPSGVGK
FT                   SSILSRLTGEELRTQEVSEKTERGRHTTTGVRLIPFGKGSFVGDTPGFSKVEATMFVKP
FT                   REVRNYFREFLRYQCKYPDCTHTNEPGCAVKEAVKNGEISCERYKSYLKIIKVYLEEIK
FT                   ELCRED"
FT   gene            complement(102853..103296)
FT                   /locus_tag="aq_169"
FT   CDS_pept        complement(102853..103296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_169"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_169"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06514"
FT                   /db_xref="GOA:O66556"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66556"
FT                   /protein_id="AAC06514.1"
FT                   /translation="MGKKELKRGLVVDREAQMIGVYLFEDGKTYRGIPRGKVLKKTKIN
FT                   AGDYVWGEVVDPNTFAIEEVEERKNLLIRPKVANVDRVIIVETLKMPEFNNYLLDNMLV
FT                   VYEYFKVEPVIVFNKIDLLNEEEKKELERWIAFTGMRATTFSR"
FT   gene            complement(103299..104660)
FT                   /gene="bioA"
FT                   /locus_tag="aq_170"
FT   CDS_pept        complement(103299..104660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="aq_170"
FT                   /product="DAPA aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_170"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06506"
FT                   /db_xref="GOA:O66557"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66557"
FT                   /protein_id="AAC06506.1"
FT                   /translation="MWELDPKTLEKWDKEYFWHPFTQMKVYREEENLIFERGEGVYLWD
FT                   IYGRKYIDAISSLWCNVHGHNHPKLNNAVMKQLCKVAHTTTLGSSNVPAILLAKKLVEI
FT                   SPEGLNKVFYSEDGAEAVEIAIKMAYHYWKNKGVKGKNVFITLSEAYHGDTVGAVSVGG
FT                   IELFHGTYKDLLFKTIKLPSPYLYCKEKYGELCPECTADLLKQLEDILKSREDIVAVIM
FT                   EAGIQAAAGMLPFPPGFLKGVRELTKKYDTLMIVDEVATGFGRTGTMFYCEQEGVSPDF
FT                   MCLGKGITGGYLPLAATLTTDEVFNAFLGEFGEAKHFYHGHTYTGNNLACSVALANLEV
FT                   FEEERTLEKLQPKIKLLKERLQEFWELKHVGDVRQLGFMAGIELVKDKEKGEPFPYGER
FT                   TGFKVAYKCREKGVFLRPLGDVMVLMMPLVIEEDEMNYVIDTLKWAIKELEKEV"
FT   gene            104858..105598
FT                   /locus_tag="aq_171"
FT   CDS_pept        104858..105598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_171"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_171"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06527"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66558"
FT                   /protein_id="AAC06527.1"
FT                   /translation="MEEEEVYIDVNSPVALKVHPSKDLMKFLLSENANLKMASFFTEFE
FT                   KGFMDIIVGIKIRYKDLSRELLKFVVLNIGNLANEYGKEIRAVFGGLSFKEYLEREKYS
FT                   YPYSGEKLFQEKISINGTLLLLEVYVKEENYTLICREEGSSNYLIKAIRKVEGPYEALK
FT                   ILEKAKESIKNRDFVSLRKLFSPYEVDFFELYSVFLKGKDTTKLKKLEKEIHELPYMLI
FT                   NGKITYEEYKKRIREIEKEIGLSE"
FT   gene            complement(105912..106574)
FT                   /gene="mutY2"
FT                   /locus_tag="aq_172"
FT   CDS_pept        complement(105912..106574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY2"
FT                   /locus_tag="aq_172"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:aq_172"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06526"
FT                   /db_xref="GOA:O66559"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:O66559"
FT                   /protein_id="AAC06526.1"
FT                   /translation="MSGIGKRELIELYDKLLQFYGKQNWWPVDLEYHKTHGSDPREEVI
FT                   IGAILTQNTSWKNVEKALENLKREKALNLKAIKEIPTEKLMELIKPAGFYRQKSLYLKE
FT                   FANKFPSISHLKNVKREDLLKVKGIGKETADAILLYALDRLEFVVDAYTKRLLERLWNI
FT                   KGSYEEIKRLFEKNLPKDLEIYREFHALIDIHAKEFCKKKPLCEECPLREKCIKSCF"
FT   gene            complement(106547..107290)
FT                   /locus_tag="aq_173"
FT   CDS_pept        complement(106547..107290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_173"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_173"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06528"
FT                   /db_xref="GOA:O66560"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:O66560"
FT                   /protein_id="AAC06528.1"
FT                   /translation="MRVKAYLEVPKEISIFYRRSFLSLIKKALEKEDENYAKDLFQKKN
FT                   FKPFTFCVFFENIRINGEILENNGKAIMTVSSGSPDFFHRFYNGLKKLREYNGRYTNGN
FT                   IKVKKVLMCEEEQITKPRQTFRTLSPIVVINRDKKPVLPSKLGNRNDDFILYDDGAFTQ
FT                   ELRYSLKCIFNGLPELKFEHQEGKKSVVKHVVGNRENEKVIKIVAYQGVFTLEGDPYVL
FT                   NEVYKYGLGFRRYQGFGCLELVKES"
FT   gene            complement(107287..108795)
FT                   /locus_tag="aq_175"
FT   CDS_pept        complement(107287..108795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_175"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06534"
FT                   /db_xref="GOA:O66561"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66561"
FT                   /protein_id="AAC06534.1"
FT                   /translation="MMDNDNQFWKRFLIFTILMFLFITAYELFYIYYVKPSQPQKTEKK
FT                   EVVKKEEFKNVNLPQLMLGTFREKQEYKNTKTVKLGIYSLELSEKGGKILRFIDQKYGF
FT                   DLISKAERELKIFPLEIFTGNPDLDQKLNFGEYEIKEGKNSVELIHKELKVKKILSYKN
FT                   GAIHLSVEGLKPPFWVFVGSPPDDEAFYTHVGPVLKINGEVVRLDVDDLKGINEFEGNI
FT                   EFGGEESRYFFKGAKDYQKHIVYKVKLGDKFVSLSTFLYDGEKTIYLGAKDYARLRELG
FT                   LVDTLDWGTLKIIVKPLFLFLYWIYEHTGSWVLSILVLTFIVRIFLFPLGYKSVVSMQK
FT                   LQELAPKMEKIKQKYKDDPVKMQEEMMKLYAETGFNPMAGCLPILLQIPIFFALYKVLI
FT                   ITVDLKVSSFLWIPSLADKDPYYILPVIMGLTMILQQKMTPSPDPKQALVGYITSVAFT
FT                   LLFINFPAGLVLYWTLNNVFNIIQNYLIKEVLLKDKSKGGSKKK"
FT   gene            complement(108732..108998)
FT                   /locus_tag="aq_175a"
FT   CDS_pept        complement(108792..108998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_175a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_175a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06538"
FT                   /db_xref="GOA:O66562"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66562"
FT                   /protein_id="AAC06538.1"
FT                   /translation="MKSIVLIFLKFWQKFISPLYPSSCRYYPTCSTYAIMAVEKYGVLK
FT                   GLIKAFFRVLRCNPFFKGGVDYP"
FT   gene            complement(109002..109145)
FT                   /gene="rpmH"
FT                   /locus_tag="aq_176"
FT   CDS_pept        complement(109002..109145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="aq_176"
FT                   /product="ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:aq_176"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06537"
FT                   /db_xref="GOA:O66563"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66563"
FT                   /protein_id="AAC06537.1"
FT                   /translation="MVTEGLKPHISIKKKKRKSGFLARMRTKSGRKIIARRRRKGRKRL
FT                   AP"
FT   gene            complement(109189..109491)
FT                   /gene="atpE"
FT                   /locus_tag="aq_177"
FT   CDS_pept        complement(109189..109491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="aq_177"
FT                   /product="ATP synthase F0 subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:aq_177"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06524"
FT                   /db_xref="GOA:O66564"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66564"
FT                   /protein_id="AAC06524.1"
FT                   /translation="MMKRLMAILTAIMPAIAMAAEGEASVAKGLLYLGAGLAIGLAGLG
FT                   AGVGMGHAVRGTQEGVARNPNAGGRLQTLMFIGLAFIETIALYGLLIAFILLFVV"
FT   gene            complement(109507..109914)
FT                   /locus_tag="aq_178"
FT   CDS_pept        complement(109507..109914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_178"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_178"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06529"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:1Q77"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66565"
FT                   /protein_id="AAC06529.1"
FT                   /translation="MKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLE
FT                   RANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEG
FT                   KGYELVVWACYPSAYLCKVIDGLNLASLIVK"
FT   gene            complement(109916..110566)
FT                   /gene="atpB"
FT                   /locus_tag="aq_179"
FT   CDS_pept        complement(109916..110566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="aq_179"
FT                   /product="ATP synthase F0 subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:aq_179"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06523"
FT                   /db_xref="GOA:O66566"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66566"
FT                   /protein_id="AAC06523.1"
FT                   /translation="MEYSHVVYALLAVALAIIFVLKGGKPSLKPTKYQALLEGYLRFVR
FT                   NMLLENVGERGLKYVPLIAAIGLFVFFGNILGMVPGFEAPTANINTNLALALLVFFYYH
FT                   FEGFRENGLAYLKHFMGPIPLMAPFFFVVEVISHIARPITLSLRLFANMKAGALLLLTL
FT                   VSLVIKNPFTLVVSPVVLIFVIAIKFLAIFIQTYIFMILSVVYIAGAVAHEEH"
FT   gene            110616..111377
FT                   /gene="hisF"
FT                   /locus_tag="aq_181"
FT   CDS_pept        110616..111377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="aq_181"
FT                   /product="HisF (cyclase)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_181"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06520"
FT                   /db_xref="GOA:O66567"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020021"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66567"
FT                   /protein_id="AAC06520.1"
FT                   /translation="MLAKRIIPCLDVDKGRVVKGVKFLNLRDAGDPVEVAKRYEEEGAD
FT                   ELVFLDITASAEDREIMIDVVKKVAETVFMPFTVGGGIRSLEDMRRLLEAGADKISINT
FT                   AAVKNPNLIYEGAKRFGSQCIVVAIDAKRKGNSWEVYIHGGRTPTGLDAVEWAKKVESL
FT                   GAGEILLTSMDRDGTKDGYDIELNRAISEAVNIPVIASGGAGKKEHFYEVFSKTKVEAA
FT                   LAASVFHFREISIPELKEYLLERGINVRPLD"
FT   gene            complement(111355..112101)
FT                   /locus_tag="aq_182"
FT   CDS_pept        complement(111355..112101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_182"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_182"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06530"
FT                   /db_xref="UniProtKB/TrEMBL:O66568"
FT                   /protein_id="AAC06530.1"
FT                   /translation="MYKTLIFLLVLLTSLSFSVCPTQVFLKYKVSDKSGKYFRRTDVIL
FT                   YTNIKVKGEKMKNVEADIRVTKGKSAVIEITPKVDLNEDILLVIPVKSDLPEVANIEEL
FT                   EGNVKKNYIAYPVDIGKDYVKFPITSFKKEKQIKVILETQDIGNPYFEKMKNSEIKESL
FT                   KITYSIYFGYAKVKTEDKNLEYLKDLISKLEKSGLLQKVEFIGFADANSKNPERNAEIA
FT                   KKRALFVLEEVLGKEALKCVSQEVSR"
FT   gene            complement(112111..113304)
FT                   /locus_tag="aq_183"
FT   CDS_pept        complement(112111..113304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_183"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_183"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06531"
FT                   /db_xref="GOA:O66569"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:O66569"
FT                   /protein_id="AAC06531.1"
FT                   /translation="MILFLLLLSISFLFSYEELEKGKIRELFKKFYEGKTNDLELKVLK
FT                   SYFENLNITVEDYVKLYTEGLLLEKEGKLKEAIQAYLKSIELNPYYNPSYYRFNFLIRK
FT                   VENKEIYREKIRKILEKRFKEAPPVLVENPENHYVFLVEKMSQYLFVFKGKKLEGMYPV
FT                   TTGMNIGDKEREGDGKTPEGVYYFTRFIPPEQLSEIYGGIAVALNYPNPYDKLLGKTGS
FT                   GIWLHGSNEKDRDKLPFSTRGCVVAQTDVLKTEIVPKINLSNTLIGIYKVIPQSLEVEN
FT                   VKEFILSWKNAWEKKDLNRFISFYSKHFRWKGGGLKEWKDYKKRTILSKKFIKVDISNL
FT                   SILAFSKLGDDEPRYYVIEFYQKYRSDTYSDEGIKRMYVVKEDGKLKVLSEEFIMKK"
FT   gene            complement(113301..113531)
FT                   /gene="rpoZ"
FT                   /locus_tag="aq_183a"
FT   CDS_pept        complement(113301..113531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="aq_183a"
FT                   /product="RNA polymerase omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_183a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06536"
FT                   /db_xref="GOA:O66570"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66570"
FT                   /protein_id="AAC06536.1"
FT                   /translation="MSRRPKIEEAMKRVESRYELVHAAVRRTLQLLREGEDFFVQEGGE
FT                   VHKKTFAAIEDIAEGKVKIIKKKEESGSKEE"
FT   gene            complement(113515..113844)
FT                   /locus_tag="aq_184"
FT   CDS_pept        complement(113515..113844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_184"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06535"
FT                   /db_xref="GOA:O66571"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66571"
FT                   /protein_id="AAC06535.1"
FT                   /translation="MKKFFPEAVTIFLLPPSFEELKRRIEGRGYVDSNVSKRLETAKGE
FT                   VPCARFFDYIVINDYLNEAVEKVKSIILSYRVKKERVLDEIEKFRLDKDIVDLLKGGEC
FT                   YVKET"
FT   gene            complement(114179..114652)
FT                   /gene="tagD1"
FT                   /locus_tag="aq_185"
FT   CDS_pept        complement(114179..114652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagD1"
FT                   /locus_tag="aq_185"
FT                   /product="glycerol-3-phosphate cytidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_185"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06521"
FT                   /db_xref="GOA:O66572"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:O66572"
FT                   /protein_id="AAC06521.1"
FT                   /translation="MILPLEELLKVLERERKGKKVVFTNGCFDIIHAGHVDYLEKAKKL
FT                   GDILVVGMNSDSSVRRIKGERRPIIPQEMRAKVLSSLKPVDYVVIFEEDTPEKLIKAIK
FT                   PDVLVKGGDWPLDKIVGREFVESYGGKVLTIPFEYDISTSKIVQKVLELYCGK"
FT   gene            complement(114649..116079)
FT                   /gene="aldH1"
FT                   /locus_tag="aq_186"
FT   CDS_pept        complement(114649..116079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldH1"
FT                   /locus_tag="aq_186"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_186"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06525"
FT                   /db_xref="GOA:O66573"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:O66573"
FT                   /protein_id="AAC06525.1"
FT                   /translation="MIEKKMLIGGEWVDKEEKIEVIYPYTRKPIGRVPKGDEKDVEKAI
FT                   ERAKEGFKEIFSLTAYERYEILMRAAQLLKERAEEFAKTLVLEVGKTIREARTEVQRAI
FT                   QTLIFSAEEAKRVNGETFPIDAHPNGKGKLGFYIRVPVGIVSAITPFNFPLNLSMHKVA
FT                   PALAAGNAVILKPSERTPLTPLMLGEILLEAGVPPKALSVIPGYGDVGKAMTTHPDVRV
FT                   VSFTGSRKVGDIIARQVGIKKLVLELGSNSAIILHKDGNLEKAVEKTVQGGYAIAGQVC
FT                   ISVQRVFVHEDLYDEFIKRLKERVSKLKVGDPMNEDTDLGPMIAPSELERIQEWISEAV
FT                   QKGAKIEAGGLRCAEDETIFSPTIVSLVPEDSKLFKEEAFAPVVAVNPYKDIEEAIRWV
FT                   NSSDYGLQVGVFTNDVKLAWKCIKEIEAGGVLINEGPTFRADHMPYGGVKYSGIGREGP
FT                   KFAIEDYTEIKTVIFDLT"
FT   gene            complement(116090..117442)
FT                   /gene="hslU"
FT                   /locus_tag="aq_192"
FT   CDS_pept        complement(116090..117442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="aq_192"
FT                   /product="chaperone HslU"
FT                   /db_xref="EnsemblGenomes-Gn:aq_192"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06522"
FT                   /db_xref="GOA:O66574"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66574"
FT                   /protein_id="AAC06522.1"
FT                   /translation="MTTKSLSELLEELTPKRVVEELNKYVVGQEEAKKAVAIALRNRWR
FT                   RQKLPENLRNEVIPKNILMIGPTGVGKTEIARRLANLIKAPFVKVEATKYTEIGYVGRD
FT                   VESMVRELVEVSFQMVKQEKMKEVRERARRLAEERLLDYLVPHQFTSFGIRESRDAGKR
FT                   EELRQKLRKGELDDRIVEIEVKEKTVPMVGIAGPPGLEELENQIKEMLSGLIPSKRRRK
FT                   VKVKEALQILEQEEAEKLIDMEEVAREAIYRAENFGIIFIDEIDKIAVKTPGAGPGVSR
FT                   EGVQRDLLPILEGTTVNTKYGPVKTDHILFIGAGAFHMAKPSDLIPELQGRFPIRVELK
FT                   PLTKEDFKRILVEPENALTKQYIELLKTENVYLEFTDDAIEEIARIAEEINTKTENIGA
FT                   RRLHTVMEKLLEDISFNAPEMAGQTIIIDAKFVKAKLENLVKDEELSRYIL"
FT   gene            complement(117420..117884)
FT                   /locus_tag="aq_194"
FT   CDS_pept        complement(117420..117884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_194"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_194"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06532"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66575"
FT                   /protein_id="AAC06532.1"
FT                   /translation="MEFFFFIDVYADRELVDYYIVTFKLDDLSSVELTGSQGKYYIRGI
FT                   RDWEKFKEEAYDITLYELGDEVDRFKDIETALREAYRIAIGEAVRRGAKNIVPAIGFGN
FT                   PPPEVVERVYPEELKFEKFPEDLDAFLDRIVKEVSLETTERSKDDDEIPF"
FT   gene            117938..118960
FT                   /gene="trpD1"
FT                   /locus_tag="aq_196"
FT   CDS_pept        117938..118960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD1"
FT                   /locus_tag="aq_196"
FT                   /product="phosphoribosylanthranilate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_196"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06519"
FT                   /db_xref="GOA:O66576"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66576"
FT                   /protein_id="AAC06519.1"
FT                   /translation="MELVRELLRKIAEFENLTAEEMYNLMKEVAEGRATDAQIGALVMG
FT                   TKMKGETPEEIEGAVKLFREKVVRVPVKDPEELVDVVGTGGDKSSTFNVSTVTGFVLAG
FT                   AGVKVAKHGNRSVSSKSGSADFLEALGAKVELLPEKVARLIEEVGFGFMFAPLFHPAMK
FT                   RVVSPRREVGVRSIFNLIGPLTNPAGVKRYLLGVFSKEYVDKFAKALKNLGVKKAFVVH
FT                   GEGGIDEVSVEGETYVTEVSEEGIRSFTFSPEELGVKRKSLSEVRVNSPEESVKVALSV
FT                   LRGEEGTPRDMVLLNASFGILVSERAGDIKEAFEMAKESIDSGKALEVLEKYVELSNKI
FT                   "
FT   gene            118960..120162
FT                   /locus_tag="aq_197"
FT   CDS_pept        118960..120162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_197"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_197"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06533"
FT                   /db_xref="GOA:O66577"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:O66577"
FT                   /protein_id="AAC06533.1"
FT                   /translation="MKEALILFFLIVSYNYLLYYITAKDLALIPLFPENPEEIILVIAF
FT                   NSALYIGWFFGERRKLVTILGYLFFFQTVLLSLVKKDPYTFVSTAFPVIFTLMLVALFK
FT                   SPFERELERIQKEKEALLEELEKNEEVRQKVEEERERLKKEISLIKLQIEQKERELERA
FT                   KEAQEKLEEVEKKEKEVNKLKEKLRELEKNLKKQKEKEEKLLESNRKLFQLLELLGRKE
FT                   DKRRGSKEVRELRKERKKLVKEVLELQDLLEIYSRENEELKKELEKLKSELEGAKKEIA
FT                   KLLTEKENLSKAVKKKEEIYEEVLRVFLPNVKFTPEALQEFMSLSTQEKRRFLRELEKL
FT                   EEGTKLESLTNVHGVYKLKFGGGRIYVRKEGDRWVVIGILDTEQDKEKERYIESLRDRL
FT                   Y"
FT   gene            120228..121451
FT                   /locus_tag="aq_199"
FT   CDS_pept        120228..121451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_199"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_199"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06549"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR041374"
FT                   /db_xref="UniProtKB/TrEMBL:O66578"
FT                   /protein_id="AAC06549.1"
FT                   /translation="MAELRETLERLASFRPQNYYVSTLYLRLMPEDRQDNKYLRVYKDL
FT                   VKKKEKDLENLNLDKEVLDSIRGDIKNIQDFLSDPKNLYNCRGIAIFSCSKLGLFEYVK
FT                   LPYVYRNRLMFSPDPLVREIAAIDEEFGRVAVLLLDRKHIRYFLMDITGIEEKLDFLEP
FT                   MTTRAHRFHSGGALLKGAEGTFQYRMPARGAAPNVVQHGMGEWRFHMRLREEWHRILKL
FT                   ASDALFEEWKRIHFDKLIIGGFIEEGLREIENFLHPYVKEKLVGYIEITPEEATPHQVW
FT                   EKALDLLWQKDREQEKEIIKELEELKGWGLAVNGTSEVLEMLAIGNVRTLILPEDFEKP
FT                   GYLCPQSHLAFLKPECPLPEEKPIPVSDVVDEALEEALDQRATIEVIIDKELQKKVDGL
FT                   AAFLRFKL"
FT   gene            121448..122074
FT                   /locus_tag="aq_200"
FT   CDS_pept        121448..122074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_200"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06550"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:O66579"
FT                   /protein_id="AAC06550.1"
FT                   /translation="MNERLMIFIDGSNLFHGIRYLNIKVDYSKLVEFLREGRYLVRAYF
FT                   YTAVPQEKDIKKGTPEWDSLQRQKRFLDELSFMGIKVKTAHLRKLPSGEYLEKEVDIML
FT                   ATDMLSLAYRNAYDTAVLVSGDSDFIHTVEAVQSLGKRVENATFKKTSSYNLRKVCDRF
FT                   ILLDDHLDKILMEEKGKEIVPVEEEEKGTEEREGFLERFKKFFGL"
FT   gene            122071..122679
FT                   /locus_tag="aq_202"
FT   CDS_pept        122071..122679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_202"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06551"
FT                   /db_xref="GOA:O66580"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66580"
FT                   /protein_id="AAC06551.1"
FT                   /translation="MKLLVATTNEGKYREIKEILSEYGIEVLKPEEKLEVEETGCTFLE
FT                   NAYLKARAYYERYKIPALADDSGLIVEAISPYPGVYSSRFYDIDFGGREEVRTNKDEAN
FT                   IRKLLRLLENTENRKAKFVAFIVVYGGSWGIFAEGEVRGEITKEPRGDRGFGYDPVFVP
FT                   EGYNKTMAELSPEEKNKISHRGRALRKLVHVLKNCEKAF"
FT   gene            122663..123844
FT                   /gene="atpG2"
FT                   /locus_tag="aq_203"
FT   CDS_pept        122663..123844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG2"
FT                   /locus_tag="aq_203"
FT                   /product="ATP synthase F1 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_203"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06541"
FT                   /db_xref="GOA:O66581"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:O66581"
FT                   /protein_id="AAC06541.1"
FT                   /translation="MKKLSEKLRAYEVLREVFNVIAVISLNRFKKTRHIVSQEYPYFER
FT                   LKEVLEHLFALHPTHPLFKPREEKRVSVVVFTSDLSFTRELCNKIFKSVPEFRETEFII
FT                   FGGKCRKKDLFERLKPKVISNTFTKLVDYSKILKTFEELFERFASKELDAVYVVSALPF
FT                   LERAEGKGKRETGKSIKEEEVKREILYTRGARYVRAVELGESGRIEVYVERFLPPKIKG
FT                   VYRKDLILNFEGNEEEIIRTVLKLYTEFHAKFLSLAHWNALNLQRFRTAKRIQDNLERK
FT                   IKNLKRLISKERQEKINRELQDIALSLLALEEKKFKDIEHKDYVLEIDKNLEESLKKKV
FT                   IEILKEHFPILEVKEVEGLLGFYLRGEGKVYNASTLKQLELFVREIILRVDRS"
FT   gene            complement(123819..124700)
FT                   /locus_tag="aq_204"
FT   CDS_pept        complement(123819..124700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_204"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06552"
FT                   /db_xref="GOA:O66582"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022373"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66582"
FT                   /protein_id="AAC06552.1"
FT                   /translation="MDYKKHYEEEHQEKPRVVEEGIWVAEEALKKAPKLEGVPTGVEGL
FT                   DELFFKSEIREGKVVKVPLGGIPRYSVTNITGVSDTGKSLMVEQYTVKQAERGEPVAFI
FT                   TVESPAPFVTMGLRERATAMGVDFDKIKDKIILIDAASHATLRENIPNLLATLAHVIKT
FT                   YKVKHTIIDSVTGLYEAKEMLARTIVRQLFNFMKKWYQTALFVSQKRSSHEELSAEAAG
FT                   GFAISHIVDCTMVLAKELIMTKYQAQIYKKEIGDIVRLFRIDGCRLCGHDTKTHFMEIT
FT                   ETGLVKIGPPLR"
FT   gene            124821..127829
FT                   /gene="nirB"
FT                   /locus_tag="aq_206"
FT   CDS_pept        124821..127829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="aq_206"
FT                   /product="nitrite reductase (NAD(P)H) large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_206"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06543"
FT                   /db_xref="GOA:O66583"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:O66583"
FT                   /protein_id="AAC06543.1"
FT                   /translation="MKVVIVGNGIAGTALVEEILRLSSGKDIRIQVFGDEKFIGYNRVL
FT                   ITEVLAGRKTLSEIYIKRWQWYEEKGVRLEIGKKVERLFPNKKILVTKDGEFYRYDKAI
FT                   IATGSKPFIPPSIKGVNKKGVFTYRTAKDVFEILDYARVSKRAVVIGGGLLGIEVTKAL
FT                   RDIGLEVFLVHILDTLMEQQLDKTASELLRKDLEDMGIKVLLKKVTEEILGEKKAEGVR
FT                   FSDGDELLADFVIIATGIRPNVEVGVNSGLKVNKGIVVNDYLETSASDIYAVGECIEHR
FT                   GKTYGLVAPIMEQVKVCAHNVVHGNEKKYTGSLTYAMLKVAGVNLFSAGEINEKDGDEV
FT                   VAFLDNGRSLYRKAVIRNNKIVGTILYGDVRGNNYLLDLIKSGKDISEERPYFLIKHIL
FT                   PKGTTGVEELKDNDIVCNCNAVTKGEIVKCIKEGCKTLEEIQERTKASTSCGSCIELVE
FT                   EILKHYVKEKPKRVNKIEVIKKELHPFDLEFKKRLEKYFSEGELENIPEEDRDVRLKWY
FT                   GIFYRKATPGYFMVRIRVPNGRLSYEQAKVVSHISEKFCRGEVEITSRQQLQIRWIKLK
FT                   DLPEILEALNRVGLSTLQTGMDNVRNVTGDPLTGLAEDSLIDTLRLSQEITNIFLGKKK
FT                   YADLPRKLNVAVLGSQTDCINALFNDVCFYLSEKDGKLGFNLYLGGKIGSGGPKKAIDM
FT                   DMFVEPYEVPEVFKATLDIYSTFGNRENRSKNRLYFLLQEWGVERFREELEKRLYKAIP
FT                   SKGKDLVNKTGEREGIINLRNGTYAVCVVVPAGKIKAKDFRQIAELARKYGSRELRLSV
FT                   YQNIYIPNIPEENLNPLLGEEIFEKFSTVSSPFTMHLIACAGSDTCSFGVIPNKSDAVR
FT                   VAKYLSERLKLDIPVRMHWSACAKGCGQHGSGDIGFVGTKTKLNGKAVLAVDVFVGGSP
FT                   TKEGFKVIQGLPLDKVEEASYLLLNYYLENRLEGESFADFAHRVGVDKLKVVLTSLLQE
FT                   GECKLLKPESISK"
FT   gene            127845..128579
FT                   /gene="cobA"
FT                   /locus_tag="aq_207"
FT   CDS_pept        127845..128579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA"
FT                   /locus_tag="aq_207"
FT                   /product="uroporphyrin-III c-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_207"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06540"
FT                   /db_xref="GOA:O66584"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:O66584"
FT                   /protein_id="AAC06540.1"
FT                   /translation="MGKVYLIGAGPGDPELLTLKAYRILRKADVVLYDALVNREILHFA
FT                   RQDSLKIYVGKRDGKHSLPQEEINELLHRFALSYKIVVRLKGGDPFVFGRGGEELLYLK
FT                   SRGVEVEIVPGITSAISAPSSAFIPVTHRGIASSFAVVTGHPNREIKWEDLVNIDTLVV
FT                   LMGVKNREKIARELIGAGRNPDEPVAFIEKATTPEQREVFSTLKEVAQNPPEVNPPAVM
FT                   VVGKVVEIGAKVLCERIIGVTL"
FT   gene            128584..129513
FT                   /gene="trpD2"
FT                   /locus_tag="aq_209"
FT   CDS_pept        128584..129513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD2"
FT                   /locus_tag="aq_209"
FT                   /product="phosphoribosylanthranilate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_209"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06539"
FT                   /db_xref="GOA:O66585"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66585"
FT                   /protein_id="AAC06539.1"
FT                   /translation="MDILERTFKKLTRLKDNLQDLSQEEAYEVFRAILEGKLSDIKTTA
FT                   FLTAMRIKGETSEELLGVIKAIKERMNFPQKKEDALDLGLNYDGKNRTIYILPSALWLC
FT                   SRLGVEFTNHYALGAPTKEGVTLYEVVKELGVDMNVSFVDQKNYAPELYKLMPLRRELG
FT                   FRSLINTVEKFLNPFQTKKIVVSIFHKPYFDKNAELLELLGIEDYTIIKGLEGGIEPLP
FT                   DRPTLVKKRGKDIESIEPKSLGLEMPKDVHSENVLRDSLEINRKIIDGRERGEFFNWAL
FT                   YTAGVLLYAAGECESVEEGVGRVEKEST"
FT   gene            129647..130066
FT                   /gene="fhp"
FT                   /locus_tag="aq_211"
FT   CDS_pept        129647..130066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhp"
FT                   /locus_tag="aq_211"
FT                   /product="flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_211"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06544"
FT                   /db_xref="GOA:O66586"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66586"
FT                   /protein_id="AAC06544.1"
FT                   /translation="MLSEETIRVIKSTVPLLKEHGTEITARMYELLFSKYPKTKELFAG
FT                   ASEEQPKKLANAIIAYATYIDRLEELDNAISTIARSHVRRNVKPEHYPLVKECLLQAIE
FT                   EVLNPGEEVLKAWEEAYDFLAKTLITLEKKLYSQP"
FT   gene            130079..130528
FT                   /gene="cynS"
FT                   /locus_tag="aq_212"
FT   CDS_pept        130079..130528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="aq_212"
FT                   /product="cyanate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_212"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06548"
FT                   /db_xref="GOA:O66587"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66587"
FT                   /protein_id="AAC06548.1"
FT                   /translation="MRSDIGRLSKYLIERKKNLGLTWEDVSRKLGKSPVYCAMLFYGYA
FT                   QADDEEVKAVAELLNLEEKELAELKDAPYREPQQPVPPTDPFVYRLYEVVILYGPALKD
FT                   VAHEMFGDGIMSAIDMSVELEKVEQEGAERMVLTFNGKWLKYRKF"
FT   gene            130544..131161
FT                   /gene="glnBi"
FT                   /locus_tag="aq_213"
FT   CDS_pept        130544..131161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnBi"
FT                   /locus_tag="aq_213"
FT                   /product="PII-like protein GlnBi"
FT                   /db_xref="EnsemblGenomes-Gn:aq_213"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06545"
FT                   /db_xref="GOA:O66588"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:O66588"
FT                   /protein_id="AAC06545.1"
FT                   /translation="MEELLAIVRKEKSYDVMKSLSEAEIPYVSWTVKGRGKEGGLRYKG
FT                   LIKEKVLMPFLPKRAFLVFPEEGKVNEAVNLIVESAHTGAYGDGKVFLINQEVGVMKLV
FT                   KAVIRPEKVYEVIKALESEGFKAMTMWDVVGRGKEGGILVGGTPYDELAKTLIMVAVKD
FT                   EDVDKVIQSITKAAHTGAYGDGKVFVCSISKVWTIRTKEEEL"
FT   gene            131158..132585
FT                   /gene="nasA"
FT                   /locus_tag="aq_215"
FT   CDS_pept        131158..132585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasA"
FT                   /locus_tag="aq_215"
FT                   /product="nitrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:aq_215"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06547"
FT                   /db_xref="GOA:O66589"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:O66589"
FT                   /protein_id="AAC06547.1"
FT                   /translation="MNFLKEIIEAIKKGNPKALFASFIYFDHSFSIWLLLGALGPFIAE
FT                   SFGLSGAQKGFMVAIPVIAAAIFRLNFGHMFQYIDGKYIAIMGIILSSIPHLYMILSGY
FT                   RVTYDDLLWMGVFLGIAGASFAIALPMAGSNYPKEVQGLVLGLAAAGNIGAVLDGILFP
FT                   PIARSIGWENTFVLSGILLLIALFFVVIWARDLTKKNEGNRFYPVFAFFATIAFMVILA
FT                   LGFQKGWFGITGNAGKLLIPVLGSVFAILLMPLAFKKVFLERDTWVLMLAYSITFGGFV
FT                   GMSSYVAMLLRDIYGISKVEAGALMSLFAFTGAMIRPLGGHIADKISGATALLFFLAGI
FT                   AGVNFIFSLVTPPLAVGIVLFLALYSFYGLGNGAVFQLVPHRWPYQTGLMTGIIGAAGG
FT                   IGGFYLPVVNGIVFESTGAYNLAFALFGGIALLCLLIVKLLHARWMEWAYVRYDYEKET
FT                   LVGIDPKSGRVIMELAR"
FT   gene            132582..134582
FT                   /gene="narB"
FT                   /locus_tag="aq_217"
FT   CDS_pept        132582..134582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narB"
FT                   /locus_tag="aq_217"
FT                   /product="nitrate reductase narB"
FT                   /db_xref="EnsemblGenomes-Gn:aq_217"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06542"
FT                   /db_xref="GOA:O66590"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:O66590"
FT                   /protein_id="AAC06542.1"
FT                   /translation="MKRFQCPYCGVGCGLYINEKGKVKGDFEHPANLGDICKKPLYLPK
FT                   VLNRGRIAKPMYRENKSHSFREISWEEAYEILKEKLISFSPDETYFYLSGQLLTEDIYV
FT                   ANKFVKGFLRTNNVDANSRLCMASAVTAYKLAFGSDGVPCTYEDVDDADAFLFIGSNAA
FT                   VAHPVLFKRVLKRRKEEEKVIIVTVDPLETETAKRSDVFIQIKAGTDTVFLNSVLYVLH
FT                   KEGWIDYRFIYNYTEGFEEALEVAMKFPPDVAASICSVKPEDVYLVAELFAHSKKLISF
FT                   WCQGLNQSLNGTMKNLALINLHLATGRLNEKGCPFSLTGQPNAMGGREVGYLTNGLPGY
FT                   RDVRNKADRAFMEKFWGVKGIKKEPGPTITEAIDMILKDRIKFLWVVCTNPAVSLPNLE
FT                   KVKRALEKVFLVVQDAYWNDTCEFANLILPAAQLGEKEGVMTGSDRTVTFCERFSEPFG
FT                   ESKPDWLIFTELARKMGAEELFPYSSPKEIFEEFKASTKGRLCDMSNLSYENLPARWGK
FT                   RWLYEDLKFPTESGKARFHPARVDVAAEEGMFILLTGRLKNNWHTMTRTGKSPELLKGE
FT                   IPPFVIMNPRDAEELGIEEGEEVILSAKGKEITRVVRFGNVKRGHIFAPFGYPSEYGEP
FT                   TNLLTSDRTDPYSKEPDLKYSGVDVFVKVNR"
FT   gene            complement(134585..136105)
FT                   /gene="nifA"
FT                   /locus_tag="aq_218"
FT   CDS_pept        complement(134585..136105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifA"
FT                   /locus_tag="aq_218"
FT                   /product="transcriptional regulator (NifA family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_218"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06546"
FT                   /db_xref="GOA:O66591"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="PDB:4G3K"
FT                   /db_xref="PDB:4G3W"
FT                   /db_xref="UniProtKB/TrEMBL:O66591"
FT                   /protein_id="AAC06546.1"
FT                   /translation="MDLKVEIETLYEVSKILSSSLNLETTVPYIFRLLKKLMGFERLTL
FT                   TIYDPSTDQIVVRATSSGKFPKEGFKKGEGITGKVWKHGVPIVIPDISQEPEFLNKVWK
FT                   RKKSKKKIAFIAVPIKSGGKVIGVLSADKEINEKDSLDEYTRFLSMIATLIANSFSLER
FT                   KVQAERKSLEEEKRALETELKRVYEKLHVEGIVGRSKEILNVLEIVHRVAPTNATVLLR
FT                   GESGVGKEVFARAIHFLSPRADKPFVAINCGAIPGELLEAELFGYEKGAFTGAYSTKKG
FT                   KFELANGGTLFLDEIGELPLHLQVKLLRAIQEKEIERIGGTRPIKVDVRIIAATNRDLE
FT                   SMVREGKFREDLYYRLNVVPIFIPPLRERKEDIPVLVHYFLEKFSKEYNKEVSITQEVM
FT                   DAFMKYEWKGNVRELQNVLERMVILDTDGVLSEEDLPPEIRDVKKESRIYNQTLNGETI
FT                   WDLEKQLIEKALEESGFVIKEAAKKLGMTPRQVSYRIQKYGIKLPKKR"
FT   gene            complement(136122..136574)
FT                   /gene="dut"
FT                   /locus_tag="aq_220"
FT   CDS_pept        complement(136122..136574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="aq_220"
FT                   /product="deoxyuridine 5'triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_220"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06559"
FT                   /db_xref="GOA:O66592"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66592"
FT                   /protein_id="AAC06559.1"
FT                   /translation="MSKVILKIKRLPHAQDLPLPSYATPHSSGLDLRAAIEKPLKIKPF
FT                   ERVLIPTGLILEIPEGYEGQVRPRSGLAWKKGLTVLNAPGTIDADYRGEVKVILVNLGN
FT                   EEVVIERGERIAQLVIAPVQRVEVVEVEEVSQTQRGEGGFGSTGTK"
FT   gene            complement(136567..138894)
FT                   /gene="phpA"
FT                   /locus_tag="aq_221"
FT   CDS_pept        complement(136567..138894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phpA"
FT                   /locus_tag="aq_221"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_221"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06562"
FT                   /db_xref="GOA:O66593"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66593"
FT                   /protein_id="AAC06562.1"
FT                   /translation="MSVEEKARIGNSEEPIIIETGKYAKLTDGSVVVRQGGTAVLVTAV
FT                   MSDEPITDVDFTPLAVDYRERASAYGRIPGGFTKREGKPTDREILVSRVIDRPIRPLFP
FT                   EGFFHDVIITALTLSADDKYDPDVLAITGASAALHISRIPFEGPIAGVRVCRVNGEFVA
FT                   NPTYEQRKEADLDIVMAGTKDAIVMVEGGGKEIPEEVLADALFFGLDAIKEVIEAQERL
FT                   REKVGKPKFEYQKVELPEDILKALEEECTPKILEAFNIKDKKERYSTLDKIVEEFIEAH
FT                   QIPEELHFAVKYFYKKLESRLMREKVLKEGVRIDGRKPNEIRPIWIEVHPFERPHGNAI
FT                   FTRGQTQAYVTVTLGTPDEALIIETIAEGEVFKRFMLHYSMPPFSVGEAKPWGPPRRRE
FT                   IGHGALAERAIEPLLPPEEEYPFIIRVVSDILESNGSTSMATVCGASLALFDAGVPMKD
FT                   NKHVAGIAMGLILEKDRYVILSDILGDEDHLGDMDFKVAGTKDGITSVQMDIKVKGITK
FT                   EIMLDALKQAREGRLYILEKMYEAIPEPRKEPHPYTPKVEVVDVPEEKAPLIIGPGGST
FT                   VKKIYDETGVKVWVGEQGKVYLFVFPGGDVEKAKQMIQDIVREVEVGAVYKGTITRVEP
FT                   YGVFVELWPGKIGLLHVSKMAEPVRSATEKYKVGEEIIVKVLDLDELGRPRFTTIGIED
FT                   VGTEKKEVKPKVGDVYEGKVVRVEPYGAFIEYAPGKVGLLHVSKMKERVKDARQKYKVG
FT                   DVVKVKVVEIDEQGRPKFTDDV"
FT   gene            complement(138897..139169)
FT                   /gene="rpsO"
FT                   /locus_tag="aq_226a"
FT   CDS_pept        complement(138897..139169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="aq_226a"
FT                   /product="ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:aq_226a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06563"
FT                   /db_xref="GOA:O66594"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66594"
FT                   /protein_id="AAC06563.1"
FT                   /translation="MVLPKDVKWDLIRQFQRHEQDTGSPEVQIAILTERINRLTEHMKK
FT                   HKKDIHSRRGLIAMVNKRRKLLEYLRETDYAKYLEVVQKLNLKVK"
FT   gene            complement(139228..141390)
FT                   /gene="aldH2"
FT                   /locus_tag="aq_227"
FT   CDS_pept        complement(139228..141390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldH2"
FT                   /locus_tag="aq_227"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_227"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06554"
FT                   /db_xref="GOA:O66595"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:O66595"
FT                   /protein_id="AAC06554.1"
FT                   /translation="MQVRDLPEDCKGCSEGCPDDEGGKSMISRRDFIKGGLALAVVLTS
FT                   DGYRLLKADEVLPNYAPELWIKLSEDNYLTVLVNKSEMGQGVYTGLPQILADELDFPWE
FT                   RVKVEPAPAGKKYVDPKWGVQLTGGSTSVRHMYDFLRFVGASMKEMLLSAASKELGVEK
FT                   KYLRAKQGFIENLKTGEKYPYGAFAEKAFRERIPTNPRLKTKEEFIYIGKSVPRIDVPE
FT                   KVNGRAKFGIDTFMEGMVYAVVERAPFGAKLKGYKGEVNNVKLVPISTGLAICGESLED
FT                   CLEAREKIQVEWEESPIDGWDDEKFKEYYLKKLQEKGIVARKDGKPEEVLKNSKKKIEE
FT                   TYVLPYLYHATMEPMNCTVHVKEDECLIFAPTQAQTATLNVAKEITGLPEEKIKVITTY
FT                   LGGGFGRKANVEFIREALEVSKAIKRPVKLIYTREDDVKSGWYRPMNATKMAGSVDENG
FT                   KVNALFFKIAVPSVFEWAGRKVIIDPAAVEGVHNMFYEIPNVHVEWVKVDLPVPVFFWR
FT                   SVGSTHNAFTLETFIDRLAKLANRDPVEMRLELLETNPRAQRVVEYTAEKAGWGKEPKY
FT                   GKAMGFAYHYSFGSHVAQVAEVSYEEDKIKVHKVVCTIDIGPVTVNPELIRAQMESAII
FT                   MGLSAFLKEGVRFRDGKPVNDNFDTYPILRMDEAPEEIEVHILNSDAHMGGVGEPGLPP
FT                   IAPAVANALFWGYGIKVNELPFYKTT"
FT   gene            141804..143150
FT                   /gene="ntrC3"
FT                   /locus_tag="aq_230"
FT   CDS_pept        141804..143150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC3"
FT                   /locus_tag="aq_230"
FT                   /product="transcriptional regulator (NtrC family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_230"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06561"
FT                   /db_xref="GOA:O66596"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66596"
FT                   /protein_id="AAC06561.1"
FT                   /translation="MILLVEDDDNLRELLKKKLEEHFVVETAKDGKTAREKLSKNNYDV
FT                   VLLDIRLPDVDGTELLKEFSTSGVKFIVITGYGDVKTAVQCVKLGAYDFIQKPFNFELL
FT                   EVTIRRALKEKRLEEENRTLKSFLFKEKEEDYLLETRSPKFREVLEIARRIANTDLPVL
FT                   IRGETGVGKEVLAKYIHTISNRKDKPFVVVDCTSIPEHLFESELFGYEKGAFTGANTRK
FT                   LGLVELANGGTLFFDEIGEMPLSIQAKLLRFIETRKFRRVGGLKDLEVDVKIICATNKD
FT                   LYEKSKRGEFREDLYFRINTVEIEIPPLRERKEDIPLLVEFFLKKYGKKIKKETLNELI
FT                   NYPWEGNVRELKNVIERACILSTGEYIDEAICLSKKSVSCVEKMMEKLPSLEELEGMYL
FT                   KFLYEKLEGDVDKIAVILGCSRRTVFRKLKKLREGKVHFKNASLSGGTP"
FT   gene            complement(143094..144113)
FT                   /gene="hksP4"
FT                   /locus_tag="aq_231"
FT   CDS_pept        complement(143094..144113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hksP4"
FT                   /locus_tag="aq_231"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_231"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06560"
FT                   /db_xref="GOA:O66597"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:O66597"
FT                   /protein_id="AAC06560.1"
FT                   /translation="MGEFEVFEKFKEQVVVIDKDYKIVYANESYVKENGYRSKEEVVGK
FT                   PCYLVSHKRDEPCDGECHPCPLKEIQKRKGAVSVVHTHYTHDNKEVHVEICAFPIEEGR
FT                   KIIQFIKNIKNDKEKFYLFSLSQKLSSVGYLALGVAHQLNTPLATISLALEELEKKCGS
FT                   CEEIEVIKNALISCKNTVDKLLLFARKDNNKDLVDTKKAVEDVLELLRVYAKERGVIIE
FT                   KELESVYMFGNETDIRHVVLNLVLNAIQASDRGKKVRVFLKKEGEELILIVEDEGKGIP
FT                   PEEVDKIFLPFYHGKDKREGSGLGLAIVNDIVKSYGGKINLRSAPGKGSIFEVHLPLS"
FT   gene            144275..145585
FT                   /gene="dhsU"
FT                   /locus_tag="aq_232"
FT   CDS_pept        144275..145585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhsU"
FT                   /locus_tag="aq_232"
FT                   /product="flavocytochrome C sulfide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_232"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06555"
FT                   /db_xref="GOA:O66598"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015323"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66598"
FT                   /protein_id="AAC06555.1"
FT                   /translation="MGVNRRDVFKLAGLGVALGALQLPSIACAAKTSNSLLSPSKGKRI
FT                   VIVGGGWAGVTAAKYIRKEIPDAEVVLIEQRKMFMSCPISNVWLGGLVDLEFLIHDFLT
FT                   PAAKYGYTFINATVTDIDRDKRRVYTEDGYVEYDYLILAPGIRYNYDAWFNGDKDMARY
FT                   AQTHYPSAFIPGSEHLRLKKKVENFEEGTFVLVVPPPPHRCPPAPYERAAMIAHVFRQN
FT                   EAKAKLIILDPKEKIAPKGPGFRMAYEQLYLDIIEYVPNAKIKEVDPVKKVIKTTAGDF
FT                   KFDDANLNPPHQAADIAWKAGLVNPKTGWCDVDPITLQSKVDKRIFIPGDANSVKGFPK
FT                   SGDMANNQTKFMLVKAIKAMIEGKDPLEYVKAPTNTCYSMVNGDPKEAIVINVVYDIDK
FT                   QKRMPVKKKVNVENERSQRLARATFEWAKAMYRDMFS"
FT   gene            145595..146311
FT                   /gene="soxF"
FT                   /locus_tag="aq_234"
FT   CDS_pept        145595..146311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxF"
FT                   /locus_tag="aq_234"
FT                   /product="Rieske-I iron sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_234"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06557"
FT                   /db_xref="GOA:O66599"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:O66599"
FT                   /protein_id="AAC06557.1"
FT                   /translation="MDRRTFVKACGSVATLSLISSSFFTQTLRAQTNEFKKYKKAILLN
FT                   KDGNPIKPEEIEVGKQYLFFYPYRSTPAFLLNLGKEVKPVEVKLLDGSSYLWPGGVGPQ
FT                   KSIIAFCAICPHQLSYPTPDYSFINYYPPDKPSKAAKKGNVIQCCAHMSIFDPEKGGVV
FT                   LDGPAEYPLLTIVLSYEDGKLYAVGTLGVEKFSDFFDAYRSELKKMYKSFRKAKKKVDK
FT                   SVVMRVEEYVNEVIYC"
FT   gene            146292..147545
FT                   /gene="fccB'"
FT                   /locus_tag="aq_235"
FT   CDS_pept        146292..147545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fccB'"
FT                   /locus_tag="aq_235"
FT                   /product="sulfide dehydrogenase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_235"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06556"
FT                   /db_xref="GOA:O66600"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66600"
FT                   /protein_id="AAC06556.1"
FT                   /translation="MKSFTVDRRNLLLAGGIGLLGVYVSKSLVFGETKGNRVVVLGGGY
FT                   GGVTTAKYVKKLYPDAEVVLVEKNPMFVSCPLSNLYLVGLVPYEQLCYPYNNLVTKYGV
FT                   NFVNDEVIGIELDKREVILGNGRLKYDYLVISLGIEYDYEENPALKEVYWSYPPAFRQG
FT                   SEHLYLKRMLEGFEGESILISVPKMPYRCPSAPYERAALILSYAKKEGLKVHLYFVDEN
FT                   ERPPVLTKGFLKAYQDFYKDDATYLTSTKVLEVDPVKKVARTTKGDIKFSMANFIPPMR
FT                   APKLLEKAGLLKKGEKWVKVDPMTFETSVKNVFVIGDSAFTYLPKSGYAAHSQGKVVAK
FT                   VIASRLRKKPWEGELIQQAVCYAMVNLKQAIMMNVEYKYNLKTKEIKKEIYEDDTWKVS
FT                   TAKRYIEWARGLWRDMFT"
FT   gene            complement(147546..149078)
FT                   /gene="guaA"
FT                   /locus_tag="aq_236"
FT   CDS_pept        complement(147546..149078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="aq_236"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_236"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06558"
FT                   /db_xref="GOA:O66601"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66601"
FT                   /protein_id="AAC06558.1"
FT                   /translation="MQRRPILVVNFGSQYVQLIARRVRELGVYSEIVHWDTPVEEIKKK
FT                   NPYGIIFSGGPASVYAEGAPLPDKRIYELGVPILGICYGLQVITHQLGGKVVRSEKQEY
FT                   GRARLRIIKEDVIFEGIPKESDVWMSHADKVVELPEGFEVLAVSENSPYAVIANREKKI
FT                   YGFQFHPEVTHTVFGKEMLANFIYGVCKAEKNWEMGDFIHEKIEEIRKTVGDAKVIAAL
FT                   SGGVDSTVAAVLTHRAIGDKLHCFFIDHGLLRYKEREEVEKNLRSLGLPLTVVDASEEF
FT                   LEKLKGVEDPEEKRKIIGRTFIEVFEREAKKIEGAEFLLQGTLYPDVVESAGIKGSAKI
FT                   KTHHNVGGLPERMNLKLLEPFRELFKDEVRKIGKLLGVPEEILRRHPFPGPGLAIRIIG
FT                   EVNKKDLEILRKADYIFIQELKKEGLYDRVWQAFAVLLPVKSVGVMGDVRTYEKVVALR
FT                   AVESVDGMTADWARLPYDFLDRVMRRIINEVEGVNRVVYDISSKPPSTIEWE"
FT   gene            149124..149639
FT                   /gene="sodC2"
FT                   /locus_tag="aq_238"
FT   CDS_pept        149124..149639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC2"
FT                   /locus_tag="aq_238"
FT                   /product="superoxide dismutase (Cu/Zn)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_238"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06553"
FT                   /db_xref="GOA:O66602"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66602"
FT                   /protein_id="AAC06553.1"
FT                   /translation="MKKLSGVLAGSLLLISASFSQDLKAHAELINTEGEVIGKAELIET
FT                   NSGVLIKLNAKGLPPNAELAFHIHERGECKPPTFKSAKGHFNPYGKKHGLLNPEGPHAG
FT                   DMPNIYTDDKGNVRVQVLNPFVTLKKGEKNSLFKEGGTALVIHSGPDDYKSDPAGNAGK
FT                   RIACGVIR"
FT   gene            149720..150274
FT                   /gene="folE"
FT                   /locus_tag="aq_239"
FT   CDS_pept        149720..150274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="aq_239"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:aq_239"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06566"
FT                   /db_xref="GOA:O66603"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66603"
FT                   /protein_id="AAC06566.1"
FT                   /translation="MAIDKEKIKQAVRLFLEGIGEDPDREGLKETPERVARMWEEFERM
FT                   RNFDMKLFEEFGGYNEMVLVKDIKFYSLCEHHLLPFFGKVHIAYIPDKKISGLSKLVRT
FT                   VRAFALRPQVQERLTEEIADFLEKELEPKGVGVVIEAEHLCMSMRGVMSPGHLTVTSAL
FT                   RGVFLKDIKTREEFLKLVKGV"
FT   gene            complement(150271..151173)
FT                   /locus_tag="aq_240"
FT   CDS_pept        complement(150271..151173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_240"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06575"
FT                   /db_xref="GOA:O66604"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:O66604"
FT                   /protein_id="AAC06575.1"
FT                   /translation="MDINLIISEVSKVIKGKEEVIKNSLVCLLSGGHLLIEDVPGTGKT
FT                   TLALALARVLGLSFSRIQFTSDLLPSDITGVSVFNQKTREFEFKKGPIFSNVVLADEIN
FT                   RGTPKVQSALLEAMAEKQVSVDGNTYKLPEPFFVIATQNPIEYYGTYPLPEAQLDRFTM
FT                   KISMGYPSEEDEVQIVQGINPMEKVSSLNVLSSPEEVIRTVNEVKEIYVSPEVARFIVN
FT                   IGNEVRNHPSVILGVSTRGLIHLANASRALAYFRERDFVVPEDVLDLLKYVIPHRIKVR
FT                   EGVKAEAVLKEVISRVPIP"
FT   gene            151206..153593
FT                   /gene="lon"
FT                   /locus_tag="aq_242"
FT   CDS_pept        151206..153593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="aq_242"
FT                   /product="Lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:aq_242"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06568"
FT                   /db_xref="GOA:O66605"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66605"
FT                   /protein_id="AAC06568.1"
FT                   /translation="MNELFQTPQVEAGIKEYPLMPLRDIVIFPTMVQPLFVGRRFSIRA
FT                   IEEANKKDKLIFLVLQKDKDVEEPKEEDIYKVGVVAYILRTVPIEDARVKVLVQGLKRG
FT                   VIKKLEWKEDHYVAQVDVIEERDIPPESQTIEDKALIKAVKESIDKLVSLGKQIIPDLV
FT                   VLIKELEEPGKLADMVASILDIKSSQAQEILETFDPRERLKKVYKFLQDEIGLLEVKQR
FT                   ISEIARERMEKEQREYYLRQQLKAIQEELGEAGGIKAEIEEYTKKFEEVKECMPEEGVK
FT                   EVEKNIKRLERLHPESAEAGVIRTWLDWVLDLPWCTRTEDNYDLERAREILDRDHYDLE
FT                   KVKDRIIEYLAIRKLTQGKEAPTQILAFVGPPGVGKTSLGRSIAEALGRKFVRIALGGI
FT                   RDEAEIRGHRRTYVGAMPGRIIQAIKQAGTKNPVIMLDEIDKLAISFQGDPAAALLEVL
FT                   DPEQNKKFTDLYIGIPFDLSEVIFICTGNRADTIPTPLLDRMELIMLSGYSEEEKLFIA
FT                   KKHLIPKLIPLHGFSPEEIEFTDEAILEIIRGYTREAGVRNLQRQISAVLRKIAVKKLQ
FT                   GEKGPFNITPELVRKLLGVPRYRPEREKKPLVGVATGLAWTEVGGEIMFIEATKMKGKG
FT                   SLVLTGSLGDIMKESAQAALSYIRSKAEDYGIDPDIFSQVDVHVHVPEGAVPKDGPSAG
FT                   VAIATALLSLFTDIPVRMDVAMTGEITLRGRVLPVGGLKEKILAAKRAEIYEVILPAKN
FT                   KDEVMEELPEYVREKMTLHFVDNLEEVFKIALVREPKPLKEA"
FT   gene            complement(153580..155067)
FT                   /locus_tag="aq_243"
FT   CDS_pept        complement(153580..155067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_243"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_243"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06570"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66606"
FT                   /protein_id="AAC06570.1"
FT                   /translation="MRTLSLLILFLSTFLFAQVPKELLEFFQRSGYVVEKEGEKVLIDL
FT                   PRGKAFPGEIFEVFQSKKPIIHPVTKKVLGYKEEKVGEVEVIKPRENFSEAKTLENNGI
FT                   KPGDRVKLKIGSVCYIGGDEGYYALSQVVQNVKRNSENCDYVVKELENGYGVSYKGKPL
FT                   AFFQYSGVGFAKRGGVFEDFALKAKFVRSLESLPLSADICKLFGKKDYLVVLFSDKVKV
FT                   YEVLKTDFVEVLSYAIPTGYPVGVVCYENKGRSAVLVNMISNGEASSAVLSPVGNSLML
FT                   TDKNVPYLFGFFYQNGKKVLIGQEFKGSWGKVYRFELRGDKLVRKDALNLPEDFRVDGA
FT                   NAWNNVLVFVDNDGQLRVYVNDEEVLTEDGFGLSYTTAEVPGVYEYAEGDKYGFYVRPN
FT                   FTKVYKDVLPLIAKNRASNIFQLVGFTKFTEGELWTVVRKKEKVYEAIKLKGRKFEEAI
FT                   QAIVRDSEGRIFVITGSKGTIPIQNRGEVYLIEITPL"
FT   gene            complement(155054..156148)
FT                   /gene="leuB"
FT                   /locus_tag="aq_244"
FT   CDS_pept        complement(155054..156148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="aq_244"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_244"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06564"
FT                   /db_xref="GOA:O66607"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66607"
FT                   /protein_id="AAC06564.1"
FT                   /translation="MKKYKIAVLKGDGIGPEIVEQALRVLDKIGEIYGVEFEYREGLIG
FT                   GEAIDKTGDPLPEETLKICKESDAILLGAVGGPKWDNLPTDKRPEKGLLRIRKELDLYA
FT                   NLRPAKVWDALISSSPLKEEVVKGTDMIVIRELTSGIYYGEPRGIFEENGKRYAINTMK
FT                   YTEDEIRRIVRKGFEIARKRRKKLTSVDKANVLEVSALWRQIVEEEKENYPDVELEHLY
FT                   IDNCAMQLVRRPTSFDVIVTGNIFGDILSDEAGVVVGSLGMLPSASIGDRYALYEPVHG
FT                   SAPDIAGKGIANPIATILSAAMMLKYSFNMDKAHDLIEKAIEETLNQGYRTPDIYSEGC
FT                   IKVGTKEITDKILENLERLKDAYT"
FT   gene            156794..157891
FT                   /gene="purK"
FT                   /locus_tag="aq_245"
FT   CDS_pept        156794..157891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="aq_245"
FT                   /product="phosphoribosyl aminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_245"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06567"
FT                   /db_xref="GOA:O66608"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="PDB:2Z04"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66608"
FT                   /protein_id="AAC06567.1"
FT                   /translation="MLTVGILGGGQLGWMTILEGRKLGFKFHVLEDKENAPACRVADRC
FT                   FRTGQISEFVDSCDIITYEFEHIKDEVLEKCESKLIPNPQALYVKKSRIREKLFLKKHG
FT                   FPVPEFLVIKRDEIIDALKSFKLPVVIKAEKLGYDGKGQYRIKKLEDANQVVKNHDKEE
FT                   SFIIEEFVKFEAEISCIGVRDREGKTYFYPQPFNKHEEGILIYNYVPYAKLKEAEEITK
FT                   RLMELLDIVGVFTVEFFLLKDGRVLINEFAPRVHNTGHWTLDGAYTSQFENLLRAITEM
FT                   PLGSTELKLPSGMVNILGKSYEEIPLKEILSVEGAKLYWYGKEKKPRRKVGHVNVVGRS
FT                   KEEVVEKVERVFTLLKGSREKLPAP"
FT   gene            complement(157857..158696)
FT                   /locus_tag="aq_246"
FT   CDS_pept        complement(157857..158696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_246"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_246"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06571"
FT                   /db_xref="GOA:O66609"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:O66609"
FT                   /protein_id="AAC06571.1"
FT                   /translation="MEYNHLLGITFSLFSAFFWATNDIFNKKLILKGYEENFVLWIRFP
FT                   LGALLLLPFGLVYWDLNETVIKTTFLWLPSEILASIFFIKSLKYAPLSLAMPFYATMPA
FT                   FSALAGWIVLGEVLSLRNWLGILLIVYGTTLLAGKNIKSFFTLNKGVLYALFSSFLFGV
FT                   NVVIGKIAVVSSNQFFFSWYYCLVMSLALIPFVKRFEVKDFSSDWKFFGIVGLFFSLGM
FT                   VFYTWAYIYTYASFVAATERLAILLDVLYGKVFFGEKVKNAFKASIIMVLGVFLLSL"
FT   gene            complement(158696..160132)
FT                   /gene="gatA"
FT                   /locus_tag="aq_247"
FT   CDS_pept        complement(158696..160132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="aq_247"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:aq_247"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06569"
FT                   /db_xref="GOA:O66610"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="PDB:3H0L"
FT                   /db_xref="PDB:3H0M"
FT                   /db_xref="PDB:3H0R"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66610"
FT                   /protein_id="AAC06569.1"
FT                   /translation="MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITP
FT                   LYGKALKQAESLKERELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERL
FT                   KKAGALIVGKTNLDEFAMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVS
FT                   LGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEV
FT                   ISGWDEKDSTSAKVPVPEWSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELE
FT                   KEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTR
FT                   DEGFGPEVKRRIMLGTFALSAGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPT
FT                   LPFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTL
FT                   LQISYLWEQKFKHYEKIPLT"
FT   gene            complement(160145..160582)
FT                   /locus_tag="aq_250"
FT   CDS_pept        complement(160145..160582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_250"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_250"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06572"
FT                   /db_xref="GOA:O66611"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66611"
FT                   /protein_id="AAC06572.1"
FT                   /translation="MNKELLEKCKQKLLEEKAKILERYLEKEETQQRLGEESKEPRDWE
FT                   DIGQMTYTEELLDNLSNVEIATLREIDYALEKIEKGTYGICERCGEEIPEPRLCAIPWT
FT                   RYCAKCAEEVERESGTYMPSYGVDMYNPENIQVEREDIGEA"
FT   gene            complement(160629..161309)
FT                   /locus_tag="aq_251"
FT   CDS_pept        complement(160629..161309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_251"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06576"
FT                   /db_xref="GOA:O66612"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012092"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66612"
FT                   /protein_id="AAC06576.1"
FT                   /translation="MDAIQEVKRIIPEVQKYVNQRMEEFERLGREGWTHFDFRPFLDID
FT                   YDAGLFSELSFCILTANSSATLGIKIQAHLGEEGFLNKTKEELEEVFRKFGHRYAGQRA
FT                   ERIVEAREKFPKVKSLIEKEKNSKVIRELLADPKSPYKIKGFGYKEASHFLRNIGFKDL
FT                   AIIDRHISRFLMEKGLLRQVKSITPKVYLEAEKALESLAKELGLSLGELDLYIFYIKTK
FT                   KVLK"
FT   gene            complement(161325..161744)
FT                   /locus_tag="aq_252"
FT   CDS_pept        complement(161325..161744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_252"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_252"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06573"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66613"
FT                   /protein_id="AAC06573.1"
FT                   /translation="MRFLILLLPFFLFAKEVCLDFSEIDTDDPYVKQAIIRKVEEYVLE
FT                   AGFKVKCTENTLRIKVRANYREVPSTISARQRVSSYTLYLSVSLGEESFSASVPYSLPS
FT                   GSLAELPRRKALEEAFSRIKLHIIKYFSREYLREK"
FT   gene            complement(161732..162217)
FT                   /gene="kdtB"
FT                   /locus_tag="aq_253"
FT   CDS_pept        complement(161732..162217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtB"
FT                   /locus_tag="aq_253"
FT                   /product="lipopolysaccharide core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_253"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06565"
FT                   /db_xref="GOA:O66614"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66614"
FT                   /protein_id="AAC06565.1"
FT                   /translation="MGKRVVYPGTFDPPHYGHLDIVKRSARIFDEVVVAVAKKPRKFLL
FT                   FDAEERVKMFEKMVEDIPNVEVKMFDCLLVDFMKREGINVIVRGVRLFTDFEYELQIAL
FT                   TNYKLAGVETVFMMPSQEYIHISSTIVRDVASYCGDLDNMVHPYVKQKLREKFNCGS"
FT   gene            162752..163159
FT                   /locus_tag="aq_254"
FT   CDS_pept        162752..163159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_254"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06577"
FT                   /db_xref="GOA:O66615"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="PDB:2III"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66615"
FT                   /protein_id="AAC06577.1"
FT                   /translation="MAKTLGLHILADLYGVDADKIDRVEDIRELLEGAVKYANLTKISS
FT                   HYYQFQPHGATGVVLLAESHISIHTWPEHGLATVDVYTCGDPSKAYRAMDYIITQLNPK
FT                   RIDKQVHERGIVEEESNQSEAEKLRSILLQV"
FT   gene            163193..163678
FT                   /locus_tag="aq_255"
FT   CDS_pept        163193..163678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_255"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_255"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06574"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66616"
FT                   /protein_id="AAC06574.1"
FT                   /translation="MKVLIVFYKDLEKNKEEILNLMKKNYKLIKRKLGIDNIYASITEE
FT                   FLEIFYLFPEICLINNTRGTLNFGLYKGLRKLKGDDILVVDAGKSFSEGKFEKVPMGDL
FT                   PSILMDKEKWAGLAYIPMREMYYFIRSLEENFDKCITEAFETLKKSYGINFVKSFIS"
FT   gene            complement(164100..165377)
FT                   /gene="ygcA"
FT                   /locus_tag="aq_257"
FT   CDS_pept        complement(164100..165377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygcA"
FT                   /locus_tag="aq_257"
FT                   /product="RNA methyltransferase (TrmA-family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_257"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06582"
FT                   /db_xref="GOA:O66617"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66617"
FT                   /protein_id="AAC06582.1"
FT                   /translation="MKDKPLKLTVEKLVYGGYGFSRLNGKAVFVRFASPKELVEAKVVK
FT                   EKKDYTEAVVTKVLISSPARRKAPCPYYGECGGCQIQHLNYEEQLRSKKDILLESLERI
FT                   GKIKEVPYEGEIPSKKEFNYRVRVQFKIQENRVGFYRWDVKEVVDVEECLLAHERINEL
FT                   IPHIREVLKVIKDLQEVHVNYSPTRDEATLKFVTITHTDEKLLQNILENVLPEWVVGIG
FT                   DYGKVGNSLVKRYKVGREHIFMDVGKWQYRVSNDSFFQVNYTLWEDFLKEVLDFSESYK
FT                   KGLDLHCGVGFFTIPLSEQGNFIEGADANPSAIKDAEYNAKINNRDNVIFEEATAFKHL
FT                   KRRIGEVINLVVVDPPRSGLLREERDLLLKNKPDKIVYISCNPTTFARDLKILTKGGYE
FT                   LKRLKLIDNFPQTYHIESIALLEVKD"
FT   gene            complement(165358..166371)
FT                   /gene="nusA"
FT                   /locus_tag="aq_259"
FT   CDS_pept        complement(165358..166371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="aq_259"
FT                   /product="transcription termination NusA"
FT                   /db_xref="EnsemblGenomes-Gn:aq_259"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06581"
FT                   /db_xref="GOA:O66618"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:O66618"
FT                   /protein_id="AAC06581.1"
FT                   /translation="MVKAQLQKLIEQVATEHDLPERVVERALKNAIITAIRKEKKIRDE
FT                   LEVEFTDEGIKVYVVRRKGNKKFKFPLDISPEDLNRLAAYAAKEEFYKELERAEQERGY
FT                   LEFKELEGEIVYGIVRKVLENGDVIVDLGRIDAILPKREQLPTDNFKTGDKVKALLLEV
FT                   RKRRGEPVLILSRTHPNFLRKLLEQEVPEIKEGLVEIKAVARIPGERAKVAVEAKEMKM
FT                   DPVGIVVGLKGMRIQKVSEELGGEKIDVIRWSDDIAELIKRALAPAHPEKIKLFPYEKR
FT                   AEVAVPEEELSLAIGKKGINVKLASKLTGWHIDVLSTKDFEKLEELRKKEDEGQTS"
FT   gene            complement(166365..166841)
FT                   /locus_tag="aq_260"
FT   CDS_pept        complement(166365..166841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_260"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06588"
FT                   /db_xref="GOA:O66619"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66619"
FT                   /protein_id="AAC06588.1"
FT                   /translation="MEINREEIEKKVKEIVEPVIRGMGFKLFDVEFKPEGRGWVLRIIA
FT                   DKEGGITIKDCEEISRKVSALLDVEDIIPFSYLLEITSPGLTRPLTKVEHYDFFKGRLV
FT                   KLILKEPIEGKREVVGYIEDVKNGIIDIREKEKGKVLHIPFSAIAKGRLEIEGW"
FT   gene            complement(167586..168155)
FT                   /locus_tag="aq_262"
FT   CDS_pept        complement(167586..168155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_262"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_262"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06583"
FT                   /db_xref="GOA:O66620"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O66620"
FT                   /protein_id="AAC06583.1"
FT                   /translation="MAFKFPAENWEVLLNPERSEWQSVEVFLKAVNPSENEVWVDLGCG
FT                   PGYFTLPLAKRVKKVYAVDLEEKMLEVCEMRAREEGIENIEFVKCEEDRIPLPDEIADG
FT                   VLMANLIHELIKPKEFLSEVKRISKPAAKIVVIDWHPLPSPAGPPLEERIPKEKAIEIM
FT                   EDNGFVLEEDLDVYPYHYFLVFKNLQ"
FT   gene            168875..168963
FT                   /locus_tag="aq_t01"
FT   tRNA            168875..168963
FT                   /locus_tag="aq_t01"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:168909..168911,aa:Ser,seq:gga)"
FT   gene            168918..169889
FT                   /gene="hemC"
FT                   /locus_tag="aq_263"
FT   CDS_pept        168918..169889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="aq_263"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_263"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06580"
FT                   /db_xref="GOA:O66621"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66621"
FT                   /protein_id="AAC06580.1"
FT                   /translation="MYPVWGTEGSNPSPSAIPAMKIRIGTRKSKLALWQANYVKDFLEK
FT                   HWGVEVELVKITTTGDKITDVPLAKIGGKGLFVKEIEKALLEGSIDLAVHSLKDVPMVI
FT                   PKGLKLGAITKRENPYDVLISRSGKKLYELPSGSVIGTSSLRRQVQIKKRRRDLKVEVL
FT                   RGNVDTRMRKLKEGLYDAVILAYAGVKRMGYESEITEVLEDFIPAVGQGSLAIEIREGD
FT                   KRIEELIKPLNNEESFLCAIAERTFLRRLEGGCQVPVGAFAKIENGTLKMKAFISDIEA
FT                   ERYIEGYREGNPEEAEKLGLSLAEELLKKGGEEILKEIYSSQ"
FT   gene            169886..170539
FT                   /locus_tag="aq_264"
FT   CDS_pept        169886..170539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_264"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_264"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06584"
FT                   /db_xref="GOA:O66622"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:O66622"
FT                   /protein_id="AAC06584.1"
FT                   /translation="MRFLGFGIFSPEENMKIDEELQIKLENGEIEPCFRLYKWKGVCVS
FT                   LGRNQEEKEFPVKVVRRPTGGGALLHGWDLSFCIVDYKNGRNFMRFYREVSKMFYNIFK
FT                   EFGVNLKFERNKSYSLQTYYCYFFPTFGELKTEEGKKVVAIAMRELKNTFLLHGSVYVD
FT                   FDYNYASKILNVKEEELRKRVTTLKELGISEEDFKTLLCSYLSSLRGRAFHPHT"
FT   gene            complement(170475..171491)
FT                   /locus_tag="aq_265"
FT   CDS_pept        complement(170475..171491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_265"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06589"
FT                   /db_xref="GOA:O66623"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:O66623"
FT                   /protein_id="AAC06589.1"
FT                   /translation="MERKYYDILTDELRWKLERSTLYDIWKKLKEKDEREALEILNEIS
FT                   KEFLELEISKDINILSNILIRELERVSEKKEDIKFLRRELKFLKKIRNRLNDLTNLEKR
FT                   DAYISLSGKRIRYKKVLRDTLNLLKDLKAKLIENVEKEDFINALLYYSEYMKNVYRAIS
FT                   LLSLKQIRSFSKALKVDPLTGLLNRRVLPYILRDVLELSLYTETPFSIAMVDIDNFKKI
FT                   NDTYGHLFGDKVLKEVAKIIKKNLRRSDYVFRYGGEEFLILMPSTELKDAVRILEKIRK
FT                   EVENTPICWQGKEIRVTISVGVCSDVYNGLKSPEEYIKCADEKLYLAKRTGKNRVVF"
FT   gene            171596..172732
FT                   /locus_tag="aq_267"
FT   CDS_pept        171596..172732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_267"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_267"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06585"
FT                   /db_xref="GOA:O66624"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66624"
FT                   /protein_id="AAC06585.1"
FT                   /translation="MFYVSKVTPFFFALALLNLLISLFIRLSQDTSLFFVSLVFGFVGL
FT                   TLMGAMYQIIPNSQNRKLSIPKVSYLVFFLILVSFYEFYTGNTESGSLFLFLGSLIFFF
FT                   HLLLNVKNFYPLTVRFLLASMIYLVLSALFLYLHFKGFLPVQLSVHTLTVGSMLNAIYG
FT                   VELAWIPMLIMETLNIRKGEKLFTAKQVSTLALLLAFWSMNYKLIALAGLLEFGVALYF
FT                   LYLNYELFKRKRMPTPPPNVVKIFLFALLFLPLGMLLGIFSASHAQALPFSLRLHLDLI
FT                   LYGFGAFTIFGGMLHLLPRIVWNWKVQEKENPGFTMGDLVNERELQTFLEYSALLYALF
FT                   LAVDSLFSPLHVISTVVYLVIMALFLKEIHKAFLYIFK"
FT   gene            172848..173318
FT                   /locus_tag="aq_268"
FT   CDS_pept        172848..173318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_268"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06590"
FT                   /db_xref="GOA:O66625"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66625"
FT                   /protein_id="AAC06590.1"
FT                   /translation="MEKVNYELHYIIMIFSDTVRYALIALAYLALNRDRLVKVEEIAKV
FT                   HKIPRPFLAKVMHELSKRGVVYSVKGPRGGFSLAKEPDKITIWDIIELFGDAYKYEMCL
FT                   LMPHKCSEFADNPCIVHHKWEELKSQIQDFFKGTTIKDLINIEEKHLFPVSR"
FT   gene            complement(173338..173826)
FT                   /locus_tag="aq_269"
FT   CDS_pept        complement(173338..173826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_269"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06591"
FT                   /db_xref="GOA:O66626"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66626"
FT                   /protein_id="AAC06591.1"
FT                   /translation="MKWEISKTFRFEAGHRVWKQNLTYGRGAQFTKEKPVNKCVNLHGH
FT                   SYVLEVTVGSDTLSEQDMVMDFYHVKNALKGLIEEIDHSFIIDVNDPMYPELKDVAEKY
FT                   GAMKIFPVEFCPTAEALAKFFYDFLKKRLEEAGLLGEVKVVKVVLWETATSKAEYKEE"
FT   gene            173860..174678
FT                   /gene="lgt"
FT                   /locus_tag="aq_270"
FT   CDS_pept        173860..174678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="aq_270"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_270"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06579"
FT                   /db_xref="GOA:O66627"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66627"
FT                   /protein_id="AAC06579.1"
FT                   /translation="MFPEVISVFGLKISLYGILVALGVLVGYFLVLKLAKREGLNTKAV
FT                   ENTFMIAVLFGVIGARIAYILEHPYEFHSLVDFLALWKGGVSFYGGLIGGIIGALIGIK
FT                   VFNLPLWKSADIAAPAIALAHFFGRLGCTSAGCCYGKPFPYATSNEVGIHFSDKFPFFY
FT                   VVFPKGAVAPPFTPLYPTQLMEAFGNLLIFFVLLFAYRYKPFSGFVFSLYLMLYGFERF
FT                   FLEFFRGVTPPIPGIGLTWNQVVSLVLIAGSILLMFLLKNQKSNVVDYEV"
FT   gene            174675..175886
FT                   /locus_tag="aq_271"
FT   CDS_pept        174675..175886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_271"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_271"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06586"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66628"
FT                   /protein_id="AAC06586.1"
FT                   /translation="MKIAFLRPGKIGTPANHVYALLDYLREKGAEIREYDLKERDVNDV
FT                   VKEIEEWKPLFLMDVNATGVIVAERDGKKHILADILGIVHVSVFFEDPLLFFPAFEGVE
FT                   KPQNYIAFITELKHTDSLTALGIQNISYISPFVDLKQFPESEGEKDIEIAFVGPVVDPQ
FT                   IILNSVSQNYPQEIMPFFIETGEFMFRNPEVHILTAFNYVFGLFNPQMQEQFNKWREQN
FT                   PSAFMRFLNDITAYTTMRRRMYLLHFLDGMDVKILGDYQGNLFENHEAIKVSSYEQLLK
FT                   YYSRSNITVYVSPQTYPTGLSVIPLEILYMGSLPLIDFKGAIPGFLKPGEEIETFAPLD
FT                   RADLEEKIVFYIEENREGINEIVQRGKKAVQERFTVKDRGEFVYNVLSDVKRQYEAAQK
FT                   GQVN"
FT   gene            complement(175879..176328)
FT                   /locus_tag="aq_272"
FT   CDS_pept        complement(175879..176328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_272"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_272"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06587"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66629"
FT                   /protein_id="AAC06587.1"
FT                   /translation="MKLDLSTFLKRDELPFRSLEEAKEYVAKYTLNFINIELEGLPKEE
FT                   WENTLKTWVKIFAFARELLKLPQERRKEVYRKYNFDSMMEGIMEDAVKVLYGFYSLGIL
FT                   KPEDKPHKALEKATELIENEEELLKREGIKRENLKFIKEFLKKFN"
FT   gene            176409..177572
FT                   /gene="aspC4"
FT                   /locus_tag="aq_273"
FT   CDS_pept        176409..177572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC4"
FT                   /locus_tag="aq_273"
FT                   /product="aminotransferase (AspC family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_273"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06578"
FT                   /db_xref="GOA:O66630"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019881"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66630"
FT                   /protein_id="AAC06578.1"
FT                   /translation="MFEFSDRLKVLPPYLFAELDRKKQEKIEQGVDVIDLGVGDPDMPT
FT                   PKPIVEAAKKALENPENHKYPSYVGKYEFRKAVADWYKRRFDVDLDPNTEVITLIGSKE
FT                   GIAHFPLAFVNPGDIVLCPDPAYPVYRIGAIFAGGTPYTVPLKEENNFLPDLDSIPEDV
FT                   AKKAKIIWINYPNNPTSAPPTLEFYKKLVDWAKEYNVIIASDNAYSEIYTGQEKPPSIL
FT                   QVPGAKDVAIEFHSLSKTYNMTGWRIGMAVGNKELVAGLGKVKTNVDSGQFGAVQDAGI
FT                   VALNLPEEEVEKIRDVYRERKKIMTEALEKIGLEIYRSDYTFYLWIKVPEGYTSAEFVG
FT                   RLIDEAGIVCTPGNGFGEYGEGYFRISLTVPTERLLEAAERIKNLKL"
FT   gene            177613..178299
FT                   /locus_tag="aq_274"
FT   CDS_pept        177613..178299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_274"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06592"
FT                   /db_xref="GOA:O66631"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66631"
FT                   /protein_id="AAC06592.1"
FT                   /translation="MNACERLSRVLERIQKACERAGRGENCAKLLGASKTVPPEVIREF
FT                   YNCGLKVYGENRVQEFLKKYEALKDLDLEWHFIGRLQTNKVKYLMGKVVLIHSLDRKNL
FT                   ADEIQKRAFKNNIVQDVLIEVNVGGEETKGGVEPENLKELFEYTLELPNVKVLGLMTIP
FT                   PYLENPEDVRPYFRKLRELRDELQREYNVALPHLSMGMSHDFEVAIEEGATIVRIGTLL
FT                   FGERKY"
FT   gene            complement(178587..179963)
FT                   /locus_tag="aq_276"
FT   CDS_pept        complement(178587..179963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_276"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_276"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06598"
FT                   /db_xref="UniProtKB/TrEMBL:O66632"
FT                   /protein_id="AAC06598.1"
FT                   /translation="MKILYGGLTQAHDFLIKGAMERLGYDVEPLPTPDNEALKVGKEFC
FT                   NKGQCNPTYYTVGNLVKYLMEKRESGERDIEKKYVFVTAGSCGPCRFGMYEMEYRKALK
FT                   DAGFRDFKVITFEQSEAVLKEMGESELKFDKDFFLSLMKAVILGDLINDVYYKVKPYEE
FT                   VPNSADMWKEESLNILYEALRNGRSLFKALREVKRKLDNLKVYYFQPKPKVKITGEFFA
FT                   QTTEGDGNYRMAKWLIEEGAEPIVEPVSTWIEYLIYEKILDTKEKAFKNRKQAFKTILA
FT                   LKALNVYFRGLYNFYRLALGNKPDPLKSQKKLAQYANRYYNVRLSGGEGHMEVGKHIYM
FT                   IKHKKAHMVISVKPFGCMPSTQSDGVQSKVIEDLGGSLFVAVETSGDAEANVKSRVLMK
FT                   LYEAKMKAFEEYERAKEELKISEEDIQRAINENPKLKSGGIKLPHRYVSTASNALLLLN
FT                   "
FT   gene            complement(179960..181378)
FT                   /locus_tag="aq_277"
FT   CDS_pept        complement(179960..181378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_277"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_277"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06599"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:O66633"
FT                   /protein_id="AAC06599.1"
FT                   /translation="MTNFIGFENLDKIDYETIRGEETRCHFCKNLCIRTFIDLKVNEEK
FT                   KRFIIATCDKGEVESKEELKKLLKERSSLQEKYPNFVEISNKLLFKSYKPKKVVKENGI
FT                   INFFRKKKLEFLKNAVIGIPRVLNVYSYAPFFRTYFEALGVKKVVFSDFTSEELYRRGS
FT                   KRGSIDPCFPSKVAIAHVHNLLFEKKGVNIIFFPCIRTLQGEIYKAEGHWACPTVSATP
FT                   EVVKASFTKERDEFRERGVIYLDPVLDLEDTELLERQLYKVFNPLFGITKEENREAVRE
FT                   GLRALEEYRRTLRERAREVLERLEREGKVGVVLLGRPYHNDPGINHEILDEINKRGYPI
FT                   FTIESLPRDEDILYRIFERDILEGRIEHPMDIRDVWKKCYSENSSMKVWAAKYTARHPN
FT                   LAGVDLSSFRCGHDAPIYSLIEEILEETNTPYFTFHELDENKPSGSIKIRVETIDYFLK
FT                   RYEEEVLKRREVAV"
FT   gene            complement(181375..183210)
FT                   /locus_tag="aq_278"
FT   CDS_pept        complement(181375..183210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_278"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06603"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:O66634"
FT                   /protein_id="AAC06603.1"
FT                   /translation="MLTVGLDVGSTTVKAVVIDENKNIVWKNYERHRTKQIEKVIEFLE
FT                   RIREELGVKEFRLFTAGSGGRKVAELLGGKFIQEVNALSFAVEHLHKDAGSVFELGGQD
FT                   AKFIVWIRDEKGVRKFATMNDKCAGGTGATIDRILMKLNLKPEEVKNVKYDPKKVHPVA
FT                   GKCGVFAETDINSLQKNGVPKDELMISLFDAIVLQNLTVLTRGYTPRPKVLLLGGPNNY
FT                   FPALREAWEYQIRKLWEERGFEVKEENPIYVPEDALYYVAFGSALLSQFEEKDSFVVKD
FT                   LSPLYRFLEEREKIKAQSGQVALWKTKEELEEFLKEYTSKPFTPPALYPGEKVGVYIGV
FT                   DGGSTSTKGVLLNEEGEVITTAYKLSEGNPIEDTKGILKKMKREMEEKGVDIEVLGVGF
FT                   TGYAKDLLKMAFGGDVAIVETVAHTLGALKFFPDAEVICDVGGQDIKVIILRNGKVKDF
FT                   RLNTQCSAGNGYYLQSTANRFGYRVEEYADVAFKAKYCPSFNFGCAVFLEADIVNFQQL
FT                   GWTAEEIMAGLAKVLPLNVWLYVMQEPNLRKLGKVFVLQGGTHKNLAVVKAQVDYIKSK
FT                   VPEAKVYVHPMGSVAGAIGAALEAKRVKEAEGVLV"
FT   gene            complement(183235..183774)
FT                   /gene="acrR3"
FT                   /locus_tag="aq_281"
FT   CDS_pept        complement(183235..183774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR3"
FT                   /locus_tag="aq_281"
FT                   /product="transcriptional regulator (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_281"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06593"
FT                   /db_xref="GOA:O66635"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:O66635"
FT                   /protein_id="AAC06593.1"
FT                   /translation="MNDMSVQTRERIIKAAAKEFAEKGFYNTQISHIVESAGVARGTFY
FT                   IYFKSKEEVFEEILKKVVEDLKERIKPVDISRDPVEQVKENVKRVIDYALENRELAKII
FT                   LFRSCEPNYAKIIDCFFEDVVNLISRSLEKGIKLGILKPHDTEVVARVILGGVKEVIKS
FT                   LICKRKLIQKKLRMNF"
FT   gene            183890..184531
FT                   /gene="mutY1"
FT                   /locus_tag="aq_282"
FT   CDS_pept        183890..184531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY1"
FT                   /locus_tag="aq_282"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:aq_282"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06594"
FT                   /db_xref="GOA:O66636"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:O66636"
FT                   /protein_id="AAC06594.1"
FT                   /translation="MKREDVPKVLEILKREFPKWNAPVVHMIAQHDKDPFRVLVCALLS
FT                   TRTKDELTWRVCKRFFEKVKSPEDLIKLSEKEIEELIYPVGFYRVKAKQLKEIGKILIE
FT                   KYGGKVPDTLEELLKLPGVGRKVANLVLSKGFNKPAIVVDVHVHRIVNRWCLVKTKTPE
FT                   ETERKLMEIVPKELWSDINYLLVAFGQTICLPRKPKCEECPVEKYCGKCL"
FT   gene            complement(184528..185025)
FT                   /locus_tag="aq_283"
FT   CDS_pept        complement(184528..185025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_283"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06604"
FT                   /db_xref="GOA:O66637"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:O66637"
FT                   /protein_id="AAC06604.1"
FT                   /translation="MSELVEMEVHGITLDPTTQMPIVVLKGKEDENLILPIWIGAFEAN
FT                   GIAMKLQGVEPPRPMTYELLKNIITEMGGNVEKVVINDLKDSTYYAEIYINQGNNTLVI
FT                   DSRPSDAINLALRFGAPIYVAEHVLEQSKLPEPEEDEEKKKLREWLENIKPEDFEIGGE
FT                   KS"
FT   gene            complement(185022..186344)
FT                   /locus_tag="aq_284"
FT   CDS_pept        complement(185022..186344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_284"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06605"
FT                   /db_xref="GOA:O66638"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66638"
FT                   /protein_id="AAC06605.1"
FT                   /translation="MSKKFFIKTFGCQMNFNDSERIRGLLKTIGYEQTDNWEEADLIIL
FT                   NTCTIREKPDQKVLSHLGEYKKIKEKNPKALIAVAGCLAQRTGWELVKKAPVIDIMFSS
FT                   FNMHQLPELINQAQAGYKAIAILDELPQDEDKIWEYPVERDNKYCAYVTIIKGCDKNCT
FT                   YCVVPRTRGKERSRALHSILDEVKRLVDDGVREIHLLGQNVTAWGKDFEKPIPFSELLY
FT                   QVSKIDGVERIRFTTGHPRDLTDDIIEAMADIPQVCNALHLPFQAGSNRILALMDRGYT
FT                   KEEYLEKIEKLKEKVKDIAMSTDVIVGFPTETEEDFEHTLDVLKKVRFEQVFSFKFSPR
FT                   PGTPAAEMEGQIPDDVKTERMRRLLELQKSILSEIAKKYEGTVQEVLVEEEKNGELIGR
FT                   TTTNKWASFKGDPSLLGKIVKIKVIKSSPFSLEGELLEVIK"
FT   gene            complement(186373..186900)
FT                   /locus_tag="aq_286"
FT   CDS_pept        complement(186373..186900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_286"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_286"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06600"
FT                   /db_xref="GOA:O66639"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:O66639"
FT                   /protein_id="AAC06600.1"
FT                   /translation="MRLLEIIFENFLWKSRLLVLIAVVMSLFASLLLFLAGVYEIIYPV
FT                   IKLVDTGDYEIFQRKILASVISSLDLFLIATFLIIFSLGLYELFISKIDPAERDQRSSR
FT                   ILIVRNLEDLKMKLGKIVIMVLSVYFFKQALFFNFTQSIDFLFFGLGLVSIALALYLSH
FT                   REHLEEKEHKHH"
FT   gene            complement(186900..187373)
FT                   /gene="smb"
FT                   /locus_tag="aq_287"
FT   CDS_pept        complement(186900..187373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smb"
FT                   /locus_tag="aq_287"
FT                   /product="small protein B"
FT                   /db_xref="EnsemblGenomes-Gn:aq_287"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06597"
FT                   /db_xref="GOA:O66640"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="PDB:1K8H"
FT                   /db_xref="PDB:1P6V"
FT                   /db_xref="PDB:1ZC8"
FT                   /db_xref="PDB:2OB7"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66640"
FT                   /protein_id="AAC06597.1"
FT                   /translation="MGKSDKIIPIAENKEAKAKYDILETYEAGIVLKGSEVKSLREKGT
FT                   VSFKDSFVRIENGEAWLYNLYIAPYKHATIENHDPLRKRKLLLHKREIMRLYGKVQEKG
FT                   YTIIPLKLYWKNNKVKVLIALAKGKKLYDRRRELKEKAMKRELEREFKGKIHL"
FT   gene            complement(187381..188349)
FT                   /locus_tag="aq_288"
FT   CDS_pept        complement(187381..188349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_288"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06606"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:O66641"
FT                   /protein_id="AAC06606.1"
FT                   /translation="MSKVLELAKELGAEVIQTHTSWVLLLKDVVYKIKKPVNFGFLDYS
FT                   TLEKRKEMCYKEVELNRRLCPWVYIGVVPISEVKGKWVIENDENVVEYAVKMRRIPDEA
FT                   ILSNRLDKTTEEDLKKVAKVVADFHVRAKRVDEFGKMEVMKYNTDENFAQTEKYIGITI
FT                   SKEDYDFIKRKTNEFYEKHADIFEKRIKEGRIRDGHGDIRTEHVAFLEEGVCIFDCIEF
FT                   NDRFRYGDVLNDMCFLSMELEYFGREYLARAYEEEYRRISKDPDFDLMLPFFKCYRAYV
FT                   RGKVNSFLLDDPNLTQEEKEKAKERATKFFKLARTYAEMIK"
FT   gene            188378..189856
FT                   /locus_tag="aq_291"
FT   CDS_pept        188378..189856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_291"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06607"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66642"
FT                   /protein_id="AAC06607.1"
FT                   /translation="MFSKVLSGGLWGVEAFPVEVQVDISQGLPSFNVVGLPDSSVKEAR
FT                   ERVRSAVKNSGFSFPLKRITVNLSPSDRKKQGTFYDLPIALGILQSSGEIPEHDFVVLG
FT                   ELSLDGSLNKLSGLLAVLISLKEKGFKKFIIPKQNAGEASLIKGVEVYTFENLKEVVEF
FT                   LRGNLKREPISHRKHQVIEIFEGDLKDVKGQELAKRALEICAAGFHHLLFVGSAGAGKS
FT                   MLATRIKSIAPPMEEEEILEVSKIYSVAGMLEESLITERPFQAPHHTSSEVSLIGGGNP
FT                   PKPGLISLAHRGYLFLDEMAEFPRRFIESLRQPMENGKVQVSRAGSNVVFPAEFTLLGA
FT                   MNPCPCGNYKNPFKVCTCSEREIKNYNKKISEPIKDRIDLKVWVYPLKEEELVNLPEGE
FT                   SSEKVRERVIRAFRIQKERGKFNSRLSNEEVKKYCLDMLSREAKELLKEAVKNLNLSAR
FT                   SYFKLLKVARTIADLEESERIEDYHISECLQFRD"
FT   gene            189867..190262
FT                   /locus_tag="aq_293"
FT   CDS_pept        189867..190262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_293"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_293"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06601"
FT                   /db_xref="GOA:O66643"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66643"
FT                   /protein_id="AAC06601.1"
FT                   /translation="MNKLTLLLKFLIQAFMWFAIASEFVSLLYEIFHSLKENYFLGLET
FT                   HKILVKVLNVIIIYELFTTLLIALEERRIKLILIIDTAMIFFIRELLIVLFTYKKLELS
FT                   EGIASALILGTLGILRFLYLKYKIDVE"
FT   gene            190268..191383
FT                   /locus_tag="aq_294"
FT   CDS_pept        190268..191383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_294"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_294"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06602"
FT                   /db_xref="GOA:O66644"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:O66644"
FT                   /protein_id="AAC06602.1"
FT                   /translation="MKKFFPLLLLLLLTFVPALYLLNKKEYEIYTVKKEKVEKTVYATG
FT                   YVKALNEVEVKAKVAGYVSEVYKDVGQKVKKGEPLARIQNKPLEEKVKILEIQLQNLKE
FT                   KIREDSPFIRAYELKIKALREEVKELEEKLKRRKRLYEKELISKEEYESLKRKYRAKLE
FT                   SLKALESEFKESVEEVRRKIREVKANLEKAKEELGEYTVRSPIDGVILKKNVEVGEYVN
FT                   TFMETKPLFVVGNTEKLKTYLEVDEEYSSLVKKGQEVYVSVESLKDKLFKGKIVKVHKK
FT                   VDEKKKVFLVEAEVDYSEKVLPGTTVEGYIVVYRGEALLIPEKAILEGNRVKILKNGKI
FT                   IDKTIKLGETYGDKVEVLEGLKEGDRIVIEK"
FT   gene            191380..192630
FT                   /locus_tag="aq_296"
FT   CDS_pept        191380..192630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_296"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06608"
FT                   /db_xref="GOA:O66645"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:O66645"
FT                   /protein_id="AAC06608.1"
FT                   /translation="MRAVLFLSFKFFVERKRQSFIATLGVMIGTTAYIVMSSMVNGFQK
FT                   YFLEEALNINGHVKIFVEAREKGESFLKKFFPDKNFKILGEKPEETKDKIANYREILRK
FT                   YSQDKNVIGITVHLIGNGVLTYGVKEKPATFVGIIPKLEDKTLNVSKYLQEGRLNELER
FT                   NKDYVILGIKLAQELGIRETGKKVLLYAPSGEVYRLKVIDFLNTGITEIDKSRIYLHIK
FT                   KLQDILERQGEVNEVVLKLKDPDLAPFYAEKLSRETGYKAESWQESFKNFLSIFKIQKI
FT                   ITRSVVFSILLVSGFGIFNIIMMTVMEKRREIAILKAMGYEKRDLILIFTLQGLIIGLL
FT                   GGILGNILAYGMLEWLETLRIEVEGIIRAKGFILDRSLWYHFFGFVFALLTSYLASFYP
FT                   AYRASKFHPVEVFRSGG"
FT   gene            192623..193297
FT                   /gene="abcT8"
FT                   /locus_tag="aq_297"
FT   CDS_pept        192623..193297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT8"
FT                   /locus_tag="aq_297"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:aq_297"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06596"
FT                   /db_xref="GOA:O66646"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2PCJ"
FT                   /db_xref="PDB:2PCL"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66646"
FT                   /protein_id="AAC06596.1"
FT                   /translation="MAEILRAENIKKVIRGYEILKGISLSVKKGEFVSIIGASGSGKST
FT                   LLYILGLLDAPTEGKVFLEGKEVDYTNEKELSLLRNRKLGFVFQFHYLIPELTALENVI
FT                   VPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELSGGEQQRVAIARALANEPILLF
FT                   ADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAELTHRTLEMKDGKVVGEIT
FT                   RV"
FT   gene            complement(193284..194561)
FT                   /gene="serS"
FT                   /locus_tag="aq_298"
FT   CDS_pept        complement(193284..194561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="aq_298"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_298"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06595"
FT                   /db_xref="GOA:O66647"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="PDB:2DQ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66647"
FT                   /protein_id="AAC06595.1"
FT                   /translation="MIDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKR
FT                   LEALRSERNKLSKEIGKLKREGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLW
FT                   IPNLPHPSVPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSR
FT                   FTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCE
FT                   RDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQF
FT                   DKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVW
FT                   FPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILEN
FT                   YQQEDGSVVVPEVLRDYVGTDVIRPE"
FT   gene            194591..196369
FT                   /gene="glmS"
FT                   /locus_tag="aq_301"
FT   CDS_pept        194591..196369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="aq_301"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_301"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06609"
FT                   /db_xref="GOA:O66648"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66648"
FT                   /protein_id="AAC06609.1"
FT                   /translation="MCGIVGYVGRDLALPIVLGALERLEYRGYDSAGVALIEDGKLIVE
FT                   KKKGKIRELVKALWGKDYKAKTGIGHTRWATHGKPTDENAHPHTDEKGEFAVVHNGIIE
FT                   NYLELKEELKKEGVKFRSETDTEVIAHLIAKNYRGDLLEAVLKTVKKLKGAFAFAVITV
FT                   HEPNRLIGVKQGSPLIVGLGEGENFLASDIPAILPYTKKIIVLDDGEIADLTPDTVNIY
FT                   NFEGEPVSKEVMITPWDLVSAEKGGFKHFMLKEIYEQPKAINDTLKGFLSTEDAIPFKL
FT                   KDFRRVLIIACGTSYHAGFVGKYWIERFAGVPTEVIYASEFRYADVPVSDKDIVIGISQ
FT                   SGETADTKFALQSAKEKGAFTVGLVNVVGSAIDRESDFSLHTHAGPEIGVAATKTFTAQ
FT                   LTALYALSVRESEERENLIRLLEKVPSLVEQTLNTAEEVEKVAEKYMKKKNMLYLGRYL
FT                   NYPIALEGALKLKEISYIHAEGYPAGEMKHGPIALIDENMPVVVIAPKDRVYEKILSNV
FT                   EEVLARKGRVISVGFKGDETLKSKSESVMEIPKAEEPITPFLTVIPLQLFAYFIASKLG
FT                   LDVDQPRNLAKTVTVE"
FT   gene            complement(196370..196714)
FT                   /locus_tag="aq_302"
FT   CDS_pept        complement(196370..196714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_302"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_302"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06615"
FT                   /db_xref="GOA:O66649"
FT                   /db_xref="UniProtKB/TrEMBL:O66649"
FT                   /protein_id="AAC06615.1"
FT                   /translation="MRLRKILTHFFILMALTTNISFVLSPNPYELAITISANLFATILK
FT                   MGEGRILSNELMASSLVADLHLIPAGFVYFLGSVEEAVGLAMGALAANIVSIILGIIET
FT                   ILATFVEEEE"
FT   gene            complement(196711..197817)
FT                   /locus_tag="aq_303"
FT   CDS_pept        complement(196711..197817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_303"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06619"
FT                   /db_xref="GOA:O66650"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:O66650"
FT                   /protein_id="AAC06619.1"
FT                   /translation="MRFVRKKKRRKRLIDIYENRLFEILSLFRLPLLMLHTVLTIGTLG
FT                   YMILSDGDFINSLYMTVITVGTIGYGEVVEGSDTLIGRTFTTFLALGGIGVFTTSVTIL
FT                   IRIFFQEDFIGVLRAWKMLRDIEKLRGHFIIVGFNKTSQELIRLLRKRKIEIVVVDSRR
FT                   EVERQIKESKVKYYIIEEPYKRVVLEAAGIYKAMGMVVNLGDDAKNIAVIVTARLMRPK
FT                   KEDFFIYSFASSEDTAQKLEELGANRAVVPYRLLATRVAAYVFHAGSAFISDLFDRIAF
FT                   GEETEIDILEVTVPEDSELVGKQLKELDLRKNLGVTVIAVRKPDGKLIVTVSGETKIEP
FT                   GDTLILFGHPKNLRKAQRILLRKVEAKV"
FT   gene            complement(197804..200674)
FT                   /gene="ileS"
FT                   /locus_tag="aq_305"
FT   CDS_pept        complement(197804..200674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="aq_305"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_305"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06614"
FT                   /db_xref="GOA:O66651"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66651"
FT                   /protein_id="AAC06614.1"
FT                   /translation="MEEKKVDLKDTLNLPRTEFPMKANLPQREPQILEKWKGLYEKIQK
FT                   ERKGREVFVLHDGPPYANGHIHVGHALNKILKDVINKYNLLIGKNVNFIPGWDCHGLPI
FT                   ERAVEKELSKKKIKKESLPKTEFRELCREYAKKYVNIQREDFVRLGVLGDWEHPYLTMD
FT                   PKYEAQEIRELGKFFERGLAYRSKKPVYWCIYDKTAEAEAEVEYYEKEDPSIYVKFPLK
FT                   SGEKFGIKDKKVFAIIWTTTPWTLPANLGIMVKEDADYVLVEVEDEVWIVAKELMDKFF
FT                   ETVNRPEGLVLETVKGKDLVGLEYTHPFVEKEKLKGHLSEETLKNMWKIYPSEFVSLDT
FT                   GTGLVHMAPGHGQEDYVVGQRYGLEPYAPVSDEGRFVEPAPEFLINVRVFDANHLIVGV
FT                   LKEKGFLVHEEKIRHSYPHCWRCKNPVIFRATPQWFIGMDIEFFGKTLRQRALEEIEKV
FT                   KWIPEYGKNRIKSMVENRPDWCISRQRFWGVPITVFYCENCGEIIKDREVFERVAQLVE
FT                   NSEKGSDVWFELTSSQLLPEGYKCPKCGGDSFTKEEDILDVWFDSGCSHAAVIRPLGFQ
FT                   KADLYLEGSDQHRGWFQASLLESVGSYLEAPYKAVLTHGFIVDEKGRKMSKSLGNVISP
FT                   QEVVKEFGADILRLWVVSEDYTEDVKLGKNLLKKIADDYRKIRNTLRFIIGNLYDFNPR
FT                   TNALPFEKLHHFDRWIISELQNLLKKVHENYEKFLFYRVHNHIKNFVITTLSAIYLDVL
FT                   KDRLYVYAPASWERRSAQTALWHLLIALTTSTAPYLSFTAEELWEHVGKLDPSLPESVF
FT                   LYEMPKPDENLKDEEVLKDYEILLKVRDEVMRALEVARKEKGIIKHPYEAKVYIRGDES
FT                   VESLLKKYEDYLNFFFTVSQVELREGGEVQIEGEELPVKVGVNKAEGEKCPRCWIYYQK
FT                   EEFVGCVCKRCAKALSEMGIELNAVC"
FT   gene            200713..203292
FT                   /gene="mutS1"
FT                   /locus_tag="aq_308"
FT   CDS_pept        200713..203292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS1"
FT                   /locus_tag="aq_308"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:aq_308"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06613"
FT                   /db_xref="GOA:O66652"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66652"
FT                   /protein_id="AAC06613.1"
FT                   /translation="MEKSEKELTPMLSQYHYFKNQYPDCLLLFRLGDFYELFYEDAYIG
FT                   SKELGLVLTSRPAGKGKERIPMCGVPYHSANSYIAKLVNKGYKVAICEQVEDPSKAKGI
FT                   VKREVVRVITPGTFFERDTGGLASLYKKGNHYYVGYLNLAVGEFLGAKVKIEELLDLLS
FT                   KLNIKEILVKKGEKLPEELEKVLKVYVSELEEEFFEEGSEEILKDFGVLSLQAFGFEED
FT                   TYSLPLGAVYKYAKTTQKGYTPLIPRPKPYRDEGFVRLDIKAIKGLEILESLEGRKDIS
FT                   LFKVIDRTLTGMGRRRLKFRLLSPFRSREKIERIQEGVQELKENREALLKIRQILEGMA
FT                   DLERLVSKISSNMATPRELVYLKNSLKKVEELRLLLLELKAPIFKEILQNFEDTKKIIN
FT                   DIEKTLVEDPPLHVKEGGLIREGVNAYLDELRFIRDNAETYLREYEKKLRQETGIQSLK
FT                   IGYNKVMGYYIEVTKPNLKYVPSYFRRRQTLSNSERFTTEELQRLEEKILSAQTRINDL
FT                   EYELYKELRERVVKELDKVGNNASAVAEVDFIQSLAQIAYEKDWAKPQIHEGYELIIEE
FT                   GRHPVIEEFVENYVPNDTKLDRDSFIHVITGPNMAGKSSYIRQVGVLTLLSHIGSFIPA
FT                   RRAKIPVVDALFTRIGSGDVLALGVSTFMNEMLEVSNILNNATEKSLVILDEVGRGTST
FT                   YDGIAISKAIVKYISEKLKAKTLLATHFLEITELEGKIEGVKNYHMEVEKTPEGIRFLY
FT                   ILKEGKAEGSFGIEVAKLAGLPEEVVEEARKILRELEEKENKKEDIVPLLEETFKKSEE
FT                   AQRLEEYEEIIKKIEEIDIGNTTPLQALLILAELKKKCSFSKKESGA"
FT   gene            complement(204008..204754)
FT                   /locus_tag="aq_311"
FT   CDS_pept        complement(204008..204754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_311"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_311"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06616"
FT                   /db_xref="GOA:O66653"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:2YVL"
FT                   /db_xref="UniProtKB/TrEMBL:O66653"
FT                   /protein_id="AAC06616.1"
FT                   /translation="MNSFKEGEYVLIRFGEKKFLRKLLPKQSLSVKKSVLKFDEVIGKP
FT                   EGVKINGFEVYRPTLEEIILLGFERKTQIIYPKDSFYIALKLNLNKEKRVLEFGTGSGA
FT                   LLAVLSEVAGEVWTFEAVEEFYKTAQKNLKKFNLGKNVKFFNVDFKDAEVPEGIFHAAF
FT                   VDVREPWHYLEKVHKSLMEGAPVGFLLPTANQVIKLLESIENYFGNLEVVEILHRHYKT
FT                   ISERFRPEDQMVAHTAYLVFGRKLKT"
FT   gene            complement(204741..205580)
FT                   /locus_tag="aq_313"
FT   CDS_pept        complement(204741..205580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_313"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_313"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06617"
FT                   /db_xref="GOA:O66654"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:O66654"
FT                   /protein_id="AAC06617.1"
FT                   /translation="MRIRIAHSPDSDDAFMFYPLVKGLIDTEGLEIEHVLADIETLNRE
FT                   ALKGTYEVSAISFHAYPYVADKYAVLPSGGSIGEGYGPIVVAREELGTLKGKKIAVPGE
FT                   LTTAFLTLKLYEPDFEHVVIPFDRIIQAVLEGKVDAGLVIHEGQLSYKDYGLKKIVDLG
FT                   EWWKEKYGLPLPLGCNVVRKDLGREVVKKIERLMRESVEYALKERKRALEYAINYARDL
FT                   SEDLERTQKFVSMYVNERTVDYGEDGREAVRLLLRLGKERGIIKAEIPEKIFSDELF"
FT   gene            complement(205589..206026)
FT                   /locus_tag="aq_314"
FT   CDS_pept        complement(205589..206026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_314"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06620"
FT                   /db_xref="GOA:O66655"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:O66655"
FT                   /protein_id="AAC06620.1"
FT                   /translation="MSVILEFLATGFLVGKLPVAPGTFGTLVGIPLVLLLYLDRNLYLF
FT                   GTLIFFFLGWISSEYMVQNLRDEDPEQVVIDEIVGYLLCFLFVEPTLKSLILAFIIFRV
FT                   VDILKPFPVNLFENFPGGLGVMMDDVVGGLITSVVLYLLLQ"
FT   gene            complement(206135..207067)
FT                   /gene="hksP2"
FT                   /locus_tag="aq_316"
FT   CDS_pept        complement(206135..207067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hksP2"
FT                   /locus_tag="aq_316"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_316"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06610"
FT                   /db_xref="GOA:O66656"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:O66656"
FT                   /protein_id="AAC06610.1"
FT                   /translation="MNFLEEGVAIFDGEGNVKFMNQRLKESLGKEGRTYYESLRSVELI
FT                   GLIQETYQTRTPQEKGITFRDRTYAVRTFLYEDGVGILVKDITDRELMKETQKEFLANL
FT                   SHELKTPLAVVMNTLETLLDMEEESVKRELIGRALKRVKEAISLTETVYMLSFSKGKGK
FT                   VREEVNLEEVLSEVLKDLEENIKEKEISVEIDLKEKCLKGNREEIKVIIRNLLQNAVEY
FT                   NKRGGKVLVETRKDENAIVLSVEDTGIGIENRKIPLILEPFVKGEESKGLGLGLALVKK
FT                   IAQNYGAKINIQSERGKGTKVEIRFPEKV"
FT   gene            207352..208038
FT                   /gene="phoB"
FT                   /locus_tag="aq_319"
FT   CDS_pept        207352..208038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="aq_319"
FT                   /product="transcriptional regulator (PhoB-like)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_319"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06611"
FT                   /db_xref="GOA:O66657"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:O66657"
FT                   /protein_id="AAC06611.1"
FT                   /translation="MRRKMERIALIEDDKDLAFLVKLNLEREGFEVEHFERATPFFKFI
FT                   SENSVDLILIDIMLPDLDGFRIANFLKSRADLKEIPVIFITAKGEEEDKLKGFELGADD
FT                   YITKPFSMKELIARVRAVLKRYKKVSESKVLKYEGVELDTERQKLFVDGREVYLTPAEF
FT                   KILKTLMENFGRPVSRSSLVEKLWDYERETTERAIDVHVKHIRDKLGKYKGLIKTVRGV
FT                   GYKFEN"
FT   gene            208049..208645
FT                   /locus_tag="aq_321"
FT   CDS_pept        208049..208645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_321"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_321"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06618"
FT                   /db_xref="GOA:O66658"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:O66658"
FT                   /protein_id="AAC06618.1"
FT                   /translation="MSKLKTEKELKKREIMRVACKLFAQKGYHNTTMPDIAKALGMSVG
FT                   NLYNYFSSKEELAKEIMLFTSKLVGERLRKVNESNLDFKEKTKLLVKSFLQIALEEPEL
FT                   INYFLKVYLVNTEVFKDDCKGFACVSDVVTEVMIFVSDGVEKGIFRNQDFFTAFVTIMG
FT                   PLGGIVFLHNEGLLEKPLLEYAEELAQNIWNALKA"
FT   gene            complement(208642..209841)
FT                   /gene="dnaA"
FT                   /locus_tag="aq_322"
FT   CDS_pept        complement(208642..209841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="aq_322"
FT                   /product="chromosome replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:aq_322"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06612"
FT                   /db_xref="GOA:O66659"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:1L8Q"
FT                   /db_xref="PDB:2HCB"
FT                   /db_xref="PDB:3R8F"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66659"
FT                   /protein_id="AAC06612.1"
FT                   /translation="MELNALIKKIESVDSYAREFLKKFEIKQEKGKFLFIAPGEDYREW
FT                   LETIVNTFLEEEVRKLIEVKEKEEKKKVEIKDFLNPKYTLENFIVGEGNRLAYEVVKEA
FT                   LENLGSLYNPIFIYGSVGTGKTHLLQAAGNEAKKRGYRVIYSSADDFAQAMVEHLKKGT
FT                   INEFRNMYKSVDLLLLDDVQFLSGKERTQIEFFHIFNTLYLLEKQIILASDRHPQKLDG
FT                   VSDRLVSRFEGGILVEIELDNKTRFKIIKEKLKEFNLELRKEVIDYLLENTKNVREIEG
FT                   KIKLIKLKGFEGLERKERKERDKLMQIVEFVANYYAVKVEDILSDKRNKRTSEARKIAM
FT                   YLCRKVCSASLIEIARAFKRKDHTTVIHAIRSVEEEKKKDRKFKHLVGFLEKQAFDKIC
FT                   "
FT   gene            complement(209932..210942)
FT                   /locus_tag="aq_323"
FT   CDS_pept        complement(209932..210942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_323"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_323"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06627"
FT                   /db_xref="GOA:O66660"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:O66660"
FT                   /protein_id="AAC06627.1"
FT                   /translation="MLYKEFEGLRLSEMGVGTYLGELDEETDRGYYETIKKAVELGINV
FT                   VDTAINYRYMKSERVVGKVLQEVEREKVIVSTKGGYIPYDVESGEDPKEYFEKNFLKTG
FT                   IIDLSEMTPQGHYLGREFINWCFNKSLENMKTDYIDVYFLHNPEEQLLYVDRNRFNKKV
FT                   AECFELLEEKVSEGKLKFYGFATWHGFRLTPSSRQYLSLLEILDIAKSVAGENHHFKFI
FT                   QLPYNLGMPEAFTLKNQQVSGKTLSTLEAAQELGVYTYISATIYQGNVIGRVPERLKEF
FT                   FGLENDVHVAIQFVRSTPGVGTFLIGMSKTQHLLENIKVLEIPPVEREKFLTLFK"
FT   gene            211034..211816
FT                   /locus_tag="aq_324"
FT   CDS_pept        211034..211816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_324"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_324"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06628"
FT                   /db_xref="GOA:O66661"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016692"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:O66661"
FT                   /protein_id="AAC06628.1"
FT                   /translation="MYTLREPYKGYEVKVTLLPIEDIVIPPIQRDLSETLIKKLMLSIE
FT                   KVGFVDPILVVEGEEGKYEVINGQHRLKAAELLGIREIPAIILPQETKDYIISLNVEKA
FT                   PNLKDKAHQAYEIFMKYLKENPEMEEVELENMVEEPYFLTVGFITDRFGEKRFPAYAFE
FT                   KVLKKVDEFLGLPLEEAERERENRANVLRDVREVMEEKYQELGLTNALHKEAIISKAFQ
FT                   SVYGKRVRKVDDDFYTVFEKIKEAIPRVSFTEEELESF"
FT   gene            complement(211813..212577)
FT                   /gene="murI"
FT                   /locus_tag="aq_325"
FT   CDS_pept        complement(211813..212577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="aq_325"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_325"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06621"
FT                   /db_xref="GOA:O66662"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66662"
FT                   /protein_id="AAC06621.1"
FT                   /translation="MKIGIFDSGAGGMTVLKAIREAYPNVDVVYLGDTARVPYGIRSKE
FT                   TIVRYSKECANFLKDKGVDLLVVACNTASAYALEELKREFPFPVFGVIEPGVKEALRKS
FT                   KTKRIGVIGTQATIKSGAYQEALKRAGAEVYSKACPLFVPLVEEGMIEGEIPKKVVEHY
FT                   LKDFKGKVDTLILGCTHYPLLKREIQNFLEGVNVIDSSRATAKSLKDFVKNEGSGSLEL
FT                   YFTDRSQNLERLIKLILGEEVEPKITSEVFVL"
FT   gene            212605..213666
FT                   /gene="kdtA"
FT                   /locus_tag="aq_326"
FT   CDS_pept        212605..213666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="aq_326"
FT                   /product="3-deoxy-D-manno-2-octulosonic acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_326"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06622"
FT                   /db_xref="GOA:O66663"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="PDB:2XCI"
FT                   /db_xref="PDB:2XCU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66663"
FT                   /protein_id="AAC06622.1"
FT                   /translation="MQFEVLKRFFPKESLKNCKGALWVHTASIGEFNTFLPILKELKRE
FT                   HRILLTYFSPRAREYLKTKSDFYDCLHPLPLDNPFSVKRFEELSKPKALIVVEREFWPS
FT                   LIIFTKVPKILVNAYAKGSLIEKILSKKFDLIIMRTQEDVEKFKTFGAKRVFSCGNLKF
FT                   ICQKGKGIKLKGEFIVAGSIHTGEVEIILKAFKEIKKTYSSLKLILVPRHIENAKIFEK
FT                   KARDFGFKTSFFENLEGDVILVDRFGILKELYPVGKIAIVGGTFVNIGGHNLLEPTCWG
FT                   IPVIYGPYTHKVNDLKEFLEKEGAGFEVKNETELVTKLTELLSVKKEIKVEEKSREIKG
FT                   CYLEKLREFLRGL"
FT   gene            complement(213641..214411)
FT                   /locus_tag="aq_327"
FT   CDS_pept        complement(213641..214411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_327"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_327"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06629"
FT                   /db_xref="GOA:O66664"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:O66664"
FT                   /protein_id="AAC06629.1"
FT                   /translation="MLRTYFPEVVLFLHAFPLNKEMYRYQFCAFEEEGIPYVALDYPGF
FT                   GDAPNLPGEYTVERLTDYVVNELRKFRVKKVIPIGDSMGGYIMFDMWRRYREMIKGFVF
FT                   VATRAEADTEEGKKARYALIEKVQKEGKEFLIEAMLENQTSPATKKDENKMRTLRCIME
FT                   KATREGIVKTLKALAERKDNTDLLPSIDVPTLVIAGKDDERVTPPEIVKKIAEGIKGAK
FT                   YYELENSAHLPPFENPEKFNEVVIPFVKDLLKTP"
FT   gene            214370..214885
FT                   /locus_tag="aq_328"
FT   CDS_pept        214370..214885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_328"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_328"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06630"
FT                   /db_xref="GOA:O66665"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="PDB:1R4V"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66665"
FT                   /protein_id="AAC06630.1"
FT                   /translation="MQEKYNFGKVSSQHKNYSKIETMLRPKGFDKLDHYFRTELDIDLT
FT                   DETIELLLNSVKAAFGKLFYGAEQRARWNGRDFIALADLNITKALEEHIKNFQKIEQDM
FT                   GVDELLEYIAFIPPVEMNVGEDLKSEYRNIMGGLLLMHADVIKKATGERKPSREAMEFV
FT                   AQIVDKVF"
FT   gene            214915..215796
FT                   /locus_tag="aq_331"
FT   CDS_pept        214915..215796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_331"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_331"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06631"
FT                   /db_xref="GOA:O66666"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:O66666"
FT                   /protein_id="AAC06631.1"
FT                   /translation="MNKKELIDILLYDVALEHSAIIQYLYNVFLIGDPEITNEIESIAR
FT                   QEMRHLKWFAQKVVELGGKVTLNRIEEAIKVGQSWEEMLKNDVDAEEEAIKIYSQQLEI
FT                   VKDDSVKKLLDRVINDEMRHRDEFSEMLEELKNKKIEEAKQEAGIDSEIFNILNKLLQK
FT                   EYRLILDYLYHFFHSKTWQEKDTSLDIAIESMFHMGELGEKIGELGGYPDLSLPKAKHF
FT                   KGFTPEEVIEDIKEEETASRMYEENAKKVTREDLVKLFKWFEKQEDYHAQRLKELFRKM
FT                   NRFTIGGLGEES"
FT   gene            215844..215928
FT                   /locus_tag="aq_t02"
FT   tRNA            215844..215928
FT                   /locus_tag="aq_t02"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:215878..215880,aa:Leu,seq:gag)"
FT   gene            215954..216970
FT                   /gene="dcuP"
FT                   /locus_tag="aq_334"
FT   CDS_pept        215954..216970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuP"
FT                   /locus_tag="aq_334"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_334"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06624"
FT                   /db_xref="GOA:O66667"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="PDB:2EJA"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66667"
FT                   /protein_id="AAC06624.1"
FT                   /translation="MPKNDLLLRSLRGEPIGRFPVWLMRQAGRYMPEYRKIRNRVKNFL
FT                   ELCKNVDLATEISLLPLKILGVDAIIIFSDILVPLEPLGVKVEFVEGEGPKLSWSGKVS
FT                   DLKKYDPSQNAYVYEIIKRVKEAQDEVPVIGFAGAPFTLLSYLIEGGASKDFKSTKLFM
FT                   WENPKEYKRLMDILTETVLAYLKEQIKAGADVVQIFDSWVNNLSLEDYGEYVYPYVNYL
FT                   ISELKDFSDTPVIYFFRGSSSFIDLAVDYRADALSVDWSVDIPELFKIYDKGFQGNLEP
FT                   AVLYASEEVIEEKTLGLLRRIPVKTRYVFNLGHGLAPDMELEKVKYLVDLVKSFPLT"
FT   gene            complement(217169..217759)
FT                   /locus_tag="aq_336"
FT   CDS_pept        complement(217169..217759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_336"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06633"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66668"
FT                   /protein_id="AAC06633.1"
FT                   /translation="MSLVEQLVKELSKGLNTRDYPEGFFKEHLAFRLKINKLEPVKHPH
FT                   IPDINSLLGVEKQKEVLLRNTAQFVKGLPANDVLLWGARGTGKSSLVKALLGVFGKEGL
FT                   RIVQVTKHEIPELADLYEVLRDKEEKFILFFDDLTFEPHEDAFRLLKSIMEGDVEERPQ
FT                   NVLFTQLQTGDTSLRIWKKRINFRRKHSTKSFL"
FT   gene            217784..217855
FT                   /locus_tag="aq_t03"
FT   tRNA            217784..217855
FT                   /locus_tag="aq_t03"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:217816..217818,aa:Gly,seq:gcc)"
FT   gene            217867..217938
FT                   /locus_tag="aq_t04"
FT   tRNA            217867..217938
FT                   /locus_tag="aq_t04"
FT                   /product="tRNA-Cys"
FT                   /anticodon="(pos:217899..217901,aa:Cys,seq:gca)"
FT   gene            complement(217910..218716)
FT                   /gene="cysQ"
FT                   /locus_tag="aq_337"
FT   CDS_pept        complement(217910..218716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="aq_337"
FT                   /product="CysQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_337"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06626"
FT                   /db_xref="GOA:O66669"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:O66669"
FT                   /protein_id="AAC06626.1"
FT                   /translation="MLEKVIKACKKAGEEILEVYSKEFTVEEKEDRTPVTEADRRAHRI
FT                   ITEELKETRIPVLSEEGKEIPFKERRKWKRFWLVDPLDGTKEFIKKNGEFTVNVALVEE
FT                   GEPVLGVVYAPALEVLYFAEKGNGAYREVKGKMEKLPIGNWSRENLRVVASRSHMNEET
FT                   KKFLENLEKKFGKLQFLSKGSSLKICMVAEGSADIYPRIAPTMEWDTGAGHAVAKEAGC
FT                   ELFVYEEGKLREPLRYNKEDLRNPSFVCLSLEIKELVEATGGFEPP"
FT   gene            complement(218720..219373)
FT                   /locus_tag="aq_338"
FT   CDS_pept        complement(218720..219373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_338"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_338"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06632"
FT                   /db_xref="GOA:O66670"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O66670"
FT                   /protein_id="AAC06632.1"
FT                   /translation="MAEKEIMAKVFSGASKVYDFFVSLATFGGIHRWQKELIERMGEEG
FT                   NWLDVGTGTGEVLLKLKNSDLKVGIDLALGMLRRAKEKCGDCYFLLADAENMPFKDKSF
FT                   DRVSLSLVFRHLENKEKFLEEAKRVGKEKVRVGIIDIGRFKGTGVLILLMKTLLLPVGL
FT                   LFFGRDKWEFFIKSLKESLSPEETRSMFTSFGFKEIYFSRKFLGLIYIQVFEKE"
FT   gene            219402..221159
FT                   /locus_tag="aq_340"
FT   CDS_pept        219402..221159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_340"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06634"
FT                   /db_xref="GOA:O66671"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:O66671"
FT                   /protein_id="AAC06634.1"
FT                   /translation="MFTFALCPHDTEEKKEFEYWENIAKSISEKLKEDVKIITFKDYAE
FT                   EKLKLPSADYDIYYANPVSSYFLYKKGYKPLARLKGKRDSFVIIGYENVKDHQLTVTTT
FT                   YIETHLLPVLVLEHFDFLKTNIFFVKTQKEIYESVKNKKADFGIMFEDAYNEIEDEEKV
FT                   PVIVKIPSNLRHTLMVKPEIYKKLKEVIKEFEEFELIDDKEFLEGITENLPILAFLKTK
FT                   ELFDVSKAIYNEPFVGVLIYRDKIVYANETIQKLTGYTLEELQNLPFEELVAEEQREEI
FT                   KEAVKRRLRGEIFSKGYENLKIKTKDGKYLYTLAFSTTMLYKNSYAGLVFFIDITKEVL
FT                   YQKLYKALRNVNRAIATVLTEKELYKTVCETLVKELDIKFAWIGVPDEKTKTFKSIYKC
FT                   GEEQDYLKHIKIYAGGSLPEAKGPTGRAYTEGKIVINPSTEENPLMKPWKEEMLKRGFL
FT                   SSAAIPIMKNGKVHAVLNIYASIPHYFDEDIRTLLKELKQDLSFALEKIESIKESNILK
FT                   IAIENSREWILITDKDGNIEYVNDFVSKLTGYKKEELIGKKPRIFKSGYHPKEFYEKLW
FT                   KTILSGKRV"
FT   gene            222065..222556
FT                   /locus_tag="aq_341"
FT   CDS_pept        222065..222556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_341"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06635"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:O66672"
FT                   /protein_id="AAC06635.1"
FT                   /translation="MEKKPISVNVTARTFKNENFPNELFKYAKDIPAPLILEITERIYM
FT                   DDVETSRKIIKRLKENKNVKIAIDDFGTGYSSLSYLKDIDTDILKIDMSFVRRIVEDEK
FT                   IRAIVKAIITLAKDLNLSTLAEGVETKEQYEILKSMGVDLVQGFYFSKPLPENEAQLLI
FT                   "
FT   gene            222567..223340
FT                   /locus_tag="aq_342"
FT   CDS_pept        222567..223340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_342"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06636"
FT                   /db_xref="GOA:O66673"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:O66673"
FT                   /protein_id="AAC06636.1"
FT                   /translation="MSKEKYSFEDLIKVMEELRKKCPWDREQTHESLKKYLIEEAYEVL
FT                   DAIDSKDDEKLKEELGDLLLQVVFHSQIAKERGAFDINDVIDTLVKKLIERHPHVFGCA
FT                   NPEDVLKNWEKKKMEKRKSIFEGIPKHLPALMRSQKLQDRTSQVGFDFQDISQVFEKIQ
FT                   EEINELKESLEKGDRENIKHEIGDILTAVVELARFVNVDAEEALQEANERFIRRFSYIE
FT                   KKAKEEGRKLEDMSLEEMDKLWMEAKKLEEQGKLS"
FT   gene            complement(223332..224231)
FT                   /gene="arsA2"
FT                   /locus_tag="aq_343"
FT   CDS_pept        complement(223332..224231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA2"
FT                   /locus_tag="aq_343"
FT                   /product="anion transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_343"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06625"
FT                   /db_xref="GOA:O66674"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66674"
FT                   /protein_id="AAC06625.1"
FT                   /translation="MRVFFFGGKGGVGKTTASSAFAVKLSEQGKKVLLLSTDPAHSLSD
FT                   VFNTELQGETKLSENLTVKEIDLNEELKEYRSRVFKLAEATLRKETLRELEGIIHSLEE
FT                   SPGIEDVVIFEALSKEVVYRENEYDYIVVDTAPTGHTLGLLKTVRNLGNFLEEIVKLKE
FT                   KVYELKKLSGKSVHEEALEYLKERKERFKKFSEIIYDKSYFFAVLTPEKLPFEETKRLV
FT                   NSLKHYGIRVKALIINKVLPENPQDEFLKARKEVEKKFLKEIENYFMDIEKISIPYQKE
FT                   EVVGYEKLKEFSKFLPLG"
FT   gene            complement(224228..225160)
FT                   /gene="rfaD"
FT                   /locus_tag="aq_344"
FT   CDS_pept        complement(224228..225160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="aq_344"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_344"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06623"
FT                   /db_xref="GOA:O66675"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O66675"
FT                   /protein_id="AAC06623.1"
FT                   /translation="MKFLITGGAGFIGSNLAFALQERYPEAKIYVLDNFSSGHFKNLIG
FT                   FKGQVITGDISDPSLWDYVRKNFHFDVIFHEAAITDTTVEDQYFMMKTNADSFRYILDL
FT                   AVEWNAKVIYASSAGVYGNSPPPMREDKGLEPENIYGFSKLMMDHIAMDYMERYPEMNI
FT                   VGLRYFNVYGPREDYKGKTASMIYQLAVKMIKGERPRLFKWGEQRRDFVYIKDVIKANL
FT                   LALEKNVSGIFNVGTGRARSFNEIVSILNKELGTNYEIEYFDCPYDFYQKFTEADLTKI
FT                   REALGYEPEYSLEEGIKDYLPYIIKRVKK"
FT   gene            225588..227465
FT                   /locus_tag="aq_345"
FT   CDS_pept        225588..227465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_345"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_345"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06645"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:O66676"
FT                   /protein_id="AAC06645.1"
FT                   /translation="MKEKWKSIANLLEEEFDLEVQPSYEGWGAGYDPKFLPILEMWAKG
FT                   EVEEIPQGAKIPRGVIFNVVDFLKKSEDYTVNSIRHEIGLLLNTHFPSWRFGQREVFRA
FT                   GYVPTSFLVLFAVLESLKTDNKIIEELPSAFVSLKARYKEILSQIKAPYPYHQLALSFV
FT                   YAWINEEQDTSEEVKHYHSTMEKAFYEYLKEKNPQSAYDIVTEELWQKFRVLVDLSKDL
FT                   NYVDLLIEEARGRKREDAHRARIMTDILSKLPEELRNYIKENKDKSAVELPKEDVKVIL
FT                   KALEAIPDWMKDYMKQMSYMSLLEKDIEFLNFFLPKTLEIDVEHRGFVSFIFKAWEEIS
FT                   ASQNLKSKKKQEEEEELSDLDKKFKKEHGLTQKEFQKYRLILKSVLPYVEHFKRKFDNF
FT                   LPKEEELWDGKHFRGKRINPRRIATEVPIGRGRIFMRREVPQRKELIFELLMDISSSMK
FT                   KEEKILNALKSLILVSEVLDKLKMEFSIKVFNENVYTLKDFSEDYKVAKARIMDLLNDL
FT                   GGSTDLSKAITVGVESLEVVMKKEHKKGVLILFTDGQPTKGLRGEELKYFISQMKMKLP
FT                   IVAIGVGEATHMVKEYFDKTGLSVEDISKLPSAFSFVMENQFKRLLSVA"
FT   gene            complement(227462..228040)
FT                   /gene="pth"
FT                   /locus_tag="aq_346"
FT   CDS_pept        complement(227462..228040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="aq_346"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_346"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06642"
FT                   /db_xref="GOA:O66677"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66677"
FT                   /protein_id="AAC06642.1"
FT                   /translation="MDIKLVVGLGNPGKEYEKTRHNVGFMVIDELVKALRAKGPFEEAL
FT                   SHVYKARIGGKEVILAKPMTYMNNSGAAVYNLLEEYKLSPEQMIVVYDDLDLPLGHMRL
FT                   RLKGSSGGHRGVESIIKYIGTQNFPRLRIGIGRPKKKEDVVKYVLSPFSPEEEKVISQV
FT                   IKKAVRCLMRAIEISPEHAMEYCNRQDLI"
FT   gene            complement(228045..228500)
FT                   /gene="ctc"
FT                   /locus_tag="aq_348"
FT   CDS_pept        complement(228045..228500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="aq_348"
FT                   /product="general stress protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:aq_348"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06644"
FT                   /db_xref="GOA:O66678"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66678"
FT                   /protein_id="AAC06644.1"
FT                   /translation="MPHGEAFLIEAELDGETRVCLLKDIQFGWLGNNPIHIDLYDLSNV
FT                   EEIEVEVPIEFVGTPAGVEAGGTFEPVMHTLTIKAPPAKIPEKIVVDVSGLGLGEALHV
FT                   RDITPPEGCMILDNPEETVAVVYEPEEEVIGEEETGAEETGETEATS"
FT   gene            228716..229936
FT                   /gene="ribA"
FT                   /locus_tag="aq_350"
FT   CDS_pept        228716..229936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="aq_350"
FT                   /product="GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:aq_350"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06638"
FT                   /db_xref="GOA:O66679"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66679"
FT                   /protein_id="AAC06638.1"
FT                   /translation="MSEREEFKFNTVEEAIEDIRQGKMVIVVDDPDRENEGDLVMAAEK
FT                   VTPEAINFMAKYGRGLICLSLTPERCEQLDLHPMTPMNTDPKGTYFCVSIDAHPKHGTT
FT                   TGISAYDRALTIKLAISPDAKPSDFVRPGHVFPLKARPGGVLERAGHTEASVDLARLAG
FT                   LYPAGVICEIMKDDGTMARVPDLMEFAKKHNLKIITIADLIKYRLRRETLVEKVASAHL
FT                   PTPWGVFKIHAYRHKLTGEEQVALTMGEWKEDEPVLVRVHSECLTGDVFRSFRCDCRPQ
FT                   LEKALEMIAKEGKGVLVYILGHEGRGIGIANKIKAYELQEKGYDTVEANEKLGYPPDLR
FT                   DYGIGAQILRDLGVRKMKLMTNNPRKIVALEGFGLEVVERVPIKIEPNPYNKIYLQVKK
FT                   DKLGHMF"
FT   gene            complement(229933..231837)
FT                   /gene="leuS"
FT                   /locus_tag="aq_351"
FT   CDS_pept        complement(229933..231837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="aq_351"
FT                   /product="leucyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_351"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06643"
FT                   /db_xref="GOA:O66680"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="PDB:3O0A"
FT                   /db_xref="PDB:3PZ0"
FT                   /db_xref="PDB:3PZ5"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66680"
FT                   /protein_id="AAC06643.1"
FT                   /translation="MMKEFNPREIEKKWQKRWEEAGVFKAQEGKPNKFYVLEMFPYPSG
FT                   RIHMGHVRNYTIGDAIARYLKMRGKNILHPMGWDAFGLPAENAAIKHGIHPAKWTYENI
FT                   DYMKKQLKILGFSYDWDREIATCDPEYYKWNQWIFLKMLERGIAYRKTAKVNWCPHDQT
FT                   VLANEQVIEGKCWRCGTPIVQKEVPSWFLRITAYADRLLEDLKKLEGKWPERVIAQQRN
FT                   WIGRSEGALIRFYVEIEEPEKFLNCVPEELKETLLKEKRIYIDVFTTRPDTVFGATFVV
FT                   LAPEHPLVPVLACIGERLGNACYSDVENFVEKMKKMSTRERTMEEDKEGVFLGVYATNP
FT                   ANGEKIPVWSANYVLYEYGTGAIMCVPAHDQRDWEFAKKYDLPIKVVVKPEGAWDFEKG
FT                   AYEGKGTLVNSDGFDGLDSETAKRKITEWLQDRGLGEKKVSYRLRDWNISRQRYWGTPI
FT                   PVVYCEKCGMVPVPEDQLPVKLPLDVKFTGQGNPLETSEEFVNTTCPKCGGKARRETDT
FT                   MDTFFDSSWYFLRFCDPKNDREPFSREKVDYWMPVDVYIGGIEHAVLHLLYARFFQKFL
FT                   KDLGLVRDDEPFEKLITQGMVLKKWVSVKKLLDYLGLSEEDEVEELKKRLEELGARRA"
FT   gene            complement(231841..232578)
FT                   /locus_tag="aq_355"
FT   CDS_pept        complement(231841..232578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_355"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06647"
FT                   /db_xref="GOA:O66681"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:O66681"
FT                   /protein_id="AAC06647.1"
FT                   /translation="MTKFLEEVGRATLLTLWSIFFLFKKPPRLKHFISQLTYVAAETTP
FT                   VVLVTSLFTGGVIALQTYSTFHRFNAEYLIGAVVAISMGRELGPVLTSLMVVARVGSAM
FT                   TASIGTMRITQQIDALEVMAINPISFLVTPRIFATTFGVPLLTVLSDVAGIFGGWFVAT
FT                   KLFGVNEYLYWQKMVDLTEFHDIVGGLYKATFFGFIIGAVSCYYGFYTKGGTAGVGKAT
FT                   TNSVVTSSMLILISDYFLTAVIF"
FT   gene            complement(232592..234178)
FT                   /gene="leuA1"
FT                   /locus_tag="aq_356"
FT   CDS_pept        complement(232592..234178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA1"
FT                   /locus_tag="aq_356"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_356"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06637"
FT                   /db_xref="GOA:O66682"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66682"
FT                   /protein_id="AAC06637.1"
FT                   /translation="MAEKVYIYDTTLRDGSQMEGVSFSLEDKIRIAEKLDDFGIHYIEG
FT                   GWPYANPKDNLFFQKAKKMNFKNAKLTAFGSTRRPNKKVSEDPQVESLIKAETPVVTIF
FT                   GKSWDLHVTDALKTTLEENLNMIYETVEYLKRYVDEVIFDAEHFFDGYKSNPEYALQVL
FT                   EAALKGGADWVVLCDTNGGTLPHEIYEITKKVKERFKDANVGIHAHNDSETAVANSLMA
FT                   VLAGARQVHGTINGIGERTGNANLCSIIPNLQLKLGFDVIPQENLKKLTELANFVAEII
FT                   NMPLPRNMPYVGESAFAHKGGVHASAVLKNAKTYEHINPELVGNKRKITVSDLAGRSNL
FT                   VHKLKEFGIEIDPKSPELKKLIDKIKELEKEGYHFEAAEASLELLIKRHFGLVKDYFDF
FT                   DAYRVLIAKRRDDSLPTSEATVRLSVEGVEEHTASLGNGPISALDRALRKALEEFYPNL
FT                   KELQLIDYKVRIINESAGTSAKVRVLIESTDGKRKWGTVGVSENVIEASWIALRDSIVY
FT                   KLMKDEEEGIL"
FT   gene            234260..234526
FT                   /gene="flgM"
FT                   /locus_tag="aq_357a"
FT   CDS_pept        234260..234526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="aq_357a"
FT                   /product="anti sigma factor FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:aq_357a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06641"
FT                   /db_xref="GOA:O66683"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="PDB:1RP3"
FT                   /db_xref="PDB:1SC5"
FT                   /db_xref="UniProtKB/TrEMBL:O66683"
FT                   /protein_id="AAC06641.1"
FT                   /translation="MVNRIELSRLIGLLLETEKRKNTEQKESGTNKIEDKVTLSKIAQE
FT                   LSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT"
FT   gene            234590..236518
FT                   /gene="dinG"
FT                   /locus_tag="aq_358"
FT   CDS_pept        234590..236518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="aq_358"
FT                   /product="ATP-dependent helicase (DinG family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_358"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06640"
FT                   /db_xref="GOA:O66684"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66684"
FT                   /protein_id="AAC06640.1"
FT                   /translation="MDSISFYEYLLTKGFEERKSQREMIKIVEEALEEGGVKLIEAPTG
FT                   TGKTFAYLIPIIVNKQKAIISTGTKILQDQLKRDIEFLAGHWKLLTGQKVNYAVIKGKG
FT                   NYLCIDRFKKEEIPEADRLEVETFMETEWDGDLTLTGLASETIVKINVDDDYCTFAYRM
FT                   ACPFYRECYYWAKVKRREENADILVVNHSLLALKEFETKDKVLVIDEAHELDRYLTLAT
FT                   TFGISLYWFKDLQKSLEKLLGESVNIPAEEFFRNNFEKLFDEESNEAALESLREYIPQM
FT                   KTLLYIPLNEAVEKLRKKVKEEVEKFVKETLMVSYTFKDFLENTLLFDRDLIDSVNAGY
FT                   EEPTEREKELINKVKKIDYYRRKLNKLKAFIRTAEDEEEGVGYKVSRAWSKKLNGYNYR
FT                   LEAFLIFPRNVIDPEEYKAVILTSATVEPEDIYLTTGITGEFYTLPHNYDYTTSTIFIE
FT                   DTNPKKEDWKDKLTTNYYILRSEYDKVLVLLTNKEHLKLFEEDEEVGIQGKDSLTRLIE
FT                   FLRSGRIKALIGLDSLWTGVDVKGEKGILMSKLPFENPRDPLTYHRLKFLEKVGEDPFT
FT                   YQRRKAYIKFRQGVGRLIRQNSDKGKIVLCDNRIWRYREFVDFLRSLGINIVSKGKFKR
FT                   KKRTPFW"
FT   gene            236530..237600
FT                   /locus_tag="aq_359"
FT   CDS_pept        236530..237600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_359"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_359"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06646"
FT                   /db_xref="GOA:O66685"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66685"
FT                   /protein_id="AAC06646.1"
FT                   /translation="MLLDRYLLSRFLGIFLNVSFVSVLLVSLYALLDFLVGFKEKRTDV
FT                   ALSYFLNILPLGFYYISFITLSISLILFLRKVFEKKMELTVQSFGISPLRFSLPVLLFS
FT                   VFLSSTFLLGNEYAFPKLLGNLWFIEKNYKKKQEVKGFIKNFWFIKKENEVKTYYHVGN
FT                   LNLSDGSLFNFYTMKVERKNLNPLEVLKVFSGVWKDKEIFIRSGEIYDFEKGKREKVFN
FT                   KTFKLGLSIKEVELFSEKIDFLSLSEIFFLMQKSKKVGLNVDVYTGELFYRVMFSLSPV
FT                   FISIFSLYLFFKHKVLSQVIPRFLVFIVILWLVILSPKILPQKANQPVLYSLIPIFLLI
FT                   LYSLKGVYDLRKGFRV"
FT   gene            complement(237559..238302)
FT                   /gene="timA"
FT                   /locus_tag="aq_360"
FT   CDS_pept        complement(237559..238302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="timA"
FT                   /locus_tag="aq_360"
FT                   /product="triose phophate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_360"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06639"
FT                   /db_xref="GOA:O66686"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66686"
FT                   /protein_id="AAC06639.1"
FT                   /translation="MRRLIAANWKMNKTVKETEEYINTFLKFVEHPESREILICPPFTS
FT                   LYVAGKMLQGTGVKLGAQNCHYEKRGAFTGEISIPMLQEVGCEYVIVGHSERRHIFGES
FT                   DELIHKKIVACLEMGIRPILCVGEKKEEREAGMTFKVIETQIKLALTGVEEHTDKIDIA
FT                   YEPVWAIGTGTPATPEDAVEVHTFIRNLINQLNPKNEGKTRILYGGSVNPQNAKEFMKH
FT                   EEINGLLVGTASLDPESFAKIVYSF"
FT   gene            complement(238638..239435)
FT                   /locus_tag="aq_362"
FT   CDS_pept        complement(238638..239435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_362"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_362"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06649"
FT                   /db_xref="GOA:O66687"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:O66687"
FT                   /protein_id="AAC06649.1"
FT                   /translation="MKKALLYRRGGLGDTLLTFPILEILKRRGYETIAVGNTDYFSIAK
FT                   EVGYADGVYSFIPEEEFDLKVIISFEGNVKPFPEKREWIVKHYLNSLGLGEEFSTKLPI
FT                   KPVQDSPLKGKVVIHPSSGSKKKNPPLEVFLKLKDFLEERGKEVVFLLGEAEEHLREVL
FT                   SPHFLSLSPLEIAKHLKTAGFYVGLDSGISHLASYLGVPSFIVYGPTDPLVWRPIGDKV
FT                   FQISLNLDCSPCFPNVCEERMCLDTEEVLRKTKETLLRYWNSL"
FT   gene            complement(239435..239866)
FT                   /locus_tag="aq_363"
FT   CDS_pept        complement(239435..239866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_363"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_363"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06650"
FT                   /db_xref="GOA:O66688"
FT                   /db_xref="InterPro:IPR025423"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66688"
FT                   /protein_id="AAC06650.1"
FT                   /translation="MIFMKELFLFLHVVLATFWVGGMLFLSLVVAPYLKDKPQIRNEAF
FT                   QEVGKRFSLYGTFLSLFLLFVTGLVNTYLIQGGFRPSIHTKLGVFFVVVFISLLHDLWA
FT                   GKKALYSEKHRVWAKWLGILNLILSLLLVYLGVRIRLGY"
FT   gene            complement(239863..240240)
FT                   /locus_tag="aq_364"
FT   CDS_pept        complement(239863..240240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_364"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06655"
FT                   /db_xref="GOA:O66689"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66689"
FT                   /protein_id="AAC06655.1"
FT                   /translation="MREIKTPKAPVPVGPYSQAVEVNGFLFISGQIGINPETGKLVEGF
FT                   KEQVIQIFKNVDAILEEAGLKRENIVKVTIYITDIKKFKELNEIYEDYFKDVSVKPARV
FT                   TVGVKELPLNAEVEIEIVAVK"
FT   gene            complement(240237..241949)
FT                   /gene="proS"
FT                   /locus_tag="aq_365"
FT   CDS_pept        complement(240237..241949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="aq_365"
FT                   /product="proline-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_365"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06648"
FT                   /db_xref="GOA:O66690"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66690"
FT                   /protein_id="AAC06648.1"
FT                   /translation="MRWSRYFLYTEKEEPKEAEAPSHRLLLKAGFIKQVSAGIYELLPP
FT                   AYKVLKKVESIIRKEMDRSGAQELLLTVLNPKELWEETGRWETYGEELFKLKDRNGREY
FT                   CLGPTHEEEITDLVRRVVRSYRQLPVILYQIQVKFRDEKRPRFGLIRAREFIMKDAYSF
FT                   DTDDMSAMISYEAMKFAYQRIFNKLRLNVIMAEADVGQIGGKMSHEFIAFTDYGEAKVA
FT                   YCENCGYAANAEIVPLPKPEEEKEEEKPMEKVHTPNVHTIEELSKFLDVHPSKIMKAVL
FT                   YIVNEKEPVLVLIRGDREIDENKLEKVLGTDNFRLATDEEVQELLGTKKGFIGIFNLPE
FT                   NIKVLWDNSLYGVKNLVVALNEPDWHYINVNPGRDFQYGEFVDVAEVREGDPCPKCGSP
FT                   LKVRRGLELGHIFLLGTRYSEPMKAYFTDRDGKEKPIIMGCYGIGVSRILAALVEQYHD
FT                   DKGIKWPTPVAPFELDIILLNTKDEEMKNVAEKLYLEAEEKGIDVIFDDREESPGFKFA
FT                   DADLVGFPYRIVVGKKVKEGKVEVQSRHTGEKWDVEIEKAIDFVKEKIEEDKK"
FT   gene            241994..244546
FT                   /locus_tag="aq_367"
FT   CDS_pept        241994..244546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_367"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06656"
FT                   /db_xref="GOA:O66691"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:O66691"
FT                   /protein_id="AAC06656.1"
FT                   /translation="MDHKKIKRSLKFRISFVTGIIFFLALLLTYIVLYTAFHTSAKYVA
FT                   NRTAEGISNQVFSSMYQVMRKGWNRSDVMEFLRAMEVSYSDTPLDVNIFRGEKVKALFG
FT                   SIPEPEKSDEVVEAFKTKKKIFIEKDKVYKAVFPILARKECLKCHTNAKGGEVLGVIET
FT                   RIDLSPIYDKLNKVLFLSLIFLLPLNGLLSFWASKHIIEVVKSFAKNLENNINRIRNLE
FT                   DLKKISREMDVPYEELKHLYQSLYKLSEKVRQIAIDKDILELESRLLEKFIITSQLVND
FT                   WKEYIKALVNDINEVVNVDVVFSIFIENSFLDTEVFWLKEPTEDQKKVFEQSLEKEIIS
FT                   RLPISVVGNRTLVINHNVVRKNERFNNVSPDRFKIRTKTLLLDKPQLGGIVGIGIESEL
FT                   AEDPYKRAVLDSVLATLVNVIGSAKAISSYVNEIEFYAMRDPLTFLYNQRTFWELLNYE
FT                   LERANRFERSLSLLLLDLDNFKVINDTYGHAVGDRVLREVARIISEKKRKADVAARYGG
FT                   DEFAVIVIGANSNQALNLARRLKDAIESLSIPVSESETVSPRVSIGIASYPEHALTSRD
FT                   LFIIADSMLRKAKEEGRSKIRVPTIEDLQMSRVELTKKSMLVLDALNKRLIKPFFQPIV
FT                   ELKSGELFANEVLMRIGKENIPASEFIEAAENLGVIVRMDLILYEETLKKLVEEQYDKY
FT                   VFMNLSSRALTSEDFLKNILRIVENSGFDPAKIVFELTERESVKNIDLVKRFLEELKEV
FT                   GIKFAIDDFGSGYSSFHYLKKIPVDFVKIEGEFVKGALTDWRDKTFIESIVTLAKGMHI
FT                   RTVAEFIENEEIKEIMKEIGVDYGQGYYFGKPSPKPWV"
FT   gene            complement(245338..246288)
FT                   /locus_tag="aq_369"
FT   CDS_pept        complement(245338..246288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_369"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06657"
FT                   /db_xref="GOA:O66692"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="PDB:2YZS"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66692"
FT                   /protein_id="AAC06657.1"
FT                   /translation="MGRVYYINSHGTLSRHENTLRFENAEVKKDIPVEDVEEIFVFAEL
FT                   SLNTKLLNFLASKGIPLHFFNYYGYYTGTFYPRESSVSGHLLIKQVEHYLDAQKRLYLA
FT                   KSFVIGSILNLEYVYKISADTYLNKVKETNSIPELMSVEAEFRKLCYKKLEEVTGWELE
FT                   KRTKRPPQNPLNALISFGNSLTYAKVLGEIYKTQLNPTVSYLHEPSTKRFSLSLDVAEV
FT                   FKPIFVDNLIIRLIQENKIDKTHFSTELNMTFLNEIGRKVFLKAFNELLETTIFYPKLN
FT                   RKVSHRTLIKLELYKLIKHLLEEEVYLPLNYGGLK"
FT   gene            complement(246281..246814)
FT                   /locus_tag="aq_370"
FT   CDS_pept        complement(246281..246814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_370"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06658"
FT                   /db_xref="GOA:O66693"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:O66693"
FT                   /protein_id="AAC06658.1"
FT                   /translation="MKMTISYEEITNLKFTGTQVAYYVICKRKLWLFSKGLSYESESEF
FT                   VELGKLLDERAFKREKEEVEWGENPVKIDFLTGEEGLVVHEVKHSPKLEEAHVLQVKYY
FT                   LWFLEKSGVKVSHGIIHYPKQRKVLRVELTQEDRKVIVEALENIQKVLLEEKPPEVIKK
FT                   PYCKKCAYYEFCYG"
FT   gene            complement(246792..248981)
FT                   /locus_tag="aq_371"
FT   CDS_pept        complement(246792..248981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_371"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_371"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06651"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:O66694"
FT                   /protein_id="AAC06651.1"
FT                   /translation="MRENLRELLKKAWAKSDGTTIREHTDTLLKNLSILKNLFGEKIEE
FT                   ACPEDFRELLWKALELSCEYHDYGKLHCFFQKKVGNKNWKVLKGIPEVRHNLLSPAFVE
FT                   CEDENLKLLVQKVVLHHHEVPDQFEKAKEVLIKEFGFSEGKAKELDKLIGEEERFLERI
FT                   ALKKFKKRNSESLKKFYTLVKGLLLRIDHASSNKHLSEMEKGKLENPEKNVKDYLRKKG
FT                   AQLNELQNYVLENREECLVVVAPTGYGKTEAGFIFLKDKGFFTLPFRVSANGIYERARA
FT                   VFGENVGLLHSSSLIELMKKEEDELDTNTFEGIWKNYQHSKSFAYPLTVCTPDQIMPFV
FT                   FKFSGYEKYLALLSYSRIVIDELQVYAPYTMAFIVKALEVIKDFGSKFMVMTATFPEFL
FT                   RRFFEKMEIPFKEFPELKPRHNVKLLEDTLGSESSINLIRSLSEEGKVLVIVNTVRKAQ
FT                   ELSLLLNAPVLHSRFLQKHRAKKEEEIKEFFSSGEKGVWVTTQLAEVSLDLDADFLVTE
FT                   LSTIDSLIQRMGRCNRKGIKDIENPNVYVFTQEPSGKGSVYPKELLELTRKALTEGIWE
FT                   YDVKERAIKEVFGENIKKTKYYDQFKSALEYVEGFWRGSISLKESRHDAVQKFRDILSL
FT                   NVIPYQFREEVLKVYKKWRESSDILERVLAFNELQSYTFSYPYSEKLLREGKIKKASEL
FT                   QELNVFWIKGDYDENLGFRISKEEDPEVIEDDNIL"
FT   gene            complement(248932..250527)
FT                   /locus_tag="aq_372"
FT   CDS_pept        complement(248932..250527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_372"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_372"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06652"
FT                   /db_xref="InterPro:IPR010180"
FT                   /db_xref="InterPro:IPR019121"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66695"
FT                   /protein_id="AAC06652.1"
FT                   /translation="MGVKFYIDNWLTASSGVGLIEVLQDAEVEYKDLVKDSRKLELPEE
FT                   LFEKLPELYADFLTKGIDLTMKEQILKSKKLSIETLKNRLENPYTFINGYDIIKSFYRN
FT                   SIFANNNPYKDIIKQENSKLLNSILNDIHRKEDMDYESIIDVLENKGYFENIRNVIKYY
FT                   LIETLKLIISNQEDKNAPLCFFCRERHTYVYKGKYRVFGAEHFTPLSASEDTLPNLFWN
FT                   GRNKMYLCPYCEFYLFFAAFGFTKVGNNRFLFVYIPDDLDSLISINSQLKSKEKVEKNI
FT                   LGELFRVVKFLRNVETQKARWILENIYFVEIEKVSEATANIYSFSISPRLAKVLKNYID
FT                   KYPPNFESVFPKFVEYVYSGRSLYEFLFKILSGFFFPKRYQNPKGYDADLIKKGMSFKE
FT                   FLPKKLLYFIKFQEELIMGESFEKQINFAYREGLNLKKMYEKELGKEKAKDRIKTLSYR
FT                   ILEAVRRKDLDAFEQNLIRAYMQVEREIPYIFVQALKDENFNRIVYAFLIGLNGRDWSE
FT                   GEPEGTSEESLGQE"
FT   gene            complement(250518..251177)
FT                   /locus_tag="aq_373"
FT   CDS_pept        complement(250518..251177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_373"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_373"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06653"
FT                   /db_xref="GOA:O66696"
FT                   /db_xref="InterPro:IPR013337"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:O66696"
FT                   /protein_id="AAC06653.1"
FT                   /translation="MECLKAEFFSPIALFKTPFSIKGIETYPLPPYSTVIGLLYTASGK
FT                   KWKGERFNISVQGDYEAIFRDYVRFRKYNKKDKKLETLPLEVPLFYNFRLTVHILGDEN
FT                   LLKEFEKALKFPYVFPYLSGGEYPVKITKVKMVACRKEYFDTFNIPKNAYIPENIFTEE
FT                   FRVSLEGHGVYYRVPSFLISQKPRQHEWVGVYYVQKGTKVSEMELLVDEEGEPVWV"
FT   gene            complement(251158..252231)
FT                   /locus_tag="aq_374"
FT   CDS_pept        complement(251158..252231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_374"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_374"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06654"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="InterPro:IPR013414"
FT                   /db_xref="UniProtKB/TrEMBL:O66697"
FT                   /protein_id="AAC06654.1"
FT                   /translation="MAKALTLTIITSKASSLNYGETIGNVSVLKKVSLGDGSQITYVSD
FT                   KALKYEIRRKGKEEKGWKLLDKLIKEYIQNEGRIVIKERESEEKKKKKKKIRVYDVDSL
FT                   GIDLVKNFEEFDLFGGLFTKIIVNGKEVKKLKKDKISEEDIYYPEEYDSVKRTSPVKVT
FT                   YAFSISKFQGDLDFMNNIDAYNRYIKHVGEAEEQRIVQTEQHTSHYYYTLTVDLDRVGV
FT                   WEKEEGVEEVLSNEEKAKRVKDLLDIILTLSRQIKGRWENLSPVFVIGGVFSVKNPFFE
FT                   DGILAKEVDNQLLLNVQRLKDCAELVPEGEEILCGIRSGVFANEEEIRQELNAKSVKEV
FT                   FEELKKRVEEVYGVSKS"
FT   gene            complement(252309..253250)
FT                   /locus_tag="aq_376"
FT   CDS_pept        complement(252309..253250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_376"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_376"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06659"
FT                   /db_xref="GOA:O66698"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66698"
FT                   /protein_id="AAC06659.1"
FT                   /translation="MEGIKVLAKQFGKIKTPQGLAVAIALITAIAWFPDGLAGFLPSLK
FT                   SNPFQAIIGAILTILGLSIIFFLHKKLRRGQKDSIIAEFGFIVLTLIFSLIVFNDFAIT
FT                   QFITSSLVFFSAWLHVREMEIVDYTVREVRPSNVKATVIFLSSAKYDEKFKKLMEKVEE
FT                   IPTINDFFDFLEKEKMRLPWEMQLRLINEFSRSLKYVYVIGSVNSSSGSFEQIEDFKLI
FT                   VNKFFPQIEVIKYREGLDFENLEKNFGVLKEIYSELKTKGLKEREIIIDTTGGQKIQSI
FT                   AGALYSTAYDRFFAYVSTNSKSVKVFDVVPTE"
FT   gene            complement(253252..253587)
FT                   /locus_tag="aq_377"
FT   CDS_pept        complement(253252..253587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_377"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_377"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06660"
FT                   /db_xref="InterPro:IPR013409"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66699"
FT                   /protein_id="AAC06660.1"
FT                   /translation="MNEILKTEDEVVRWSVKKINDDTTLIEFELKRDLVPEDLKKINPP
FT                   DAVKNKFANTFIVLSGRGPIWLYGFLIHFYHPTKGIGVFDPRLGGAVVVSSHSPNKKVG
FT                   DVIKWEG"
FT   gene            complement(253592..254953)
FT                   /locus_tag="aq_378"
FT   CDS_pept        complement(253592..254953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_378"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06670"
FT                   /db_xref="InterPro:IPR010171"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="InterPro:IPR027419"
FT                   /db_xref="UniProtKB/TrEMBL:O66700"
FT                   /protein_id="AAC06670.1"
FT                   /translation="MKKVVIAPWGDPTNWQRVKYSYNDHEDKYPSATGIIIKAEKPDSV
FT                   ILVCPDSLAEKRIPYKEIKIQCSGNLSDKTQGNLPFENYEEIKSKVENKIKDFFSKNIN
FT                   FHKKPDVIISYSFGSYNTLEFEGQAEDFFAGVLKGLVYKFTEYLEKGIPEKIEIILDVS
FT                   HGINYTTVMTYEAVRTLAQLLAYFTEVSLKVLNADPVIGRNIQKPLRINEIEYYSSIFP
FT                   NLVVYRIKKEDKECEQILEAYDDSINEIGDNMKLEREHIFLSAIIHGTPLYILTYMPSS
FT                   KDLKAKIDNAAGYYEKNIIIENEIGEKKIKVKRKLRFTENYITMLKAYFLSFILEKKGF
FT                   SKKEEVLLEDINKLNEMIFREFPVLKHRISKETNNINERRDNIPEDFLIYREINRRGNR
FT                   DFEERNFFAHAGFEYNSVMLKKDDKDIILKVNEQNKEKIENALKEAIQSLLLRR"
FT   gene            complement(254950..256071)
FT                   /locus_tag="aq_380"
FT   CDS_pept        complement(254950..256071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_380"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_380"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06661"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:O66701"
FT                   /protein_id="AAC06661.1"
FT                   /translation="MANTIVVGELIFGTGYFSTGKLEVGKEKGKETDNKKNFIHKALKK
FT                   VDFLEEFESLNLLLNKYIPIPCGDIVTIKNNNEKLWLKDGTINEELKKIFLEEIIKDDN
FT                   FGKLKEKLKNFSEILKRKNREIAQSLLNQGYVNVFNEDEFLKLKTAERLIVGLGTTHVF
FT                   ETGLALHHLFGIPYIPSSSLKGIVRMAHFWEIVEENIKNIKEDKKDDVIKRLQEKLQKG
FT                   DIRKEQNKEFLIHMLLFGTQKFKGLLTFLDAYPMIDESNKNKIFDLDLINVHYKSYYTQ
FT                   NKPPGDWENPNPVYFLTVSKGIEFHFWVLFDSYRAEKLKKYNDFENVINELLDNNYENL
FT                   RNKLKELLEDTLTLYGVGAKTRLDYGIFDGGNK"
FT   gene            complement(256087..256986)
FT                   /locus_tag="aq_381"
FT   CDS_pept        complement(256087..256986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_381"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_381"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06662"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:O66702"
FT                   /protein_id="AAC06662.1"
FT                   /translation="MYEYGQLLTLYAVTPIHIGSGQSISFIDLPIQRERHTGFPILRSN
FT                   GIKGALRSVAERVWKDKAKVETVFGPEDDASKFAGCVSITDARILFYPVRSVRGVFAWI
FT                   TSPIVLRRFQEDLRSIGKEINIKVLKNGKEVPSNLNLEENEAILFSDGLIKDGKLFLEE
FT                   FAFNPILNAPENVDWDFFNTIIPSDELVGLLRTHLVIVSDNVFRDLVNYAVEVRTRIRI
FT                   NQATGTVERGALFTEEFIPSESIFYSLLNISEPHNKEVFEKAEKVREEVKDLINRCKII
FT                   QVGGDESLGKGFIRLNLC"
FT   gene            complement(257019..257906)
FT                   /locus_tag="aq_382"
FT   CDS_pept        complement(257019..257906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_382"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_382"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06663"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR007522"
FT                   /db_xref="UniProtKB/TrEMBL:O66703"
FT                   /protein_id="AAC06663.1"
FT                   /translation="MKKEHQKTLTFEIITPVVMAGTYKDEPELRIPSIKGMLRWWFRFF
FT                   YASHNQSIDKLREHENEIFGSTEKACQFYMHLKYSQKLTDAYLAMNKRYGRYNNIKRKA
FT                   LEKNDTFRIDFIYSPFFTYKKELNTTLQLLSFLGGIGARWRRGFGSIQLKNGEDYKSFD
FT                   KLKEKIEKVLKGKGEYHHDGFININNVDIYLVKPKRDNFWIDSLGAMNNLRKKVYKEFK
FT                   SETNIKAIACKPKGGSRAVSPLIIQIKKFSEGKFYGILIVYNEWDKYEEFKNFINNNSE
FT                   LSFEQLLKSKPRKI"
FT   gene            complement(257872..258615)
FT                   /locus_tag="aq_383"
FT   CDS_pept        complement(257872..258615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_383"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_383"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06664"
FT                   /db_xref="GOA:O66704"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:O66704"
FT                   /protein_id="AAC06664.1"
FT                   /translation="MRFLIKMENLKEEPAKVRLDYRSRFISLLKSVLGEEYYSNHKIKP
FT                   FTFAVFFGKEAKISNGYIENVRTINFRFSSGDFLTIAKFYNGILQLKKNQYIHPIGTGK
FT                   FKIIDFRPEKEREIIGFFKTLSPIVIERIGSKPKDSPEERYITPDEESFEESLVENIYR
FT                   RYIAIMGSEPQFSKFKFIPVKVKKEYVRHYGGIVKTFIGKFKIETDSKDLLEFIYKYGL
FT                   GVRTGQGFGYLEVEDEKRTSKNINI"
FT   gene            complement(258857..259258)
FT                   /locus_tag="aq_384"
FT   CDS_pept        complement(258857..259258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_384"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_384"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06665"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:O66705"
FT                   /protein_id="AAC06665.1"
FT                   /translation="MQTRIQKVVKFAYGCVNEVKGREQIEEKYASYVRKLPSMIIHNGL
FT                   LPTVAFIRSKAGIDAQNKLSPEKEAWKKIENHIKNYLIKIENVEVPDSLTRLFAEMDFS
FT                   RYRLYTQKILFFTQWLKRVAEGELKSEEE"
FT   gene            complement(259248..260135)
FT                   /locus_tag="aq_385"
FT   CDS_pept        complement(259248..260135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_385"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_385"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06666"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:O66706"
FT                   /protein_id="AAC06666.1"
FT                   /translation="MRRETYFIKAITPLHIGTGQGLTHIDLPIAREVHTGFPFIPGSAI
FT                   KGCLREYHIKKVARNTELTASMIDEILQEGEIRGNLNDKEKKYLKMLIDIFGTAGEGSE
FT                   ESSASAGKVIFTDARLFLFPVRSTNGVFQLVTCPYVINRYLEDTGEKECFCLDLPDDTA
FT                   VVYFDRYPNIDEVMLEEFTLRKQRNKKFEEIISRIPLESYQKERVLCVSDSVFSYMVKN
FT                   YTEIQTHIKINRDSGTVESGALWTEEYLPAESVLYFNLFYEKQNLNLEVPEFFHLGGDI
FT                   TTGKGLVRRLGNAN"
FT   gene            complement(260132..261109)
FT                   /locus_tag="aq_386"
FT   CDS_pept        complement(260132..261109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_386"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_386"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06667"
FT                   /db_xref="InterPro:IPR010165"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:O66707"
FT                   /protein_id="AAC06667.1"
FT                   /translation="MKIYLFKPYDVIGFGGLKNFSAGETHIQKSIFPPPIMRFFHIFNS
FT                   VYGVFLYKDGNLFLPVPSDCLVKRKEESGKAKISPLEFPPLIRGDLEAYERANGFISFS
FT                   DLMNKYAKNIDGFKIYLLEEFLKKESRVGITLDKERRVVRSIKEINRKEEKGLLYSQDF
FT                   FRFNDGVKLAVLGEINKDIVISGKQYFRLGGEGKIVSFKHTEHINSFLEGKIKIKNGNY
FT                   YKFYCLTHAYINNGIIESKIQTICIEGINFEVEWLYNGGVEYVSGYNKPFLEMLRPGSV
FT                   LILKAKNEGEIQRLNQISTNVPISNIKNFLNRGWNSGIIVEGVK"
FT   gene            complement(261090..262955)
FT                   /locus_tag="aq_387"
FT   CDS_pept        complement(261090..262955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_387"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_387"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06668"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:O66708"
FT                   /protein_id="AAC06668.1"
FT                   /translation="MKLLVFTFSPVQGFIEKSRKLRDFFNSSLILSYITKKLIEKLKED
FT                   PDVEIIYPAIKEHDSEKLLMNYPNRLVAKFEKDKNYCEELKNQFSKIWEEIYTYIADKI
FT                   KIPESVKATFKSHNKHYFTYFCEIQEEVDREEWMTELKVNEETLKKFKINQENPYGFTY
FT                   DLLERKLGARKTFRPYYGRVDENKKVHGCTLCGERPALDLNWEELRKNLPPYHLDDSER
FT                   LCGVCLTKRFFHFYLKEKEGIKDLAKFHSTRHFALAPLIKKVEKDKLSEEEKEILREIL
FT                   SMYTNNQINDGNLKELIYNNIDELTYKRVKALVRKRLDKIPDKDKEVRLKEFEKKFKNS
FT                   YFSILMADGDEMGKWLGLKPEKRKVELTENFHKKFSEALFKFAQKITKIEDNICLKFVY
FT                   LGGDDVLAVAHPSVILKAAKIIRKRFSEILKKELKPSNIKEDPTMSAGLVIAHEKENLA
FT                   FVLEHLRTAERRAKNEGRNRLCISVIPHNSYPRELVLKWDNLENFIKLIEYFKSEKLSS
FT                   RIPYYLRKELEIFIINEESVVNMKDIALSVIKRILKRQISKNQNDKKLNEYEYYSLITQ
FT                   IEDLINERIKETGSLKNALEYVLNTFYIARFIANMEGLKHENIPV"
FT   gene            263585..264490
FT                   /locus_tag="aq_388"
FT   CDS_pept        263585..264490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_388"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_388"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06669"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66709"
FT                   /protein_id="AAC06669.1"
FT                   /translation="MELRRIEGILLEQSLLSSKGQEVVKTARNLEIKITSQIPEVYKTL
FT                   LNLTKVKAKVLRNRGNVITLLLDNGIEINAKNEMSVSLREGQSVVLTLVRENPLTFKLE
FT                   EGKFVKNTTLEVLRKGLKNLKKFDFSQIENYENFKNSGIFYENKVLKAIIKNSIDDLKV
FT                   DLKYKALIKQDKEILEFINFLQMYALENPRSILLPFKLQDFEGFLSIKVKEFYEVFVHI
FT                   NTEKYSLNISFFVEKNLNFSEVEISSNSEEVLQRLESLKDDIRKIFNVPIRSFNFLLKE
FT                   NVKEEVLREILKEGGLDLKV"
FT   gene            265099..265647
FT                   /locus_tag="aq_389"
FT   CDS_pept        265099..265647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_389"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06687"
FT                   /db_xref="GOA:O66710"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:O66710"
FT                   /protein_id="AAC06687.1"
FT                   /translation="MPTERLAIIATKGTLDMAYPPLILASVAASLGVETAVFFTFYGLN
FT                   IIHKEKVKQLKLAPIGNPAMPMVFPDSVKQTPVVGQLAGLMESIFPGPPQIMGIIPGMT
FT                   NFMTAMMKKRLKEKGVASIEELLELCKEADVKLIPCQMTMDLFGYKREDLIDGLEPPAG
FT                   ATEFFNYVLAADKPMIIFV"
FT   gene            265667..266092
FT                   /locus_tag="aq_390"
FT   CDS_pept        265667..266092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_390"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_390"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06676"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:O66711"
FT                   /protein_id="AAC06676.1"
FT                   /translation="MAGQEFEKLLFYIVTVPFFVRAEPTTGELINPQAGAPFFLATAAT
FT                   TMDYEVEMVITSEAGYLLMRDNAKKVKVRPGVEQTVYDFIKMAKDAGVKIYLCTPSLDL
FT                   TDIYKEEDVNKEICDGILGGAAFLDKLMSGEYAVITL"
FT   gene            266219..266971
FT                   /locus_tag="aq_391"
FT   CDS_pept        266219..266971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_391"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_391"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06677"
FT                   /db_xref="GOA:O66712"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:O66712"
FT                   /protein_id="AAC06677.1"
FT                   /translation="MAEQTQVRKYGYNIPISEKTLQVPWEEKVRVIEEVKSDFRFKEYL
FT                   FGCLNCGVCTASCPSNRFFDYSPREIVQRFLENDIDVLYDMMHEYIWACSQCFTCWIRC
FT                   PFVNNPGGLVIIMREVAVRNAFEATKDLLKPYGRVLLKVMTTGNQLSADMLQPDFFPDW
FT                   GPKMLDNMENLRPKRMAIPFDVGKSVKTAWEVSLQTAIEMYQIWRDTGIFEMLERLDPN
FT                   LYNVIMDIVEENEERWEELMEEMEEAEA"
FT   gene            267030..267698
FT                   /locus_tag="aq_392"
FT   CDS_pept        267030..267698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_392"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_392"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06678"
FT                   /db_xref="UniProtKB/TrEMBL:O66713"
FT                   /protein_id="AAC06678.1"
FT                   /translation="MAHKSKSPYLMYPEKEPFPILNKHSHYDHLFEEMYELEEKGEILV
FT                   FRITEEYRPKYVYTRTGRIKVIPTNKLWHHKSCGQCGNIPGYPASIFWFMNKFGLDYLN
FT                   EPHQTSCTAWNYHGSGTSNPVALAAVWLRNMHQAWKTGYYPLIHCGTSFGSYKETREQL
FT                   IFNKELREAVKPILKKLGRLTEDGRIVIPQEIVHYSEWVHAMRDGNSRPLRKRKESPKE
FT                   "
FT   gene            267846..268373
FT                   /locus_tag="aq_394"
FT   CDS_pept        267846..268373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_394"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_394"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06679"
FT                   /db_xref="UniProtKB/TrEMBL:O66714"
FT                   /protein_id="AAC06679.1"
FT                   /translation="MTTQPGTTAVGFGFRHILTEREFTRSFAIQRKLKVIAEEIKADVI
FT                   ITHDTGCTTTFEKNQWIGKAHGMYYPVAVMSDVMFSALACGAHPFKVVQLYWNCSNYEP
FT                   LLEKMGITNWRELKKEWEDTVKYIAELEKQGKYDELLEFFKEYDLYEPYSKTSDGFKLR
FT                   KSATADLPLFKS"
FT   gene            268431..269489
FT                   /gene="hdrA"
FT                   /locus_tag="aq_395"
FT   CDS_pept        268431..269489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrA"
FT                   /locus_tag="aq_395"
FT                   /product="heterodisulfide reductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:aq_395"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06671"
FT                   /db_xref="GOA:O66715"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66715"
FT                   /protein_id="AAC06671.1"
FT                   /translation="MAKSVLVIGGGPAGLAAARTLGKLGIPTILVEKEGKLGGRPILEE
FT                   YHTLIPRKMKPQQVLGPFIEEVQNNPNIEVKLNTEIEACEGEAPNFKVKLSNGETVEVG
FT                   AIVVATGFQHFDAKRKGELGYGIYPDVITNLELEQMFSREGKLYRPSNGELPKRVAFVF
FT                   CVGSRDRQLGVTNVHCCRYGCALSGLQGSEIREKYPEVEVFCYYMDVRTYGTWEYPFYW
FT                   EPQEKYGVRYVRGRIAEITYSPKDGRLRVKHEDTIVQRPAEIPMDLVVLVLGMEPSEGT
FT                   KKVAKILGLAQDPDSQFLIPAEDSGSNIISNRPGVFIAGACKGPIDIESSLAEGEAAGA
FT                   EAATFLGAKVSV"
FT   gene            269486..270304
FT                   /locus_tag="aq_397"
FT   CDS_pept        269486..270304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_397"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_397"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06680"
FT                   /db_xref="UniProtKB/TrEMBL:O66716"
FT                   /protein_id="AAC06680.1"
FT                   /translation="MSERQNTGGFKAASLDEALIRDYLIKILSEGEEFLQDFYQDVKAK
FT                   SEFFQKKLSKDNIKKLTEKDLEEILDKIFAARRKKKRIIEETGVENLKEAIKKLLYGEE
FT                   GGFLGLGKKEDKRTWEEKVEEFARSIRGVDKRAAKDIAAELLHFTFPDKYILWTSWVWD
FT                   PETETGAIVFLKEEPPTGGKGRKMYGETYEQFEQVYKQIMEKLHEFGVKVKDYLFVDIF
FT                   LAMIYATYVDYMTLSTMHSAKGFFPPAGVMARRLLGVHAPIRYTDVEEVS"
FT   gene            270319..271080
FT                   /gene="hdrC"
FT                   /locus_tag="aq_398"
FT   CDS_pept        270319..271080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrC"
FT                   /locus_tag="aq_398"
FT                   /product="heterodisulfide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:aq_398"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06673"
FT                   /db_xref="GOA:O66717"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:O66717"
FT                   /protein_id="AAC06673.1"
FT                   /translation="MAIHERSLVEPERILRKDRLVIDGIDVSGDWNLIILPRTIEDYDL
FT                   SLLDEILQQPEGKTILQCYQCSYCTASCPVHNYWDERYNPRHFIYLARLGLVDELQKRA
FT                   DVMWRCVSCHKCTHRCPKGVLVEEVLKAILKVLSKRGLIEEYPSKKFDKFFLEQVYEYG
FT                   RIEDGDLLFGWIEKQGYKVFKDPILKKPIPLFGEIPEWLKTLAIKPIKNMNIDFLILNA
FT                   KHMLIHPRTKNWSKMKQVLKKVFEEEGVTLH"
FT   gene            271093..272088
FT                   /gene="hdrB"
FT                   /locus_tag="aq_400"
FT   CDS_pept        271093..272088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrB"
FT                   /locus_tag="aq_400"
FT                   /product="heterodisulfide reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:aq_400"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06672"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:O66718"
FT                   /protein_id="AAC06672.1"
FT                   /translation="MAVPVQFRKPPMGGIGKKVAYYPGCSLEGAARAYDVSTRIVAKEL
FT                   GLELDYLEDYNCCGAMETKNVSFWGTMLLNARNMSLARRQGHNVIVAPCNGCSFSLQRV
FT                   EYFLETDKNTLDRINQLLQEAGEKPLDNIPHTYHILEWFYHEAGPEKVKEKTKKPLRGL
FT                   KVASYYGCLYTRPHFYARTYSHLAPEDEEQARPRKRETADDDEHPYYMEALLEAAGATS
FT                   VEIEPMHTQCCGGPHSLSDEEVSEKFVMMILQTAKRNGADIIATECPLCHASLEMYRHR
FT                   LMLKGVPDVDVPAAYFTQLLGLAFGYSVNDVKLKDNLSDPIPVLKRLGLA"
FT   gene            272163..272570
FT                   /locus_tag="aq_401"
FT   CDS_pept        272163..272570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_401"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_401"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06681"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:O66719"
FT                   /protein_id="AAC06681.1"
FT                   /translation="MLEKELKIVILMTSGPKTPWRCATPFYIATLMAAQEADVEIFFNM
FT                   DGTNLIKKGVAEKICPSLEGNCFSANGQKPKTVYDFMKDAKLAGVKFYSCKQAVDSMGL
FT                   TEEDLIPELDGIVPASEFALRAMMADKLITF"
FT   gene            272598..273044
FT                   /locus_tag="aq_402"
FT   CDS_pept        272598..273044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_402"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_402"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06682"
FT                   /db_xref="GOA:O66720"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66720"
FT                   /protein_id="AAC06682.1"
FT                   /translation="MAEVNGCQLPEDRLYYINPDKNAFIWAKEEDGVFTIGLTSVAAAM
FT                   AGRLVAYTPKKVGKAVKKDKSVATIESGKWVGPVPSPFDGEIVEVNEALKGNPALVNDD
FT                   PYGQGWIAKVKPANPEEAKSVLVDANKAAELLQPIVQEKGVKCG"
FT   gene            273087..274112
FT                   /locus_tag="aq_403"
FT   CDS_pept        273087..274112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_403"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_403"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06683"
FT                   /db_xref="GOA:O66721"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:O66721"
FT                   /protein_id="AAC06683.1"
FT                   /translation="MNVFGVIQELDVELNEKLVEKLIEGFEIRKKNFGDKVFFYSPGFK
FT                   HYEVEDFSVNSPPKFVDISVTGRNCELMCDHCASKILWHMIPATTPEELVKVGEDLKKK
FT                   GIEGVLISGGSDKNGFVPLWDFFDAMKYLKEELGFLLTCHVGLVDEDYVEKLKEANVDA
FT                   VLLDIIGDNETIAQVYKLPHKSVEDYDRSLRLLKEAGLRIVPHVIIGLHYGKIKGEYNA
FT                   IDMIAKYEPDALVLVVVMPYYGKAKFQLLPPPSSEESAQVILYARKAVPNSPVVIGCAR
FT                   PAGADRVKLDAYSVLAGVNGIAFPAEGIVTYSKSLGLEPVVSPNCCSTVYSMVFQTMET
FT                   Q"
FT   gene            274129..275271
FT                   /locus_tag="aq_404"
FT   CDS_pept        274129..275271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_404"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06688"
FT                   /db_xref="GOA:O66722"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66722"
FT                   /protein_id="AAC06688.1"
FT                   /translation="MKLGVLGSTGSVGSQTLQVYENFRDEIELVGILANRASEKLLQQA
FT                   KKYKPKYVVSYQEPAKEWLESLPEGVKYLKGDEGLKAIIEESERLMNAISGIYGIKPAY
FT                   EVIKAGKTLLASNKESILCLGEIIRKNRERVIPVDSEHNALFQLLSSVKREEVKHVYLT
FT                   ASGGPFKDKSLEELKTASVEEALRHPRWNMGAKITIDSATLMNKGFEMLEAHFLFDFPI
FT                   ENIKVVIHPQSFVHGILELIDNSFLMHTSQTDMKIPIMHALFYPKRKEYPFKKVSLLEL
FT                   SPITFEKVDTTKFKAIDLAKWAGFMGGVYIPVLVGADEEAVNLFLNKKIGFLDIVDLIE
FT                   QALSEVNIKDPQSVEEILEAVEWGRQKVREIYERKYAGKG"
FT   gene            complement(275231..276100)
FT                   /locus_tag="aq_406"
FT   CDS_pept        complement(275231..276100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_406"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_406"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06684"
FT                   /db_xref="GOA:O66723"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:O66723"
FT                   /protein_id="AAC06684.1"
FT                   /translation="MKIFLSLFISLLFLSLIFYFLPLNELLISLKSIKTETLILSFLLY
FT                   SLSQFTRSVRWSLLLSLPLKESFFLNSANLFLNNVLPARSGELSWFYYAKKLGINFKYS
FT                   LWSFTIGRLYDLLALIFVVFISYLLAKEGTFFALLGLFVGFFLALLIPFLVNLIPEIWK
FT                   LTDLKNFLRRELSVKLSLYLFTLSGISFFLKALSTYILVESLVRLNLFEYTLGFLGGEL
FT                   SSILPLHSFMGYGTYEAGFLLPLKLLGLEVKEGLKIGFIVHNFLLLSSAFWGVLSILYL
FT                   HTFSRKSP"
FT   gene            complement(276097..276708)
FT                   /locus_tag="aq_407"
FT   CDS_pept        complement(276097..276708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_407"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_407"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06685"
FT                   /db_xref="GOA:O66724"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66724"
FT                   /protein_id="AAC06685.1"
FT                   /translation="MRYDVVIVGGGPAGLACALTLASSQGRGWEWAEGKKFLVIDNGRS
FT                   DLNKAMLNNVPGIPMGTLGPELLEKIREQIKATNDSVEFLEDTVTKVEGEKGNFKVHTQ
FT                   SGKVFEAEYVVLASGFHKFEIECEGVEVVDNPKSPKPGRVMVKHDGDYKVREGLFVAGL
FT                   LAGVSSMYTAAAGSGVQVAINILSEWAGKPIVIHDVPKEK"
FT   gene            complement(276724..277248)
FT                   /locus_tag="aq_408"
FT   CDS_pept        complement(276724..277248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_408"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_408"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06686"
FT                   /db_xref="InterPro:IPR025529"
FT                   /db_xref="UniProtKB/TrEMBL:O66725"
FT                   /protein_id="AAC06686.1"
FT                   /translation="MDLAKFIFSILFNKNKRDKLDQALKRIEKEFGEIEEVSKEFYFPF
FT                   LENYYGREMGKPLKKIYLSLKGLKNKEELVEVKLKAMELEEELSEEGKRSVNLDPGYLD
FT                   ESQLILASHKRRGARVYLGSGIYAEIELLFVYRDFRPIYWTYRDYRHPEVREFFRRVRK
FT                   RFLKERKAFSG"
FT   gene            complement(277239..278114)
FT                   /gene="pyrB"
FT                   /locus_tag="aq_409"
FT   CDS_pept        complement(277239..278114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="aq_409"
FT                   /product="aspartate carbamoyltransferase catalytic chain"
FT                   /db_xref="EnsemblGenomes-Gn:aq_409"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06675"
FT                   /db_xref="GOA:O66726"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="PDB:3D6N"
FT                   /db_xref="PDB:4BJH"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66726"
FT                   /protein_id="AAC06675.1"
FT                   /translation="MRSLISSLDLTREEVEEILKYAKEFKEGKEETIKASAVLFFSEPS
FT                   TRTRLSFEKAARELGIETYLVSGSESSTVKGESFFDTLKTFEGLGFDYVVFRVPFVFFP
FT                   YKEIVKSLNLRLVNAGDGTHQHPSQGLIDFFTIKEHFGEVKDLRVLYVGDIKHSRVFRS
FT                   GAPLLNMFGAKIGVCGPKTLIPRDVEVFKVDVFDDVDKGIDWADVVIWLRLQKERQKEN
FT                   YIPSESSYFKQFGLTKERFEKVKLYMHPGPVNRNVDIDHELVYTEKSLIQEQVKNGIPV
FT                   RKAIYKFLWT"
FT   gene            complement(278111..279226)
FT                   /gene="carA"
FT                   /locus_tag="aq_410"
FT   CDS_pept        complement(278111..279226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="aq_410"
FT                   /product="carbamoyl phosphate synthetase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_410"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06674"
FT                   /db_xref="GOA:O66727"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66727"
FT                   /protein_id="AAC06674.1"
FT                   /translation="MRKTAILALEDGSYFVGYSFGAEGETGGELVFNTSMTGYQEILTD
FT                   PSYKGQIVVMTYTQIGNYGVNDEDIESKSVQVNGFVVKEAFFRYSNWRAKKSLDEYLKE
FT                   NNVVGIYGIDTRALVKKIREKGSMKGVISTVEKDPKKLVQKARELPDISEQNLVEEVSA
FT                   KDIYYWNQGDYDPRRGFLYRENEKPLVAVIDFGVKFNILRRLVSEGAKVVVVPPENAKE
FT                   AIEKINPDAIFLSNGPGDPERVISGIRLTREYMEKKPIMGICLGCQIIGLALGGKTYKL
FT                   KFGHHGGNHPVKDLRTGKIEITAQNHNFAIDPESLPEDVEVTHLNLLDNTVEGIKHKHL
FT                   PIFAVQYHPENSPGPHDSYYLFKEFVKMAQG"
FT   gene            279846..282320
FT                   /gene="pcnB1"
FT                   /locus_tag="aq_411"
FT   CDS_pept        279846..282320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB1"
FT                   /locus_tag="aq_411"
FT                   /product="poly A polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_411"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06692"
FT                   /db_xref="GOA:O66728"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="PDB:1VFG"
FT                   /db_xref="PDB:4WBY"
FT                   /db_xref="PDB:4WBZ"
FT                   /db_xref="PDB:4WC0"
FT                   /db_xref="PDB:4WC1"
FT                   /db_xref="PDB:4WC2"
FT                   /db_xref="PDB:4WC3"
FT                   /db_xref="PDB:4WC4"
FT                   /db_xref="PDB:4WC5"
FT                   /db_xref="PDB:4WC6"
FT                   /db_xref="PDB:4WC7"
FT                   /db_xref="PDB:4X0A"
FT                   /db_xref="PDB:4X0B"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66728"
FT                   /protein_id="AAC06692.1"
FT                   /translation="MVCPKVVILSEGADLDSLSAAYGVLKLYPDAYLLKPKHLSKKAGE
FT                   VFKKYRDKFRVIEDLPDCFELVLVDTHFLPEGLPRERIKRIIVYDHHPIGDVKEFEGKI
FT                   EKVGAATTLVVEEIKEKGIDINPRDATLLAFGIYEDTGNFTYEGTTPRDALALAFLLEK
FT                   GANLREIREVVMETYTPEQIEAVGKIVQSIEKVFINGRQISFATAVLERYQPDINTLLY
FT                   EIKDLKESDAFFVIIEAEGKTYVFGRSQSEDVDVGEILSHFGGGGHREAGAVKLENVSA
FT                   ERIKELIKAFLKRKYVKLKVRDIMNTPPFVLEEHVSVKDALTELSERGIANAPVINREG
FT                   KLVGIISKKALLKLVKLYPDEPIELFVNRDFYTLSPDAPVWEAEEILTKFGQKLIPVVE
FT                   DGTVVGVVTRLDILQAVKEDLEKLKEKRRKIKVPENIEEIAREVGQIAKEMGLRAYIVG
FT                   GVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFA
FT                   TARRETYPRPGAYPKVEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKD
FT                   KVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLIN
FT                   EIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEER
FT                   IDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYE
FT                   VYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKQGLKGKELGER
FT                   IEELKREIMNKI"
FT   gene            282323..283039
FT                   /gene="abcT7"
FT                   /locus_tag="aq_413"
FT   CDS_pept        282323..283039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT7"
FT                   /locus_tag="aq_413"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:aq_413"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06695"
FT                   /db_xref="GOA:O66729"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:O66729"
FT                   /protein_id="AAC06695.1"
FT                   /translation="MLEVREVEKSFKKKKVLKGGSLSVNKGEIVGLLGPNGAGKTTLFN
FT                   SIIGFISVDKGKVLLDGEDVTHLPPFKRAQKGLAFLPQEHTLFEDLTVLENLLIFLEFF
FT                   TDSKEEAITKAEALLEDFGLLELKDQKAYALSGGQKRRLEIARSLITTPKYVLLDEPFA
FT                   GLDPIIVSEIREIVKNLKNNGIGVLITDHNVRETIKMVDRVYIISEGKVLAHGKPEEVV
FT                   NNEAVRKTYLGVDFKL"
FT   gene            283036..284355
FT                   /locus_tag="aq_414"
FT   CDS_pept        283036..284355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_414"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_414"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06697"
FT                   /db_xref="GOA:O66730"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:O66730"
FT                   /protein_id="AAC06697.1"
FT                   /translation="MSVVIIGVGRYAREVLEIVTAITEVYVIEKPGEHIQKFVEEAKGL
FT                   EKVKFVFESATDVETWREKVNLSEVEAVISFLKLESTLEVAKLLREFFNYEGEIIYVAN
FT                   ERPENEELQKLKVDTVSIPNVLRVIFKNLLIGKGIIRYPVGIGLEKGEIVEITLTEYSP
FT                   LVYKRLRDIKIRKARVALVYRNGKLLLPRSNLRLQSGDRLLVVGEPSSVNVFIHTATEG
FT                   ISDFPLNWGSAGVYCSGNEKEFNYLKEKVKVREWLEDCEKIQEIENLGLIVLEKKESGF
FT                   LKKGSVDRAFEEFSVPSFHLKGTYPYEKVLASANTDAREVLLSTAVDIAVQFGSKLFIL
FT                   YVKPFEKMISEKEKEVIEGLKSFAERVRKITKINLELVIREGNPVRETLKFMDEESFNL
FT                   LLIGYKVGRTTKLFSPYSPHLIARKSKLSTLLVPEVVLEQ"
FT   gene            284327..285490
FT                   /gene="napA1"
FT                   /locus_tag="aq_415"
FT   CDS_pept        284327..285490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA1"
FT                   /locus_tag="aq_415"
FT                   /product="NA(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:aq_415"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06696"
FT                   /db_xref="GOA:O66731"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:O66731"
FT                   /protein_id="AAC06696.1"
FT                   /translation="MCRRLSLSSELFLIIVFLSAFLAPLFSRILRMPVPVGELIFGILI
FT                   GNFFVGIQVPEILNFLSDFGFLLLMFLAGLELDFNLIEKADKKQNAVYISYVLLIFLSA
FT                   FVFGILLGIGTAPAIILSLISLGLMVATLKDMSVLEEPFAKKVLLIGVFGEIISLLALT
FT                   LMEKLLHFHGFVSLIKELGVIFVFFFSFFLGFYLTRLLVWWYPEIVNRLTYEEDPSALG
FT                   IRLSLFLMFTSSIFAKLAGIESVLGAFMAGVVFSYFIREKKDLEEKLSSIGYGFLIPIF
FT                   FIKTGMGMEVAGLNLAILFKVFIFLAFMLFVRLIPSFVLLLAGFSLKDSFTAGLLLSYP
FT                   FTLMVAGIEIARRGGALDEETALALFLTAAFSSLVFPWSAKIILSRR"
FT   gene            285507..286553
FT                   /locus_tag="aq_416"
FT   CDS_pept        285507..286553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_416"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06702"
FT                   /db_xref="GOA:O66732"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66732"
FT                   /protein_id="AAC06702.1"
FT                   /translation="MEFVTNYTLEELKKRFTELGLEPYRAKQVFRWVYKKFVTDFEKMT
FT                   DLGKKHRELLKEHFAFHPLEKLDRVEAPDAVKYLFKTKDGHILETVLIKERDHYTLCVS
FT                   SQIGCAVGCTFCATALDGLKRNLSTAEIIDQYLQVQQDLGEEKIRNVVFMGMGEPLANY
FT                   ENVRKAVEIMVSPEGLDLSKRRITISTSGIVAQIKRMAQDPVMKEVNLAVSLNAVSQKK
FT                   REELMPLTKTNTLEELMEVLKNYPLPKYRRITLEYVLIKGVNDSPNDAERLAKLIGRHK
FT                   KKFKVNLIPFNPDPNLPYERPALTDIMKFQKVLWKYGISNFVRFSKGVEVFGACGQLRT
FT                   QRLQLQRV"
FT   gene            286550..287209
FT                   /gene="abcT6"
FT                   /locus_tag="aq_417"
FT   CDS_pept        286550..287209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT6"
FT                   /locus_tag="aq_417"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:aq_417"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06694"
FT                   /db_xref="GOA:O66733"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66733"
FT                   /protein_id="AAC06694.1"
FT                   /translation="MKVVELKNVKKIYPDGTIALKGVSLSVEEGEFLGVMGPSGSGKST
FT                   LLHLIGGLDKPSEGIVKVFGKEINHLDEDELAEMRKRKIAYVFQFYYLLEDFSVLENLT
FT                   LIGELAGIKNPKKKALELLDFLRLSHRINHKPYQLSGGEQQRVAIGRALMVEPKLILAD
FT                   EPTGNLDSKEGFRIFELFKELNEKGITFVVATHNDSLKPFFGRIINLRDGEIVTQR"
FT   gene            complement(287456..287857)
FT                   /gene="gspG"
FT                   /locus_tag="aq_418"
FT   CDS_pept        complement(287456..287857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="aq_418"
FT                   /product="general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:aq_418"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06691"
FT                   /db_xref="GOA:O66734"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:O66734"
FT                   /protein_id="AAC06691.1"
FT                   /translation="MRRGFTLIEVLVVLIILGLLAALIVPKLTGRVDEARIESTKLQLK
FT                   AVKNALEQFKLDNGFYPTTEQGLKALVEKPTTPPEPKNWKQYMEKVPKDAWGNDFIYVS
FT                   PAGNKPYELKSVGPDGIEGTEDDISVWDL"
FT   gene            complement(287857..288189)
FT                   /locus_tag="aq_419"
FT   CDS_pept        complement(287857..288189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_419"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_419"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06698"
FT                   /db_xref="GOA:O66735"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:O66735"
FT                   /protein_id="AAC06698.1"
FT                   /translation="MFEGFKEVTDKDFYKAVMMNPKPSVVVFTDPNNPANEQIKPILEK
FT                   YQKLYGDKIDFFYMDVTKNTSFEDFGIFNFPAILYFRDTMELDRHDFIPTEEMVEQAIK
FT                   RLLRMV"
FT   gene            complement(288189..288536)
FT                   /locus_tag="aq_420"
FT   CDS_pept        complement(288189..288536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_420"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_420"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06699"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66736"
FT                   /protein_id="AAC06699.1"
FT                   /translation="MKRFRKNNLELELIRELSEIDFYNISAPLNSKEFWKEWQEKFNRA
FT                   NLTRIALRNILRNKRLSPKEYRKVKNSIKKYEDIINYLNALKLTALNARGSFGGYFIEF
FT                   DEDEEENEGGT"
FT   gene            288568..289689
FT                   /gene="aspC3"
FT                   /locus_tag="aq_421"
FT   CDS_pept        288568..289689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC3"
FT                   /locus_tag="aq_421"
FT                   /product="aminotransferase (AspC family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_421"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06689"
FT                   /db_xref="GOA:O66737"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:O66737"
FT                   /protein_id="AAC06689.1"
FT                   /translation="MDRLEKVSPFIVMDILAQAQKYEDVVHMEIGEPDLEPSPKVMEAL
FT                   ERAVKEKTFFYTPALGLWELRERISEFYRKKYSVEVSPERVIVTTGTSGAFLVAYAVTL
FT                   NAGEKIILPDPSYPCYKNFAYLLDAQPVFVNVDKETNYEVRKEMIEDIDAKALHISSPQ
FT                   NPTGTLYSPETLKELAEYCEEKGMYFISDEIYHGLVYEGREHTALEFSDRAIVINGFSK
FT                   YFCMPGFRIGWMIVPEELVRKAEIVIQNVFISAPTLSQYAALEAFDYEYLEKVRKTFEE
FT                   RRNFLYGELKKLFKIDAKPQGAFYVWANISDYSTDSYEFALKLLREARVAVTPGVDFGK
FT                   NKTKEYIRFAYTRKIEELKEGVERIKKFLEKLS"
FT   gene            289705..290040
FT                   /gene="metG'"
FT                   /locus_tag="aq_422"
FT   CDS_pept        289705..290040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG'"
FT                   /locus_tag="aq_422"
FT                   /product="methionyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_422"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06693"
FT                   /db_xref="GOA:O66738"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:1PYB"
FT                   /db_xref="UniProtKB/TrEMBL:O66738"
FT                   /protein_id="AAC06693.1"
FT                   /translation="MEEKALIGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEE
FT                   RTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDV
FT                   KEGAKLS"
FT   gene            290037..290654
FT                   /locus_tag="aq_423"
FT   CDS_pept        290037..290654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_423"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06703"
FT                   /db_xref="GOA:O66739"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:O66739"
FT                   /protein_id="AAC06703.1"
FT                   /translation="MKYFHFTEEHPFSLVLPLIEEGKLDPWEVDIVELANLYMEELKKL
FT                   EVLDLRVPARAILAASFLLRKKIETIFPKPPRKYTKRKYTLQEIVDMFEEEYREVEEDI
FT                   KENVEKIRKIVKRKRASAKRKRREKRKEVPLHVAKFEEVLEELWNSFKELEVGTRLSFF
FT                   NFLSKKDLVPQFMALLYLDYESKVRLFQEKPFEDITVEILKT"
FT   gene            complement(290643..291701)
FT                   /gene="thrC2"
FT                   /locus_tag="aq_425"
FT   CDS_pept        complement(290643..291701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC2"
FT                   /locus_tag="aq_425"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_425"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06690"
FT                   /db_xref="GOA:O66740"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="PDB:2ZSJ"
FT                   /db_xref="UniProtKB/TrEMBL:O66740"
FT                   /protein_id="AAC06690.1"
FT                   /translation="MNRWQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEADNLARAIGF
FT                   KGKIYLKYEGLNPTGSFKDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLR
FT                   AYVLLPKGAVAIGKLSQAMIYGAKVLAIQGTFDDALNIVRKIGENFPVEIVNSVNPYRI
FT                   EGQKTAAFEICDTLGEAPDYHFIPVGNAGNITAYWKGFKIYYEEGKITKLPRMMGWQAE
FT                   GAAPIVKGYPIKNPQTIATAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIA
FT                   STEGVFCEPASAASVAGLIKLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCEEPITVP
FT                   PDFDEVVKVLGF"
FT   gene            complement(291728..292093)
FT                   /locus_tag="aq_427"
FT   CDS_pept        complement(291728..292093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_427"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_427"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06700"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66741"
FT                   /protein_id="AAC06700.1"
FT                   /translation="MNLFEYKLSVVRQVMDKYEVAEEAKFISGLSKGSMVNALSRKKKL
FT                   PNKEAKFTRYVIYTVDVERIIDMMEEPYRTVIKKRYYDASLDTVKKDFGLQNKREAYFL
FT                   VKKSVNKFYDLLENYWK"
FT   gene            complement(292111..292557)
FT                   /locus_tag="aq_428"
FT   CDS_pept        complement(292111..292557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_428"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06704"
FT                   /db_xref="GOA:O66742"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="PDB:2DBO"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66742"
FT                   /protein_id="AAC06704.1"
FT                   /translation="MRAVIQRVKKSWVEVDGKVVGSINEGLNVFLGVRKGDTEEDIEKL
FT                   VNKILNLRIFEDERGKFQYSVLDIKGEILVVSQFTLYANVKKGRRPSFEEAEEPKRAKE
FT                   LYEKFVDKIKESGLKVETGIFGAMMDVFIENWGPVTIIIDSREI"
FT   gene            292832..293572
FT                   /locus_tag="aq_429"
FT   CDS_pept        292832..293572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_429"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_429"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06701"
FT                   /db_xref="GOA:O66743"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:O66743"
FT                   /protein_id="AAC06701.1"
FT                   /translation="MELDKYLVLGFATLYALFMLLTKDIFVKYLSSLYAVSFMLIYMSY
FT                   YLEGVNFPRLYVYGFRVVGFIMLAYTFFENYKLIKLLRNLEKRTYIDSLTGVYNRKFLE
FT                   EIFKLEKEKYRTFRKEFCIIFIDLDNFKEVNDRYGHMEGDKVLKRVAELIKKSVRKEDY
FT                   VIRYGGDEFVIITEAPRGDVLSIMSRLQDVIKIKYKEVEVTASIGSACFPNDGKELEEL
FT                   IKKADERMYRIKKMKNELLKLNKG"
FT   gene            complement(293549..294100)
FT                   /locus_tag="aq_430"
FT   CDS_pept        complement(293549..294100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_430"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06705"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:O66744"
FT                   /protein_id="AAC06705.1"
FT                   /translation="MAEKRTRLRRDKGVVRSRRRGMRRRAAIFVDGTNLYFIQKNFLNA
FT                   KIDIVKFVNYFKQFYDIYNTFFYLAYKEEDEKQERFFKLLAFSGITVVKKPVKQLKDGS
FT                   LKGDVDVDIAIDMLLTKDNYDTAILCSGDSDFERLVYVLRNFGKEVICVSTKESSSIEL
FT                   VNACDRYIDLKEILPFIKLE"
FT   gene            complement(294248..294796)
FT                   /gene="grpE"
FT                   /locus_tag="aq_433"
FT   CDS_pept        complement(294248..294796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="aq_433"
FT                   /product="heat shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:aq_433"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06707"
FT                   /db_xref="GOA:O66745"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66745"
FT                   /protein_id="AAC06707.1"
FT                   /translation="MEKNQKEIEKELEELRKREKELEEKIQKLETIAKNSNLRVAELQR
FT                   EIDYLKERYRRDLEEQRKFCYEKFAYDLLEVMDNFERALEYGRQAQDVKSILLGIEMIY
FT                   SEMKKIFEKYGIREIPVEGKEFDPYVAEAVEKVETDQYPPNTVVKVIRKGYYIHDKVLR
FT                   PARVAVAVPPQEEEGEEIT"
FT   gene            complement(294816..296294)
FT                   /gene="glpK"
FT                   /locus_tag="aq_434"
FT   CDS_pept        complement(294816..296294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="aq_434"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_434"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06710"
FT                   /db_xref="GOA:O66746"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66746"
FT                   /protein_id="AAC06710.1"
FT                   /translation="MSVVISIDVGTTRVKVIAFSKNGKIVAISDREVSQIYPEPGWVEQ
FT                   DPLELWEAVRKSLSEVIQQVGLKEINSIGITNQRETVILWDKETGRPVYNAILWQDLRT
FT                   EDICRKLSEYSEYIKENTGLLLHPYFSASKVNWIIENVNGVKKDIERGKVIFGTVDTWI
FT                   LWNLTGGKVHKTEPSNASRTLLFNIKRLEYDDELLKIFRIPKNILPEVNESSSLFGYTD
FT                   KSITGVEIPITGILGDQQASLFAHGIRELEEVKNTYGTGLFLMLLTGSKPIIPERLLGT
FT                   VAWVINGKVNYAIEGSVLTGGACIKWLMDRLKLIKQAADTEYLAKSISSNEGVYFVPAF
FT                   SGLGAPYWDASARGIIIGITGRTRIEHIARAALEAIAYQTRDVIEEMEKETGVKIKILK
FT                   ADGGASQNNFLMQFQADILGIPVERPRHVELTALGAAGIAGIYSGMWKSKEEFIEDTRE
FT                   VELTFSPEMKKEERELYYSKWKDAVKRAMKWSML"
FT   gene            complement(296291..296965)
FT                   /gene="ribD2"
FT                   /locus_tag="aq_436"
FT   CDS_pept        complement(296291..296965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD2"
FT                   /locus_tag="aq_436"
FT                   /product="riboflavin specific deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_436"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06708"
FT                   /db_xref="GOA:O66747"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66747"
FT                   /protein_id="AAC06708.1"
FT                   /translation="MERPYVIIVSEVSVDGKLTLYRGASSKELMSLMDEEAYKYLHEIR
FT                   AKVDGIMVGCETVRTDNPSLTVRYAKGKNPVRIIPCSTANVPLDANVLNTKEAPTIIAT
FT                   TERAPKERLEKIKELGAEVIVVGDELVDFDKLLPELYRRGIKSLMVEGGASINWEFVRR
FT                   RVVDEIRLIHLPVIVGGENVPTLVGGEGFKKLKNLLHLRLRSHFVRGKQLITEWEVVNK
FT                   IR"
FT   gene            complement(296990..297061)
FT                   /locus_tag="aq_t05"
FT   tRNA            complement(296990..297061)
FT                   /locus_tag="aq_t05"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:297027..297029,aa:Gly,seq:ccc)"
FT   gene            297105..299003
FT                   /gene="nuoG"
FT                   /locus_tag="aq_437"
FT   CDS_pept        297105..299003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="aq_437"
FT                   /product="NADH dehydrogenase I chain G"
FT                   /db_xref="EnsemblGenomes-Gn:aq_437"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06711"
FT                   /db_xref="GOA:O66748"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:O66748"
FT                   /protein_id="AAC06711.1"
FT                   /translation="MSEKVKIYIDDVEIEAEKGKTVLQVALENGIDIPYFCYHPRLSIA
FT                   GACRMCVVYWEDINRLVISCNLPVQEGMRVRTHRTSEMVREQQKYLLQALMTRHPLDCP
FT                   ICDKAGECDLQNLGAIYGPQKQIVPISALEKEREEHDWESDFLEYYSNRCVVCYRCTRA
FT                   CDEVVGTRALYVEDRGFHSNIVPAVRPMDTSTCEMCGICVHVCPVGAIISKPFKYWSRS
FT                   WLLEKGRTVCNLCPVGCEIQIEYGVGDWRSKRKVYRTKPTDELNICAKGFFGYDSINHK
FT                   RLLKTKVGKREETPGNVVNLLTTILTEHGGKTGIVFSAYLPKEVIDEVLRIAKASQAYV
FT                   TAPQSVDLFKFLDELEEYDFPTVKEFEKADAFVFIGDDITSVATVLSYYTKKKVYKIGK
FT                   SVRDEKLQPEEITYEDLQNLEGNVFVLVTPHALNGEIKEVATKLKELKREKGFKVIPVP
FT                   KDANALYLYEVLKGIYSDLPAVMEACERGDIENLIIFGEDILEFYEDKVFEELKEKLEH
FT                   LVVVSPYEDGLSEYAHIKIPMSLMGENEGTYKTFFGEVKGKKFLPWAFDDLAFWKYLGE
FT                   NFKEEKGLKVVKSSSNLRRRFEPHLYRNNWITQRSQNLSRLYEKNKDITVYYERSV"
FT   gene            complement(299119..300078)
FT                   /locus_tag="aq_438"
FT   CDS_pept        complement(299119..300078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_438"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06720"
FT                   /db_xref="GOA:O66749"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:O66749"
FT                   /protein_id="AAC06720.1"
FT                   /translation="MNIFFLISSFFRKLKIKDFIKPAIGGFIAGSIGMLFPAAIGNGYG
FT                   WLQLILDGKWNDYAQIFLSAVAVMLGVSFTIGSGGSGGVFGPSVMIGGLLGASYSLFLN
FT                   AQYSLNLHVPSFTIVGMVALFAGAAKAPLSTLILIAEMTGGYELLVPAMIAVFVSYFLS
FT                   GEKSIFPSQVNTRLDSPAHMDEFGFYILEKLCVRDYMTPNPITVSPNQTLKEVEEILSK
FT                   HLIGGLPVVAKGKLVGIVTKSDIQKVPSELREKKRVYDVMSTNLITVTEEESLAEVLRI
FT                   FSSKGIGRLPVVKHKGSSELIGIITRADIGKAIREWKK"
FT   gene            complement(300317..300829)
FT                   /locus_tag="aq_439"
FT   CDS_pept        complement(300317..300829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_439"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_439"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06714"
FT                   /db_xref="GOA:O66750"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:O66750"
FT                   /protein_id="AAC06714.1"
FT                   /translation="MLRKYFWLPVIIGLFAGLFAILFVEALEVITHLVLEQVVGYYQPL
FT                   PGGEGHRETFTWEPLKPYLLPITVALGGLISGLLAYFFAPESAGVGTDAAIYAYHHGKK
FT                   LSLKSSIVKLITSAVTIGTGGTSGREGPIALIGAGLGSSVADWFKLKESEKRKALAIGS
FT                   GQSSSYL"
FT   gene            300870..301664
FT                   /locus_tag="aq_440"
FT   CDS_pept        300870..301664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_440"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_440"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06715"
FT                   /db_xref="GOA:O66751"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O66751"
FT                   /protein_id="AAC06715.1"
FT                   /translation="MHVLLIGLGNMGKKYLRKIKELGLNPVICDIDPEKANVCNECPFY
FT                   CHIGDIKEEVQKVIIAVDPKDHVRLAKEFLEKGIPVLLEKPPALTSKEFEEIVENPNLE
FT                   ISEIELYSEAVKNFPTDVEPEEIVIERLNKGSGYINPLWDLAWHDLYVLQYLFGDVEAE
FT                   EVNRKNGIWEIKGKVKNVPFTLRVAWNYPEEQKRVWRIKTKKGEILMDFIKEELAYGNY
FT                   KRQRLYGDKLGEMVRDFLSGVRREGSTRRALNNLRILESLKI"
FT   gene            complement(301661..302320)
FT                   /locus_tag="aq_442"
FT   CDS_pept        complement(301661..302320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_442"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_442"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06716"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O66752"
FT                   /protein_id="AAC06716.1"
FT                   /translation="MEIKENSYVKSFKKLRIAKLFENREEFKKLRRKNTFWKEISEAMA
FT                   VRERIKDHLIRDPNHVVIDLCSGKGFLSTLVALMHPKTKVIAVDIDEGADREHFTYLKN
FT                   AQFVKADIMSEEVEKLIKEAGDKVILTGIHLCRDLSERFIELVNNNENVKFAVLMPCCE
FT                   GNFPREKYQFLIDELGVYEAWCYYLKDKFDENLKVKMKRDKKVISPKNIVLTAERN"
FT   gene            302447..303136
FT                   /gene="gua"
FT                   /locus_tag="aq_443"
FT   CDS_pept        302447..303136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gua"
FT                   /locus_tag="aq_443"
FT                   /product="glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_443"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06709"
FT                   /db_xref="InterPro:IPR011903"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2AYT"
FT                   /db_xref="PDB:2YWM"
FT                   /db_xref="UniProtKB/TrEMBL:O66753"
FT                   /protein_id="AAC06709.1"
FT                   /translation="MLLNLDVRMQLKELAQKEFKEPVSIKLFSQAIGCESCQTAEELLK
FT                   ETVEVIGEAVGQDKIKLDIYSPFTHKEETEKYGVDRVPTIVIEGDKDYGIRYIGLPAGL
FT                   EFTTLINGIFHVSQRKPQLSEKTLELLQVVDIPIEIWVFVTTSCGYCPSAAVMAWDFAL
FT                   ANDYITSKVIDASENQDLAEQFQVVGVPKIVINKGVAEFVGAQPENAFLGYIMAVYEKL
FT                   KREKEQA"
FT   gene            303136..303966
FT                   /gene="accD"
FT                   /locus_tag="aq_445"
FT   CDS_pept        303136..303966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="aq_445"
FT                   /product="acetyl-CoA carboxyltransferase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_445"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06712"
FT                   /db_xref="GOA:O66754"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:O66754"
FT                   /protein_id="AAC06712.1"
FT                   /translation="MRFLDRFFKKKKKEEALWTKCPNCKSLLYVPDLESNLKVCPNCDY
FT                   HFTLSALERIKYTLDEENPELLFEEILPADPLNFKDTKSYKDRIKKAQEETGLSEAIVI
FT                   TEGHIKGKRAILAVMDFNFIGGSMGSVVGERFFRACERAVETKTPLISFAASGGARMQE
FT                   GILSLMQMAKTTFGVGLLKEANIPYISVLTNPTMGGVSASFAFLGDLILAEPKALIGFA
FT                   GPRVIEQTIKQKLPEGFQTAEFLLEKGQIDMVVHRKELKDKLAYFLEVMYYAKR"
FT   gene            303963..304640
FT                   /gene="mgtC"
FT                   /locus_tag="aq_447"
FT   CDS_pept        303963..304640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtC"
FT                   /locus_tag="aq_447"
FT                   /product="Mg(2+) transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_447"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06713"
FT                   /db_xref="GOA:O66755"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:O66755"
FT                   /protein_id="AAC06713.1"
FT                   /translation="MKEYLDIFFLEKYPFPLYEAFLRIVFAALLGALIGLERERRRQPA
FT                   GLRTHAVLAIGSALITLVSIYTSYTYGGITADPSRITAQIVSGIGFLGAGAILRFGVTV
FT                   KGLTTAASLWSTAGIGIAAGTGMYVLSLFTTLILLLFLTFVSKVEREILGSKGTVNLKL
FT                   TLTDFPEGIYRVQNILEEVKIQKVVKKKEEVEVLLSIPRYEDLTEKLEEVLRLKEVKEL
FT                   ELM"
FT   gene            304651..304941
FT                   /locus_tag="aq_448"
FT   CDS_pept        304651..304941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_448"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_448"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06717"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66756"
FT                   /protein_id="AAC06717.1"
FT                   /translation="MKEVLMRIYSSKEENLEDYINKLFEGGIRGAVVLQGIAGFGKGRE
FT                   FHSEEIEVLSYELPVVIEVVEDREKLLNFLKENRETFKNCYITFERVKVWE"
FT   gene            304932..305306
FT                   /locus_tag="aq_449"
FT   CDS_pept        304932..305306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_449"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06721"
FT                   /db_xref="GOA:O66757"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66757"
FT                   /protein_id="AAC06721.1"
FT                   /translation="MGVVFAVALGGAIGSALRFLLSKVVQEHFGISFPVGTLFVNLVGA
FT                   FFIGFFFAYLVDKLAVNPHARALLITGLLGGLTTFSTYSYESFSLLREGETLKFLAYTL
FT                   GTNVLGIFFTFLGYILGESL"
FT   gene            305303..305620
FT                   /locus_tag="aq_450"
FT   CDS_pept        305303..305620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_450"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_450"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06718"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66758"
FT                   /protein_id="AAC06718.1"
FT                   /translation="MRVVKKKLLRIFTSEDESFEGKPFYKYLLERAKERGLEGATVFRA
FT                   IAGYGKTKEIRKHKLFQLRSSLPVVVEIIDEEEKIKRFLEEIKGKHNGLITLEDVEVIY
FT                   L"
FT   gene            complement(305617..307374)
FT                   /gene="ilvB"
FT                   /locus_tag="aq_451"
FT   CDS_pept        complement(305617..307374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="aq_451"
FT                   /product="acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_451"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06706"
FT                   /db_xref="GOA:O66759"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:O66759"
FT                   /protein_id="AAC06706.1"
FT                   /translation="MPAKKGADIVIETLKAEGVEVVFGLPGGAIMEVYDALYRLGGIKH
FT                   ILARHEQGAGHMAEGYAKATGKVGVVMVTSGPGATNLVTPIADAYMDSVPLVAITGQVP
FT                   THLIGNDAFQEVDIVGITRPITKHNFLVKSIEELPLILREAFYIARTGRPGPVLVDLPK
FT                   DVTQQIADVKIPSDEEVKAALPGYKPHVEGNPQQIKKAAELIMSAKRPVLYVGGGAVNS
FT                   EAQEELIELAELMQIPVTTTTQGKGAFPETHPLSLRMLGMHGTYYANMAVYNSDLLIAV
FT                   GARFDDRVTGKIDEFAPGAKIIHIDIDPASISKNITVDVPIVGDVKIVLRKLINEIKKR
FT                   GAKILYPEERKKWLEQIEKWKKLHPLTYRNSDKVIKPQYVIEQLWEATNGEAIIVPGVG
FT                   QHQMWAAMFYKFKYPRQFINSGGLGTMGFGLPAGIGAKIGRPDREVWVVDGDGSFVMTM
FT                   QEVITAVQYKVPVKVAIINNAYLGMVRQWQELFYDKRYSEVDLSVQPDFVKLAEAMGAV
FT                   GMRAKKPKEVREVIEEARKIDDRPVIIDFWVDREENVLPMVPAGKSYKDMILEDGKGKH
FT                   EAETMYLVG"
FT   gene            complement(307708..308481)
FT                   /locus_tag="aq_453"
FT   CDS_pept        complement(307708..308481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_453"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_453"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06719"
FT                   /db_xref="GOA:O66760"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66760"
FT                   /protein_id="AAC06719.1"
FT                   /translation="MGTLRKLLNALFLCLWDAFRYDYSYHASALTLQLLLVLAPLIVFL
FT                   AALSSYLGFIKLDLLEEVLREHFPKQTHAVIAEILKAKEQGKTASLISLLVSYFFSVNF
FT                   VKKIAKSLSYVVERKKRDVHEVFFWVGFPILLVLFSFVTGMSFYVSILLKTYFKGIGFL
FT                   SNLASSLPLLFLVISLYWSFIKINRKISLLISSFLVYFFASLLQYIFTLYTVYVFKGSV
FT                   LYGSLSTIVLFFLWLNFNFLLFLVGARFIERYESS"
FT   gene            complement(308469..309581)
FT                   /locus_tag="aq_454"
FT   CDS_pept        complement(308469..309581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_454"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06722"
FT                   /db_xref="GOA:O66761"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66761"
FT                   /protein_id="AAC06722.1"
FT                   /translation="MRRFFENVPENLWRSYEWQIQNRIKTLKEIKKYLKLLPEEEEGIK
FT                   RTQGLYPFAITPYYLSLINPEDPKDPIRLQAIPRVVEVDEKVQSAGEPDALKEEGDIPG
FT                   LTHRYPDRVLLNVTTFCAVYCRHCMRKRIFSQGERARTKEEIDTMIDYIKRHEEIRDVL
FT                   ISGGEPLSLSLEKLEYLLSRLREIKHVEIIRFGTRLPVLAPQRFFNDKLLDILEKYSPI
FT                   WINTHFNHPNEITEYAEEAVDRLLRRGIPVNNQTVLLKGVNDDPEVMLKLFRKLLRIKV
FT                   KPQYLFHCDPIKGAVHFRTTIDKGLEIMRYLRGRLSGFGIPTYAVDLPGGKGKVPLLPN
FT                   YVKKRKGNKFWFESFTGEVVEYEVTEVWEP"
FT   gene            complement(309613..310614)
FT                   /gene="sor"
FT                   /locus_tag="aq_455"
FT   CDS_pept        complement(309613..310614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sor"
FT                   /locus_tag="aq_455"
FT                   /product="sulfur oxygenase reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_455"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06723"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011661"
FT                   /db_xref="UniProtKB/TrEMBL:O66762"
FT                   /protein_id="AAC06723.1"
FT                   /translation="MLTDIKKGVAVAINKAKVNNTPRFQELMYQVGPKVCITTAMHEGF
FT                   LGFHAFIQVGAHPLGGRFGAAKVINADSLEAIQREGLTAIKYNPLELWQYTVWEKWEDH
FT                   EEMHYQQFDRIFELCVGCFTEVVEGPNEPIYVVREANMPPVIDFTDVPKVLGESMMQAM
FT                   QGKGGIPKVRLLTQRIAVVGIHKVKEGMEEKFIEGAVETLELLNKYSAGMIGWMILEKI
FT                   GESPYGTFQIKPPEFWEVVASRGAVPPKTRETIWGEYGKPEFQLEPAGHPKEFIVHMEW
FT                   SRPESAMFGPALTAVNPKIKKVHDEKVMTTLAHIPPYYKVFMPLMEDLILFP"
FT   gene            310732..311235
FT                   /gene="bcp"
FT                   /locus_tag="aq_458"
FT   CDS_pept        310732..311235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp"
FT                   /locus_tag="aq_458"
FT                   /product="bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_458"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06726"
FT                   /db_xref="GOA:O66763"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:O66763"
FT                   /protein_id="AAC06726.1"
FT                   /translation="MKEFLIKILVLLGLAQPGNAIQEGQPAYLFSLNNHEDKVVNLSDY
FT                   KGKWVVLYFYPKADTPGCTTQAKEYTKLMPEFEKLNVKVFGISTDSVEKIRRFREKYGL
FT                   TVEFLSDPEGIVAKAYGVTLIAGLCSRDTVIINQNLIVEKIYRGVSPSADPHKVLEYIK
FT                   QRAS"
FT   gene            311258..311782
FT                   /locus_tag="aq_459"
FT   CDS_pept        311258..311782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_459"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06732"
FT                   /db_xref="GOA:O66764"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:O66764"
FT                   /protein_id="AAC06732.1"
FT                   /translation="MGYIYIVSFGDVEDRLLLADASNVKEIFDLEVRVSTVKADIEEAY
FT                   NPQRNQYHAGTILSYLSRVVYPDMVRLVALVSFDLYEEGLNFVFGEAQYGGKYAVVSTY
FT                   RLYHPDERVFFERVFKETNHELGHTFGLKHCPDPYCVMSFSNSIDEVDRKSRDFCPNCR
FT                   RKLDYVLSYYR"
FT   gene            311779..312390
FT                   /locus_tag="aq_460"
FT   CDS_pept        311779..312390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_460"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_460"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06728"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66765"
FT                   /protein_id="AAC06728.1"
FT                   /translation="MIGRVFRIFREKGGILKALGLWEWYENLPHKYQKKVKHYYSLKTI
FT                   KSINFPYKAKHFDTGEVENVLYTKRTFLGTIAQTALLEGDLEFAEWLYNEALKMEGSPY
FT                   EAHLILNDLVLLAQKQRDLEKVKKYVLQDVELYPEYKEELKSRWGGTLPQIMAFEIYVY
FT                   LLEREGKIKEALELVEWIKKEGITYPYYDQVKERLLQKLK"
FT   gene            312402..313838
FT                   /gene="gatB"
FT                   /locus_tag="aq_461"
FT   CDS_pept        312402..313838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="aq_461"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:aq_461"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06727"
FT                   /db_xref="GOA:O66766"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="PDB:3H0L"
FT                   /db_xref="PDB:3H0M"
FT                   /db_xref="PDB:3H0R"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66766"
FT                   /protein_id="AAC06727.1"
FT                   /translation="MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLG
FT                   MPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATN
FT                   GWVELNLPNGEKKKVRIRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTP
FT                   EEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRF
FT                   VQKALEYEIERQINVVEEGGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPL
FT                   KVKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEP
FT                   KGIVNWLINDLLGLLRDKGISIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVET
FT                   GKTPSQIVEEKGLKQITDENQIKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRET
FT                   RGKANPQVVNKVIRELVKEV"
FT   gene            313851..314192
FT                   /locus_tag="aq_465"
FT   CDS_pept        313851..314192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_465"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_465"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06729"
FT                   /db_xref="GOA:O66767"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66767"
FT                   /protein_id="AAC06729.1"
FT                   /translation="MNRQPMFFILIVLLFTVFSLKEFIPNTFCIHPKEGIIHLEKEHPK
FT                   TFCEKDEVHVKVLSEIKNLKVQLDLDKSFSFTSPFRISLSFVVLKKQNALPEKSPRRES
FT                   PIKTVRLLI"
FT   gene            314640..315419
FT                   /locus_tag="aq_467"
FT   CDS_pept        314640..315419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_467"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_467"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06730"
FT                   /db_xref="GOA:O66768"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:O66768"
FT                   /protein_id="AAC06730.1"
FT                   /translation="MTNIWKKNYETAKEVEEFVKKAYELGDVTELELLRAKRERSIAEV
FT                   KLKVSRSKYEASLKELSRLLAKEVRDVEGELSAGVAMKEVNIDTLPVVLSIKKKIEAID
FT                   RQIQLEKALAKPKLATGFVVEESEEGYYGLRGSLTLELPLFYRREGEILQNIAMKKALK
FT                   RRLEAELLKVKSRLESVKIRLETLQKELEKLEREVIPRAREELALAIKSYKLKAITLLE
FT                   LSDVRRKYYELLINRAELLLDIHRTYSEFIEIGGWRR"
FT   gene            315416..316495
FT                   /gene="czcB3"
FT                   /locus_tag="aq_468"
FT   CDS_pept        315416..316495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB3"
FT                   /locus_tag="aq_468"
FT                   /product="cation efflux system (czcB-like)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_468"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06725"
FT                   /db_xref="GOA:O66769"
FT                   /db_xref="InterPro:IPR005695"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:O66769"
FT                   /protein_id="AAC06725.1"
FT                   /translation="MKKILIYLITLLAFSFGGEEHGHEEEIHLTDKQIKLLGIKLYEVK
FT                   REPVGKIVKMPAEVEENPLLNYVVYSPVEGIVRKLYKKEGDLVKKGEPLAEVYSPELAN
FT                   LIGEVRTAKVRMESARKLYERYKKLYEQKVIKYTLFYNAMVEYERAKGEYEALLSKLKS
FT                   FGEVKGYNLVLRSPGKGYVVKQNVVLGESVGLDNFLFKIHSHEVVWVYGWADEKSAKDI
FT                   KEGMKGTALSHEDRLPCRVDYIGHEVDRKTRRVKVRCVAQNKNHVLKPGMFVELLVKTQ
FT                   GEPAILIPKNAVQEIEGKKVVFVRTEEGFEARPVTILKELNGYYVVLEGLKEGERIAVT
FT                   GTVFLKTKLVGVEEGGHAH"
FT   gene            316510..319569
FT                   /gene="acrD3"
FT                   /locus_tag="aq_469"
FT   CDS_pept        316510..319569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrD3"
FT                   /locus_tag="aq_469"
FT                   /product="cation efflux system (AcrB/AcrD/AcrF family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_469"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06724"
FT                   /db_xref="GOA:O66770"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:O66770"
FT                   /protein_id="AAC06724.1"
FT                   /translation="MFRAVLKYRLLVLIALVGTVIYGVYSFKKLPIDAFPDPTPVQVNI
FT                   YTEAPGLSAEEVETLITIPVESVMNGIKDVELVRSVSLPGLSYVSVYFKEGTDVYFARR
FT                   LVMEKLPDAKERIPEGFNPVMGPNSTGLGNVLVYVLYDTSGKYTPQELKSIFQQWVARP
FT                   LIMSAGGVEEIVQFGPELAYVIVPDFEKLIAYGITLEDLLNALERNNLLVGGGFYQSAE
FT                   GDLVVRGLGRVYSKEDLLRIPVKVDEEKGVSVYLRDVAKVVEGEVPNRRGAFTMNGQEV
FT                   QGNIVVKRIYENTKEVVDKVKEKLKEIQKILPEGVKIEHLYDQAYLTEKAVSTIQKALF
FT                   SGMLLVAIVTAFLMGNFRTSLIVISSLPLTLLIAFIVMKETGMSGNLMTLGGLAIGIGM
FT                   FVDSSVVVVENVYRHLTENKSATKFSIILDSLKEVWRPVLFAVLIIVIVFSPIFVFESV
FT                   EGKFFKPLAMTLIIALLASLFVAFTFIPALSYYFLKPGKETYSKLMRAIHKVYEKVLDF
FT                   TFKLRTLLYLGVFISFVFSLFLLTRIGTEFAPELEEGAVIVKAFLDPNVSLEEGKRVAT
FT                   AIEREAMKFPEVIRTFSTVGRAEKGEAADVNYIETWILLKPQSEWETFKTREEFNEILR
FT                   KRLEWLPASLGFTQPIKMRIDELLSGVRADIAIKIFGQDPEVLNELADKVKEIAESVPG
FT                   AVDVQKEIQAGRLQLRIYPKWEVLERYGITVEEVLDVVKYNLGGAPVGELQKDTLLFPI
FT                   VMTLPEDFRGDVSKLAKIPLFERHGKILTFGDVADLKVEPGLFVIRRENNIRFALVMLN
FT                   VEGRDTGSFVKELQSRIENEVKLPTGYFITYGGQFENQQRAMKKLSIAVPVSIFLIFVM
FT                   LYLNFNSVRDALVVMLNVPFAVIGGIIALYISGFNLSVPSAIGFIAIFGVATLNGVVLV
FT                   SYIRQLLQEELEIREAVKRAAILRIRPILITAITTLIGLIPLLVIRDIGSEVQRPLATV
FT                   VVGGIFTSTLLTLIILPSVYELVYRKFPRA"
FT   gene            319586..320233
FT                   /locus_tag="aq_473"
FT   CDS_pept        319586..320233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_473"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_473"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06731"
FT                   /db_xref="GOA:O66771"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66771"
FT                   /protein_id="AAC06731.1"
FT                   /translation="MKEEREKKEEVFEEEEFGELLKYTLAGYAGGLGLGWLLDKLGFQQ
FT                   NPIGEWLVRTLAGEGESILEGIFAVKKRLTGAVSSLAQAYGWGKLIGMTVPWWIDLFSR
FT                   LLGVNVYGWEGFYIPYFYAMSDQIGANVSGFIYLYKKEGNFSKAVKRYFTNPVMLTSLL
FT                   VILLVPIGLLVARLLGFSPTTNFYAALETVAANLCWLPPLVGMLVEKKKGSD"
FT   gene            complement(320225..321457)
FT                   /locus_tag="aq_474"
FT   CDS_pept        complement(320225..321457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_474"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06733"
FT                   /db_xref="GOA:O66772"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66772"
FT                   /protein_id="AAC06733.1"
FT                   /translation="MKVAFETLGCRMNQFDTDLLKNKFIQKGYEVVSFEDMADVYVINT
FT                   CTVTVGGDRSSRQAIYQAKRRNPKAIVVATGCYAQVNPQELAKLKEVDLVVGNTHKSEL
FT                   LKILEEYLERREKKVVVGEIFREKEVRNFDTVLYFEGVRPFLKVQEGCNKFCTFCVIPY
FT                   ARGKVRSVDLEKIVHQVKLLAQKGFKEVVLTGTQLSQYGWDKGYNLYTLLTELIKIEGI
FT                   ELIRLSSMHIKEMDKELLKLIVSEEKIAPHFHLSLQSGSNRILELMDRGYTREEYEEVV
FT                   NFIVENRPISSIGTDVIVGFPTESEEDFQETYEFLKRIPISYMHIFPYSDRPFTKASKL
FT                   KPKLPERIKKERVRILKELDQKKRQEFYEKNKGKELRALVIEENRLLTENYIDIKREGY
FT                   KEVGKLVRVLI"
FT   gene            322201..322575
FT                   /gene="panD"
FT                   /locus_tag="aq_476"
FT   CDS_pept        322201..322575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="aq_476"
FT                   /product="aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_476"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06737"
FT                   /db_xref="GOA:O66773"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66773"
FT                   /protein_id="AAC06737.1"
FT                   /translation="MLREMLKSKIHRLTVTDADLHYEGSLSLDEYLMELADLKPFEKID
FT                   VYNINNGARFQTYVIPAPRYSGEVKLNGAAARLGHKGDLIIIASYAQYTEEELENYAPK
FT                   LIFVNEKNQPVEVKESTEVK"
FT   gene            322577..322909
FT                   /locus_tag="aq_477"
FT   CDS_pept        322577..322909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_477"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06748"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:O66774"
FT                   /protein_id="AAC06748.1"
FT                   /translation="MFMNVPEVTPEEAKKMLEEEKDKVVLLDVRTPPEHFQVRIPNSML
FT                   IPLDELRYAFQNLPKDKKYIVYCRIGERSAFATYFLRQMGYEAYNLAGGILIWPYEKES
FT                   GAPAKS"
FT   gene            complement(322899..324134)
FT                   /locus_tag="aq_478"
FT   CDS_pept        complement(322899..324134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_478"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06749"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:O66775"
FT                   /protein_id="AAC06749.1"
FT                   /translation="MSFVVARQPIFDRNGEVFAYEFFLRREGDEEKYPEDVPFSRAVYI
FT                   ITDILVESGIEKLANGKKAVINVSLEAILNKSLELLPPDKVIFDLNPPEVPLGETLKQK
FT                   VLQKLKDYKGKGVSFILNERLYSSEHKELINLSDIVEFYFKSVTPDKIRSAKRYGKKVL
FT                   VSMIEKEEEYKKALEYGADYFQGFYFAKPEIVKRTKLAPFLKVTLLRLLNAISIARSLK
FT                   EIADIIETDVGLAVKFLQFVNSAYFARRKKIESLEHAVSFVGMENIKKFVILVSMNEFL
FT                   KVENPELWRKSLTRAFIAEELTNRYSPEVSEKAFLVGLFSLLDKILEVDIPTFLRELNV
FT                   DEEVVKAFEDKGSSLHKLLEVVSRLEEAVNSSPEELDKTAQQLSQELGIPEIDLVIVAK
FT                   EAKEKAERIIKI"
FT   gene            complement(324100..325386)
FT                   /gene="glyA"
FT                   /locus_tag="aq_479"
FT   CDS_pept        complement(324100..325386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="aq_479"
FT                   /product="serine hydroxymethyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_479"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06734"
FT                   /db_xref="GOA:O66776"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66776"
FT                   /protein_id="AAC06734.1"
FT                   /translation="MEHLLKTDPEVFDAVVKEYERQFYNLEMIASENFTSLAVMEATGS
FT                   VLTNKYAEGLPGKRYYGGCEYVDVVENLAIERAKKLFGAEHANVQPHSGSQANMAVYFA
FT                   VLNPGDTIMGMDLAHGGHLTHGAKVNFSGKLYNVIHYGVNPETELIDYDQLYKLAKEHK
FT                   PKLIVGGASAYPRVFDWAKMREIADEVGALFMVDMAHYAGLIAGGVYPNPVPYAQFVTS
FT                   TTHKTLRGPRSGFILTTKEYAKAVDKSVFPGIQGGPLMHVIAAKAVAFKEAMSEEFKEY
FT                   AKQVVENARVLAEELKKYGFKIVTGGTDSHIVLVDLRNKNIIGKDAEKALEKAGITVNK
FT                   NAVPFDPLPPTKTSGIRIGTAALTTRGMKEDEMRKIAGWINEVLSNMDDEKTIQRVRQE
FT                   VRELCETFPLYPELKRRIDELRSGKATDL"
FT   gene            complement(325395..326378)
FT                   /gene="oppB"
FT                   /locus_tag="aq_481"
FT   CDS_pept        complement(325395..326378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="aq_481"
FT                   /product="transporter (OppBC family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_481"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06743"
FT                   /db_xref="GOA:O66777"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:O66777"
FT                   /protein_id="AAC06743.1"
FT                   /translation="MFKFILFRVLQAIPTLLGVTFLSFLIIKLAPGDYLDQLRLNPQIS
FT                   PETIERLKHLYGLDKPLLVQYFLWLKNALFFDLGYSFQYHAPVAELILERIPNTLLLSV
FT                   SSALFAWLLSIPLGTLAAFKENSLFDRFVVGFSYTFMSVPSFFLAFLLLFFASKTGILP
FT                   VGGMQSPNFEQLSIPEKVLDILKHLIIPSLTLGLVSLASLTRLVRSSVLEILSSPMVTM
FT                   LKAKGVGTFTLVRHVLKNAMNPFTTLLGYEIASLISGAALIEIIVGWPGMGMLMLNAVL
FT                   SQDLFLVMGGLYIGTIMLLVGNLIADLLLAYIDPRVRKRLSGEFKL"
FT   gene            326762..328042
FT                   /gene="eno"
FT                   /locus_tag="aq_484"
FT   CDS_pept        326762..328042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="aq_484"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_484"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06738"
FT                   /db_xref="GOA:O66778"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66778"
FT                   /protein_id="AAC06738.1"
FT                   /translation="MSRIKRVHGREVLDSRGNPTVEVEVELESGALGRAIVPSGASTGE
FT                   REALELRDGDPKRYLGKGVLKAVDNVNGVIAKALVGLEPYNQREIDQILIELDGTENKS
FT                   KLGANAILGTSMAVARAAANELGIPLYEYLGGKFGYRLPVPLMNVINGGAHADNNLDIQ
FT                   EFMIVPVCGGAFREALRAGVETFHHLKKILKEKGYSTNVGDEGGFAPNLNSSEEALDIL
FT                   MQAIEKAGYKPGEDILLALDVASSEFYENGVYKFEGKERSAEEMIEFYEKLIQKYPIIS
FT                   IEDPMSENDWEGWKEITKRLGDKVQLVGDDLFTTNPKILRKGIEEGVANAILVKLNQIG
FT                   TVSETLDTVMLAKERNYSAIISHRSGETEDTFISHLAVATNAGQIKTGSASRTDRIAKY
FT                   NELLRIEERLGNGAVFWGREEFYRFTS"
FT   gene            complement(328330..328965)
FT                   /gene="ahpC1"
FT                   /locus_tag="aq_486"
FT   CDS_pept        complement(328330..328965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC1"
FT                   /locus_tag="aq_486"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_486"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06735"
FT                   /db_xref="GOA:O66779"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:O66779"
FT                   /protein_id="AAC06735.1"
FT                   /translation="MDVKEIAKKIITDCPVRVGQKVPNFEMETYDPSTGKFGKVVLEDL
FT                   LKERKWVILFFYPADYTFVCPTELADLAEKYDELKEMGCEVISVSTDTKFVHLAWHRDE
FT                   PLLKNVKYPMGADPTGQVSRLFGVYDENTGLALRGTFIINPEGVLVGSEVNFYNVGRNA
FT                   DELVRKMKANVYLMSHPEEACPAKWEPGKKTLKPSEELVGRVGEVLNE"
FT   gene            complement(329019..329528)
FT                   /gene="tpx"
FT                   /locus_tag="aq_488"
FT   CDS_pept        complement(329019..329528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="aq_488"
FT                   /product="thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_488"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06736"
FT                   /db_xref="GOA:O66780"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2YZH"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66780"
FT                   /protein_id="AAC06736.1"
FT                   /translation="MARTVNLKGNPVTLVGPELKVGDRAPEAVVVTKDLQEKIVGGAKD
FT                   VVQVIITVPSLDTPVCETETKKFNEIMAGMEGVDVTVVSMDLPFAQKRFCESFNIQNVT
FT                   VASDFRYRDMEKYGVLIGEGALKGILARAVFIIDKEGKVAYVQLVPEITEEPNYDEVVN
FT                   KVKELI"
FT   gene            complement(329597..330319)
FT                   /gene="fnr"
FT                   /locus_tag="aq_490"
FT   CDS_pept        complement(329597..330319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr"
FT                   /locus_tag="aq_490"
FT                   /product="transcriptional regulator (Crp/Fnr family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_490"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06741"
FT                   /db_xref="GOA:O66781"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:O66781"
FT                   /protein_id="AAC06741.1"
FT                   /translation="MAQGAFSKGQTPEDLKIDLLKKTHLFEDLSPQELREVAKYIQVRN
FT                   YMKGEYIFFEEEAEPGIFILVEGLVKLIKETSDGRSIIVRLVFPGEVFGWIEWGKSVPK
FT                   FKYTAMAALPSTILYISNKYFINLAIKYPAIAIKLTCDATHNLLQTYEVLKSIASGKVE
FT                   ERIAKLLLELAEKAGEKKDGRIIIRLPLTRQDIAEMTGTTVETTIRVMSKWKKQGIINT
FT                   ERGYIEIIDKKALEKLVV"
FT   gene            complement(330417..331355)
FT                   /locus_tag="aq_492"
FT   CDS_pept        complement(330417..331355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_492"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_492"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06744"
FT                   /db_xref="UniProtKB/TrEMBL:O66782"
FT                   /protein_id="AAC06744.1"
FT                   /translation="MFEPQIQKLLTINLALKGNEYLLAFTDDYRKELSEVLKEIEKVAK
FT                   GITPEVKTIVFPSTGQHGKEPPEVLWVETFGKKAVEVLKEEGIFEKVLNKEPYDYEKLA
FT                   EILKSYSEKVPNVVIALSHYSTTHTTYRKVLTDVFKARYASMPLFEPEMFLGPMDVDWD
FT                   YVAKLSTDIAEVLTEGEYVEVSSPYGVNLEFSIKGRKGIPDTGLLTEPGSYGNLPAGEA
FT                   FIAPIEESAFGKLVILYAPNRKLEREITLYFKDGAVERIEGFEDYRYELERVFDTYPNA
FT                   RYIAEFGVGTNPKARRADNILEAEKIMELST"
FT   gene            complement(331382..332350)
FT                   /locus_tag="aq_493"
FT   CDS_pept        complement(331382..332350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_493"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_493"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06745"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66783"
FT                   /protein_id="AAC06745.1"
FT                   /translation="MTESLNRDLPVLLATLNKLSSDADRILLENREDIRKIAYNLSIVM
FT                   EKVKDDLPVLVENLKELSVNLNTVVKNNKVNINKTLVSLRKTTENLSRASYKLDKILAD
FT                   LESGKGTLGKLLKDEELYENVNQGVKALGKAGKVVEKTQLYIGLRGELYREGDSKGILS
FT                   VRLVPDRDKYYLLEVVGDSRGRVYREEYLDGREVVKKEFKPEFTLQYARNFSLFGRTLT
FT                   LRGGLKENTGGVGADYYIYRDKYLFADLWDFGRKDRPQDKDLKPNLQIGIHWYINRNLY
FT                   VRFGGDDLLNSKLRGFFGGVGLEFVDEDLKYLLGGIGVPIR"
FT   gene            complement(332298..333059)
FT                   /locus_tag="aq_494"
FT   CDS_pept        complement(332298..333059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_494"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_494"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06746"
FT                   /db_xref="GOA:O66784"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:O66784"
FT                   /protein_id="AAC06746.1"
FT                   /translation="MQISLSFTSSSIPGRQKLGTLSPSFSMFSIINYSHRMRLTTELKL
FT                   GAFVVAVSLAFAFLVLTFGEIPFFQPKMKEYLVYFDEVAGLSKGAEVRVSGVRAGKVKE
FT                   IILERGKVKVVFEVKEEIPIYRDAIASIGTLGLMGDKYLAVKPGSPESGELPPRSEIKN
FT                   VKTVSDTDKLIASLTQTAEEFKKVAQNLNTILLENRENLRQTIAHLNYLIKNLNEITEQ
FT                   NRGKHKLSSEEFKTIDRIFKQGSARSPRYFE"
FT   gene            332980..333465
FT                   /locus_tag="aq_495"
FT   CDS_pept        332980..333465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_495"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06750"
FT                   /db_xref="GOA:O66785"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:O66785"
FT                   /protein_id="AAC06750.1"
FT                   /translation="MLKEGDKVPSFCLPGIDEEVNEREICIDEFKGKKVILYFYPKDNT
FT                   PGCTQEACDFRDNLNLLKEMGYVVIGVSPDSTASHKKFKEKYGLNFILLSDKDKKVAEM
FT                   FGVYGEKKAYGKVTKGIIRSTFLIDEEGRIIKEWRNVKAKGHVAKVIETLKSLEEKQ"
FT   gene            333390..334088
FT                   /gene="mutY3"
FT                   /locus_tag="aq_496"
FT   CDS_pept        333390..334088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY3"
FT                   /locus_tag="aq_496"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:aq_496"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06742"
FT                   /db_xref="GOA:O66786"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:O66786"
FT                   /protein_id="AAC06742.1"
FT                   /translation="MAKRKGKGTRSESNRNLEELRRKAVEIVKRLEKVYLNPRLELEYE
FT                   NAFQLLVMAILAAQESDKVVNKVSKEFFKKYKTPQDIARANLEELEEDLKHINFYRRKA
FT                   KLIKECCEKLIELYKGEVPKSVGELVKLPGVGRKTANMVIGGAYNLPAIIVDRHVHRVV
FT                   ERISLSKQKNPDKMEMELSEIVPQELWTKFSLLLLNHGKTICKARNPECEKCPILDLCE
FT                   YGQKNLKGRK"
FT   gene            complement(334072..335367)
FT                   /gene="gsdA"
FT                   /locus_tag="aq_497"
FT   CDS_pept        complement(334072..335367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsdA"
FT                   /locus_tag="aq_497"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_497"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06740"
FT                   /db_xref="GOA:O66787"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O66787"
FT                   /protein_id="AAC06740.1"
FT                   /translation="MSSGDTELRKRIEFIIFGGTGDLSRNKLIPAILKLKDKIDLKKIY
FT                   ILGRNRKKFEEIKEKFKDFSELFVFVEFLAEREESYKNISSILGKESLKVFYLAVPPDL
FT                   FKEILENVGKYLNFPEKRIVIEKPFGLSLKHAKDLNKIISVYFKEEEIFRIDHYLGKPQ
FT                   VQNILAFKFSNYVFSEVLNKCLVEKVEVIALEEVGVEGRKAYYEKVGVIRDMLQNHMLL
FT                   LSSLIVMRLPPRAEDFHFELKNALKRAEFESESLILGKYKSYQGKAPTFALVKLHFDDE
FT                   RFTGVPFVLATGKKLKKKLTRVCIHFKNFPKEIERLLGCVPERNLLVFELYPEQEVSFR
FT                   VNVISPLGFLRCTESINWRVSLKDVLGEIPEAYESLLLDVIRGDKTLFLDAEETEILWE
FT                   KTEPLLKKEKEVLTYDDRVLIPEFAEDFISCL"
FT   gene            complement(335330..336232)
FT                   /gene="gnd"
FT                   /locus_tag="aq_498"
FT   CDS_pept        complement(335330..336232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="aq_498"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_498"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06739"
FT                   /db_xref="GOA:O66788"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O66788"
FT                   /protein_id="AAC06739.1"
FT                   /translation="MKTLFLIGLGRMGSALAYRLKNRGWEIYGYSRTQTTRERAKKDLG
FT                   IKVLNSYENLKNFPSPKTVWLMVPHTAVDEVLQNLKPFLNKGDTVIDGGNSYYKDSQRR
FT                   YRELKEVDVNFLDVGVSGGILGKDTGFSFMIGGDEEVFKKHEKLFKDLAYEEKGYAYLG
FT                   SSGAGHFAKMVHNGIEYGIMEAIAEGFELLKKSPFDYDLREVARVYSQGSVIRSFLIDL
FT                   LVKAFEDFGDLEDVEGYVEDSGEGRWCVKESVELGAPIPVIAQSFYERFSSREKDLFKN
FT                   KVLAVLRYEFGRHRVKKKD"
FT   gene            complement(336232..337032)
FT                   /locus_tag="aq_499"
FT   CDS_pept        complement(336232..337032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_499"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_499"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06747"
FT                   /db_xref="GOA:O66789"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016692"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:O66789"
FT                   /protein_id="AAC06747.1"
FT                   /translation="MKMNECKYTEPVKGYEIIFKEVETDKVVIPPIERPLSETLIERLV
FT                   SSIQKLGFIDPIMVVPEEQEGYYEVIDGQHRLEAAKIVGLEKVPAFVLPKELRNYILSF
FT                   NIEKAPALKEKAIQAYNLFMEKLQQNPDMKEYELEPFIEYPFYITIGFVIERLGDRKFP
FT                   GSYFERILQKVDEFLDMPLKEAEKERENRARKLEEVKIVLNQKAEELGITMSYEKHKIV
FT                   SYAFQKLYGKGVRFLGEDFYTVFDNLKQAIQELTPEELGLTQGT"
FT   gene            complement(337114..338085)
FT                   /gene="trxB"
FT                   /locus_tag="aq_500"
FT   CDS_pept        complement(337114..338085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="aq_500"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_500"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06756"
FT                   /db_xref="GOA:O66790"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66790"
FT                   /protein_id="AAC06756.1"
FT                   /translation="MAVSLMQQPDKVYDVIIIGAGPAGTTAAIYTARAGWKTLVLYRAE
FT                   ADGALGVTQKIENYPGVPGPLSGYELLKIMREQAKSFGAEFVRGKVIATDLNSDPKKVY
FT                   TIDGREFRGKTIIVASGAMERANKFKGEEEFLGRGVSYCGVCDAAFFKDQPVAVIGDDD
FT                   YAIEEAEFIARFANKVFFVVPGSKIKAPPEVIEHFEKLPNVEILLRHRPIEIVGDQVVK
FT                   GIKLKDLEKKEEKLLEVNGVFIFLGGTKPSVDFLMGQVEMTEGDCIVVNEEMMTSVPGV
FT                   FAAGDVLCNEVKQAVVAAAMGCKAALAVDKFLSGKKKIVPQW"
FT   gene            complement(338228..339727)
FT                   /gene="pmu"
FT                   /locus_tag="aq_501"
FT   CDS_pept        complement(338228..339727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmu"
FT                   /locus_tag="aq_501"
FT                   /product="phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_501"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06757"
FT                   /db_xref="GOA:O66791"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:O66791"
FT                   /protein_id="AAC06757.1"
FT                   /translation="MEQGYRTISRKTLRPLQKDIRKITFLCKAECSRKRIIQYSIMIKF
FT                   GTDGWRARIAEEFNFDNVRRVAKAHAEVLKEKGVKRVIVGYDWRFRSEDFAKAVYDVFR
FT                   SEGLEAKLVGSACTTPMVSFAVKYLGYENGVMITASHNPPAYNGYKIKESFGGSATPEF
FT                   VKNVEEKVKDIESVEIKEFEPEYQEVRKKYVEKIREFFDMDLFKEKKTLVVHDSMHGTS
FT                   SGLLDFVLRDTKVSVINIRKDRDPLFGGHPPEPIEKYMEITKEKVRALGAELGIANDGD
FT                   GDRIALVDDKGNYVNTQLIYAMLLLHLLENKGKRGKVVKTVSTTYLADRICKEFGVPLI
FT                   EVGVGFKNINEIILKEGGVIFGGEESGGYGIPEYLPERDGIFSALNILELLYLKDKKVS
FT                   EVVAEIFERFGEAYYKRVDLRVKEKIKGRIKELKENPPERIGEFKVREVKTIDGVKFVF
FT                   EDDSWLLMRPSGTEPLIRVYAETPTKEEVEKIIQKGLELLK"
FT   gene            complement(339619..340080)
FT                   /locus_tag="aq_503"
FT   CDS_pept        complement(339619..340080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_503"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06760"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:O66792"
FT                   /protein_id="AAC06760.1"
FT                   /translation="MGIGGDYVWKRKPDVFLGIRKDWDFYDFYVSAYYMTRKPQLLFSV
FT                   KAGRFLAGDKGVRIEVSRIVKGFEVGFWYTYSDTSDFTGPNKNYHDKGVFVRIPLRIFN
FT                   LRDVKQIASFSLAPWSRDIGQLAGRPFDLYRKIYEKLPFYVKQNAAEKE"
FT   gene            complement(340164..340583)
FT                   /gene="otnA'"
FT                   /locus_tag="aq_504"
FT   CDS_pept        complement(340164..340583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otnA'"
FT                   /locus_tag="aq_504"
FT                   /product="polysaccharide biosynthesis protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_504"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06755"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:O66793"
FT                   /protein_id="AAC06755.1"
FT                   /translation="MEDGDMIYVPRKPSAVLVFGEVQNPSAILYKPGLKVKDYIALSGG
FT                   FTRDADVDNVFIIKANGIAISQESGKSLIEWDSERKRFIWGWAYNDILNYKLEPGDAII
FT                   VPTKIKIPTMWRPLIRDVIQIIYQSALTVYTITKL"
FT   gene            complement(340614..342791)
FT                   /gene="otnA"
FT                   /locus_tag="aq_505"
FT   CDS_pept        complement(340614..342791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otnA"
FT                   /locus_tag="aq_505"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_505"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06754"
FT                   /db_xref="GOA:O66794"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:O66794"
FT                   /protein_id="AAC06754.1"
FT                   /translation="MQGRDTVRMWRDRKMKVFLRSLILIFVAAFLFVYAKDKPQPKKLP
FT                   KYKNLISKIEKEFSSRNSTPLRQFGYEFFMTPLDVSKLVLPVSENYKLGPGDEVIIYIV
FT                   GLPSNQEIPPVIKTIVDREGNISIPNLGVFNVWGLTLKETEELLRQELGLDLKVTVGEI
FT                   RTFVIYVAGEVNRPGTHVATAVNTVIDALSIAGGVKKTGSLRNIILTRKTPSGLKTYNI
FT                   DLYDVFIKGKPIDLTLRDGDTILVKPIGPTVAIAGEVKRPAIYEIKGGETIKDLIELAG
FT                   GLLPSSYQYKVILQRYENGKLRIIEDSLTNKAFMNENLRDGDLVLIKKSADIPENSYSI
FT                   EGYVTLPGVYEYKEGLKLSDILNPDLFFKDTNLKFAVLVRQYPKGSIPKYIAFSPEKVL
FT                   TGKEDMELKPYDRLIFFKLGQSVGKKINLNLVKNYVLVSGYYKYTGPVACSDDCYISEI
FT                   LQKDLILKDTNLNYAEIERFNPKTLQREEIIKFKPIEVLNGSKDIKLQSWDRIVFYPEF
FT                   VYEPVRISGEVERPLWVTYKPGLTLEEAISQVKFKYPLGELKVIVKQDKKVEVFYLNDL
FT                   RKHPSPLSFVKLKPGTEIVVKRVKEDETVTKVYVYGQVWKPGVYKIGERTTLYDVLKAA
FT                   GGFKPMAYPKGIVILRESIAQMQRERLNKAMVFLKAQLEKEIAGYMQAELPKEQKEAYK
FT                   EAFAAKRRLLQEMEKVQVTGRLVGLNIPPDI"
FT   gene            complement(342733..344034)
FT                   /locus_tag="aq_506"
FT   CDS_pept        complement(342733..344034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_506"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_506"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06758"
FT                   /db_xref="GOA:O66795"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:O66795"
FT                   /protein_id="AAC06758.1"
FT                   /translation="MFLRLKKSSIYFLRSSIVSIFAIVSLKFIRTLNLASYKMISSMEE
FT                   KSIDRKSEKLGYPMYEEDEIDLYELWVVLKKRFRVILLTLVIFIAGAVAYVFIAPPVYK
FT                   TEAVIFPIGGEKTNLPSILEGLPVPLPSVADKVTVESVLKSRTLRERVIEKLNLMPVLF
FT                   KDLWDESRNTWRQDLEPEDIPTILDGAELLEDLISVSSNKKTGTITFSVEFPEDPHMAY
FT                   KIAQVSLEEAYKILNEKSWSLAKKHRIFLENQIKEVLNKQKVLEEVYLKFIKGEIKEVP
FT                   IVVDERFISKIFKESLNYENNDKFDIPGNLKQNLERNIPIAKGMNRNLPEYQFNYQKLQ
FT                   WQFEVLKNLLSTLFQQYQIAKANEVKESVSFQIIDPPYIPQKPAKPKKALILAVSFVSG
FT                   LFTGIFLAFFKEWLNNARKRYSENVEGQENESVS"
FT   gene            343742..344278
FT                   /locus_tag="aq_507"
FT   CDS_pept        343742..344278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_507"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06761"
FT                   /db_xref="GOA:O66796"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:O66796"
FT                   /protein_id="AAC06761.1"
FT                   /translation="MNTYATAPAIKITRVSSITLNLFLSTTQSSYRSISSSSYIGYPNF
FT                   SLFRSILFSSILDIILYDAKLSVRINFKLTMAKIETIEDLRKYIEDFFKRRNKKVKVIL
FT                   FGSRARGTHTSYSDVDIAILSDENIDNDLILLREEIENSLLPQKVDIVGFSKLEESFKE
FT                   EILKEGKVWIDLTKS"
FT   gene            345070..346395
FT                   /locus_tag="aq_509"
FT   CDS_pept        345070..346395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_509"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06762"
FT                   /db_xref="GOA:O66797"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:O66797"
FT                   /protein_id="AAC06762.1"
FT                   /translation="MGIEEKLTTASKIKSLLNIREQEKVLDALIRSSFINILARGFGYL
FT                   KHVTIAVVLGFNLQTDAFFMALSLIGIFLIFADVFDSIGVPNLVDARLKSQEEFKKLSG
FT                   LLFTFTLILTFLTGFLAIGFYPFVLKIPVGFNMEALSYTQVAYFLLLPYLLFNFLFHHF
FT                   GAVLRSVRRFTVYFVGEFLFSFFSFLFIFLGLIFYNKWLVLPLSISFAQIIATLYMFYV
FT                   GREFIHINFFLNQTTKKILNHFFYLSALYGVLHLFIVIDRAFGSLLGEKSISAIHYGLI
FT                   VASIPRGIIRLENIAITSLSESKGDIKKLNFYIKRILIVSGISLLFFFVFAEIIVKLLF
FT                   GYGAFTQMDLILTVEATRFYSLSLPFMFLWPILYRVFQIKENLKPVFFIAISGITVNGI
FT                   LNYFFVLKLNYGIKGIALGTLGAYIVICSLSYIILYYKYRRN"
FT   gene            346396..346866
FT                   /locus_tag="aq_510"
FT   CDS_pept        346396..346866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_510"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_510"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06759"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O66798"
FT                   /protein_id="AAC06759.1"
FT                   /translation="MVKSDYTRCPICETQKNVNQYIDTYISPFNNQEYKLYECSNCKLQ
FT                   WWEPLKIIPEFYENEVFDSYISFHEGIRSRIGKNHEAFFKYVPKNVKGKLLDIGCGDGV
FT                   FLREAQKYGFEVWGIDFDKKSVETAKKNLGVKTIYAMSLEEFHKFAKDNNIR"
FT   gene            346905..347546
FT                   /gene="murB2"
FT                   /locus_tag="aq_511"
FT   CDS_pept        346905..347546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB2"
FT                   /locus_tag="aq_511"
FT                   /product="UDP-N-acetoenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_511"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06751"
FT                   /db_xref="GOA:O66799"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:O66799"
FT                   /protein_id="AAC06751.1"
FT                   /translation="MEAFAGTPLKDLIRFSVKENIRNFYKLLGFPASVGGAVSMNAGAF
FT                   GVEISDFLKEVYFVDWEGKLQKAKRDELSFSYRKSPFPELGIVYKVVFELGKSEENILP
FT                   KYEKIRRIRKEKQPINFPTSGSTFKNPKGNFAGKLLEEVSLKGFRLKNVGFSEKHANFL
FT                   VNYGGGTFSEVVDLINIAKERVYENFGIVLEEEVKLIESSGSDGWKVLGA"
FT   gene            complement(347383..348366)
FT                   /locus_tag="aq_512"
FT   CDS_pept        complement(347383..348366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_512"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06763"
FT                   /db_xref="GOA:O66800"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:O66800"
FT                   /protein_id="AAC06763.1"
FT                   /translation="MEQGYRTISRKTLRPLQKDIRKITFLCKAECSRKRIIQYSIMIKF
FT                   GTDGWRARIAEEFNFDNVRRVAKAHAEVLKEKGVKRVIVGYDWRFRSEDFAKAVYDVFR
FT                   SEGLEAKLVGSACTTPMVSFAVKYLGYENGVMITASHNPPAYNGYKIKESFGGSATPEF
FT                   VKSVEEKVKDLESVEVREFEPEYQEVRKKYVEKIREFFDMDLFKEREALIVHDSLHGSV
FT                   FPVPSVKGYKYFIGLYLEEFTGKFLVKVKLVNFVPQFFQCVGNRLSRFQGNFTLRGPST
FT                   HQNHYSQSVLPPPPILYRSFRKPFLLQCLSNPPLPKMFPLRNSQGS"
FT   gene            349447..350571
FT                   /gene="mtfB"
FT                   /locus_tag="aq_515"
FT   CDS_pept        349447..350571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtfB"
FT                   /locus_tag="aq_515"
FT                   /product="mannosyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:aq_515"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06752"
FT                   /db_xref="GOA:O66801"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:O66801"
FT                   /protein_id="AAC06752.1"
FT                   /translation="MIINIMERLIMNSIYIDGLFYKGSGIGRYYEFSIQELSQYAIIYI
FT                   YVPMKFKNEFYQQFGNNDKIVPISTKYEKFSLKGLLIQSKILKSLENKVYLFFFPHINL
FT                   PLYISQNTVVTVHDLRPFTEYWDRGEFKKLIIKKLFFDRAIKYSKAIISISKTTKNDLL
FT                   KFYSEVQNKIVVIYETFSINKKSTETKQNIVGDYLLYVGQFKKHKNLDRLLKAFSMIKN
FT                   KIKCKLVIAGKKDNIDIYNSIKSLNLGDRVVVIKNPSDGELINLYKNAKFFISPSLYEG
FT                   FGLPPLESLNYDVPVILSDIPVFREIYEDIAIYFNPFSEENIAEKIIFALSNYNSIKQK
FT                   TVSEKDKIFNKFEKRKIVKQYLELFNKIIKGELA"
FT   gene            350568..351674
FT                   /gene="mtfC"
FT                   /locus_tag="aq_516"
FT   CDS_pept        350568..351674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtfC"
FT                   /locus_tag="aq_516"
FT                   /product="mannosyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:aq_516"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06753"
FT                   /db_xref="GOA:O66802"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:O66802"
FT                   /protein_id="AAC06753.1"
FT                   /translation="MKVLHLGKLCPPNEGGIEVFSYDLLEYLNSKGIKADLLCFGNRTF
FT                   NDAYRGFNFFSCKMNVKLNSAPLSYDFVKTFKKIEKNYDIIHVHSPNPLAEILSLFSHK
FT                   KVVAHWHSDIVRQKFTYFFYKPFQHMYLKKAIRIICTSPQYLQTSKQLEGFRNKAVVIP
FT                   LGLNPKRLMSDYVDEKFKDFIELKNKGRKIVLSIGRLVEYKGYKYLIEAAKYINNNISI
FT                   VIAGSGPLFQSLEEKIETLNLKEKVFLFGRINNVSLYMKNCDVFCLPSITRNEAFGLVL
FT                   VEALYFGKPLITTDVEGSGISYVNQNGITGLVVKPKDPKALAEAINKILKNENLYKQFS
FT                   ENAKKRFKEFEISNIGDKILNLYEEVLK"
FT   gene            351738..352151
FT                   /gene="spsK"
FT                   /locus_tag="aq_518"
FT   CDS_pept        351738..352151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spsK"
FT                   /locus_tag="aq_518"
FT                   /product="spore coat polysaccharide biosynthesis protein
FT                   SpsK"
FT                   /db_xref="EnsemblGenomes-Gn:aq_518"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06769"
FT                   /db_xref="GOA:O66803"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O66803"
FT                   /protein_id="AAC06769.1"
FT                   /translation="MNGKAGASSKGGNFVYTIIRKAKAGEPLRVVDDIYMSPTYTLDAA
FT                   KEIWKILLENKPYGIYHVTNSGYCSWYEFAVKILEYSGLKTDIKPVRHTEFKTKANRPL
FT                   WSPLASKRGIKLRNWEEALKDFINAISINNLSY"
FT   gene            352120..353193
FT                   /gene="rfe"
FT                   /locus_tag="aq_519"
FT   CDS_pept        352120..353193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="aq_519"
FT                   /product="undecaprenyl-phosphate-alpha-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_519"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06768"
FT                   /db_xref="GOA:O66804"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:O66804"
FT                   /protein_id="AAC06768.1"
FT                   /translation="MLFPLITFLISFFLCFLFIKYINLNLFHDTQKGVQKFHHRPTPRI
FT                   GGLAIYLSVLLVSVIFILLNKPFSKEFFLFIMSAFPVFFSGLLEDITKKVSPKWRLLIG
FT                   FISGILAFYLISAKVTRVDIPFVDSLLSIPLISLLFTAFALAGVSHAFNIIDGFNGLAS
FT                   GVAMLVFGAYAYVSFLHNDLFLVYLNLLLIAATLGFFLWNYPFGLIFLGDGGAYFLGFC
FT                   AGAIGAILVNKYPDISPWFPMLLVIYPVWETLFSIYRRKFLKDYPPHMPDALHFHQLLY
FT                   RRLLKFTLGSNIEPFKRNSYTSPFLWVMELICLVPAVLFWDNTPILMLFTFAFIVFYTW
FT                   LYFRIVKFKTPKIFRIK"
FT   gene            353194..354087
FT                   /gene="murB1"
FT                   /locus_tag="aq_520"
FT   CDS_pept        353194..354087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB1"
FT                   /locus_tag="aq_520"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_520"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06766"
FT                   /db_xref="GOA:O66805"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66805"
FT                   /protein_id="AAC06766.1"
FT                   /translation="MLFLKNVPLQNLTTIKIGGRVSFYAEPSDLKEISLCIDFSKSRDI
FT                   PLFVLGNGSNTIFGDVRGLVVNLKNLKGFKVKEIKGKFFVEAFSGTPLKDLIRFSVKEN
FT                   VKSFYKLLGFPASVGGAVSMNAGAFGVEISDFLKEVYFVDWEGKLQKAKRDELNFSYRK
FT                   SPFPKLGIVFKVVFEFERSKENILPKYEKIRRIRKEKQPINLPTSGSTFKNPEGNFAGK
FT                   LLEKAGLKGFRLKNVGFSEKHANFLVNYGGGTFSEVVDLINIAKERVYENFGIVLEEEV
FT                   KLIESSGSDGWKVLGA"
FT   gene            354044..354919
FT                   /gene="ddlA"
FT                   /locus_tag="aq_521"
FT   CDS_pept        354044..354919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="aq_521"
FT                   /product="D-alanine:D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_521"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06765"
FT                   /db_xref="GOA:O66806"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66806"
FT                   /protein_id="AAC06765.1"
FT                   /translation="MRVVVLMGGRSSEREISLKTGKAVAKALRELGHEVYELDLDKELP
FT                   CKLLEIKPDKVFIALHGRYGEDGTVQGLLEILDIPYTGSDTIASAVSIDKDFTKRIVKS
FT                   LGINTPDWETFISEGDVLNTEWNKFPAVVKPVREGSSVGLKIVESLEELKEYALDLLKK
FT                   TERVMVEEFVEGRDMTVGILKGEALPVVEIIPKKGVYDYECKYTKGMSEYRILKDEKLS
FT                   KKLQEISLKISKFLSLKDFARIDFRVTKEGKIFFLEVNTIPGMTELSLLPMAAKEKGMD
FT                   FKKLISIIIT"
FT   gene            354930..355580
FT                   /locus_tag="aq_522"
FT   CDS_pept        354930..355580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_522"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_522"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06775"
FT                   /db_xref="GOA:O66807"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66807"
FT                   /protein_id="AAC06775.1"
FT                   /translation="MRGILGLVFGSVILIYLISLFLMKHPFFQIREIKVSGLYVEEIEK
FT                   IEKDIHALGRGLLVIPESNILELFNEKLNNRFQGVEINKRFSTEGITIEMNFQRRKAIS
FT                   FVNINEKKFLMDMEGIFFWDEYQKPDKTLFIYSKEVFQFFKQKILKLLTQGNSVKVYKD
FT                   KVMVDIGGKRFILPPLEDINEKEIHLMKKLLKLHPDAKIFDIRYKGFILLNEG"
FT   gene            355580..356830
FT                   /gene="ftsA"
FT                   /locus_tag="aq_523"
FT   CDS_pept        355580..356830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="aq_523"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:aq_523"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06770"
FT                   /db_xref="GOA:O66808"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:O66808"
FT                   /protein_id="AAC06770.1"
FT                   /translation="MKRLAALDIGSQKTVFVIGERDSYGDIHIIGFGEVPSRGIVKGVI
FT                   NDLSEAKGSILRAMKEAEAMAGLKVREVVYNVSGGTTKNGTVKSQNVKDTISISTKSSE
FT                   IEESHIQRLHERCLMKAKEEGYEIVYTAPRKYILDDHTEVKNPLGLVGSKLSVEMHVVK
FT                   VSTTILRNLEKAIREVGLNPVGRTVNAIASADSVLTHDEKEDGVLLLDMGAGLTDYSLY
FT                   TEGRPYITGVVPFGGINITKDLSYMLKIDTETAESVKVNHGVAFESLVDDEDVVKIKPR
FT                   GEDREIPIQKKQVAEIIQSRVEEIVEKVFKEIKARGVPLNQINSGIVVTGGTANLKGIR
FT                   ELIEHMTGLPVRIGLPQGIVGLREKIENPKYATVCGLLRQAFVSGTIDITESTNSNTGN
FT                   FFKNLSERFKKWFEELL"
FT   gene            356843..357946
FT                   /gene="ftsZ"
FT                   /locus_tag="aq_525"
FT   CDS_pept        356843..357946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="aq_525"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:aq_525"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06771"
FT                   /db_xref="GOA:O66809"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="PDB:2R6R"
FT                   /db_xref="PDB:2R75"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66809"
FT                   /protein_id="AAC06771.1"
FT                   /translation="MEEFVNPCKIKVIGVGGGGSNAVNRMYEDGIEGVELYAINTDVQH
FT                   LSTLKVPNKIQIGEKVTRGLGAGAKPEVGEEAALEDIDKIKEILRDTDMVFISAGLGGG
FT                   TGTGAAPVIAKTAKEMGILTVAVATLPFRFEGPRKMEKALKGLEKLKESSDAYIVIHND
FT                   KIKELSNRTLTIKDAFKEVDSVLSKAVRGITSIVVTPAVINVDFADVRTTLEEGGLSII
FT                   GMGEGRGDEKADIAVEKAVTSPLLEGNTIEGARRLLVTIWTSEDIPYDIVDEVMERIHS
FT                   KVHPEAEIIFGAVLEPQEQDFIRVAIVATDFPEEKFQVGEKEVKFKVIKKEEKEEPKEE
FT                   PKPLSDTTYLEEEEIPAVIRRKNKRLL"
FT   gene            357943..358707
FT                   /gene="moaC"
FT                   /locus_tag="aq_527"
FT   CDS_pept        357943..358707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="aq_527"
FT                   /product="molybdenum cofactor biosynthesis moaC"
FT                   /db_xref="EnsemblGenomes-Gn:aq_527"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06772"
FT                   /db_xref="GOA:O66810"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66810"
FT                   /protein_id="AAC06772.1"
FT                   /translation="MRTVDITTKIETLREAKAYGRIRLKPETVKLIKENKVPKGNLVEA
FT                   TKLSGIFGAKKTGELLPFCHPIPLDFVALEVKVNEDNLEVFSTVRGIARTGYEMEALTA
FT                   VTTALLNVYDMCKALDDSMVIEEVKLLEKSGGKSDWFRRLDGVKVNLHAENEGLRKIAE
FT                   DYLKELGATFAEEAELYISIGDNLPINKEIRSLERVISLYDFRRNPKEVGKEIRVGWSD
FT                   DALIIILPESEEKIRFFFETFGGIIGNLLCRR"
FT   gene            358695..359264
FT                   /gene="dedF"
FT                   /locus_tag="aq_528"
FT   CDS_pept        358695..359264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedF"
FT                   /locus_tag="aq_528"
FT                   /product="phenylacrylic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_528"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06774"
FT                   /db_xref="GOA:O66811"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="PDB:2EJB"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66811"
FT                   /protein_id="AAC06774.1"
FT                   /translation="MQKIALCITGASGVIYGIKLLQVLEELDFSVDLVISRNAKVVLKE
FT                   EHSLTFEEVLKGLKNVRIHEENDFTSPLASGSRLVHYRGVYVVPCSTNTLSCIANGINK
FT                   NLIHRVGEVALKERVPLVLLVREAPYNEIHLENMLKITRMGGVVVPASPAFYHKPQSID
FT                   DMINFVVGKLLDVLRIEHNLYKRWRG"
FT   gene            complement(359590..361632)
FT                   /gene="oprC"
FT                   /locus_tag="aq_529"
FT   CDS_pept        complement(359590..361632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprC"
FT                   /locus_tag="aq_529"
FT                   /product="outer membrane protein c"
FT                   /db_xref="EnsemblGenomes-Gn:aq_529"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06764"
FT                   /db_xref="GOA:O66812"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:O66812"
FT                   /protein_id="AAC06764.1"
FT                   /translation="MKRTLLLGALFSVAFAQEVNLEEIQVIGKREVLTEDVVRELPAKD
FT                   VGEALEYNIPGVWKVRKGAIANDVVIRGFKKDEVNQLFDGARVYNACPNRMDPGIFHVD
FT                   FSEVESVEVIKGPFDVRNYGAVGGTVNVKTKEPKEGMEGRITTYADNWSTINPSFYFSY
FT                   GKDRLSFLIGYAFRFGKPYEDGKGRKITEIYPSGNPSAYSQDERDSTAFNIHTAWAKLR
FT                   YKITDGVKFKLDYAHQRATDVLYPYLMMDGIYDEVDRVNLGLEGKRFKAQLYGSSVRHW
FT                   MTNPKRVISQNAPRGYTMGTYAKSKVYGFKGEYSFGDFSFGIDTFYRYWKAQTTMYMRN
FT                   MGMYRTQNTIPDVDVYNFGLYGEYRKKLSPKLRLVAGLRLDWSKTKADSGKANINLYRH
FT                   YHNTTDTSQTDVYPSGNVQVFYELKEGIELFAGLGSAVRVPDPQERYFALDRMGKMENT
FT                   MGDWVGNPKLDPERNNELDLGIKLTGERYSGELRTFLSYVKDYIYVYRATAPSSGNMMN
FT                   QNTKAMSYTNIDAYFYGFELSGSYAITDTIFFDGNVAYTRGRKDDTYPAKNITDKDIAE
FT                   IPPLTARLALRYDTGMYFGQVEGVLAATQDNVDSDLQEEKTSGYGIINLKGGVNYRNLR
FT                   VVAGINNLFDKLYYTHLSYLRNPFRTGVKVPEPGRTYYLSVSYTF"
FT   gene            361705..362493
FT                   /locus_tag="aq_531"
FT   CDS_pept        361705..362493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_531"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_531"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06776"
FT                   /db_xref="GOA:O66813"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:O66813"
FT                   /protein_id="AAC06776.1"
FT                   /translation="MGAKYSFLGYLLSGLLHGALLFSLTHAGLEVREQKSKEPVGLSLK
FT                   TLQIKKEEPKTVSTIKKSEKKTIKKEQKVVKKPKKTFKKKYKKRHRRKIVKPKKYAVKK
FT                   IHKTEKVKNVIAQKPKKVTKLTEKKVIHENNLGLHGKTNVLEGSPVKRINTYEQITVAK
FT                   KTEFSYKKEFLKINFEKIRNYVQERIKYPYIARRMGWEGKVILEIILSEKGCESVRVAH
FT                   SSGHKVLDRNAVETVKALCGKFPKPREKIRLRLPISYVLR"
FT   gene            complement(362461..363126)
FT                   /locus_tag="aq_532"
FT   CDS_pept        complement(362461..363126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_532"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_532"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06777"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66814"
FT                   /protein_id="AAC06777.1"
FT                   /translation="MKRFLLLIILFGISFSFVSDYLLRAESLFSQLKDANAKEETPYLY
FT                   GKVKGYYEAIKLYAVEYKEDRIKTLFTLMSKNTKKAVRGAYTEREPLTELITFEPRVYF
FT                   EEYCDGIMDECFYEKHYEKEKFIELVDYFSLKRRVEFLRNHEGKYCAPFDFGMAEALFN
FT                   AVSLELMQEKPDEKVLIALREKLEPILVMAEEKLRYAMKKELPCYRNRLSEHIGYWKP"
FT   gene            complement(363142..364284)
FT                   /locus_tag="aq_533"
FT   CDS_pept        complement(363142..364284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_533"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06779"
FT                   /db_xref="GOA:O66815"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:O66815"
FT                   /protein_id="AAC06779.1"
FT                   /translation="MKVFLKKGKEKKVKHFYPWVFRDEVEKIEGEGIVAELYDSEGNFL
FT                   ALGTYSPYSRIAFRVLSYEREEVNEEFFKRRLRESELLRRDIPSNAYRLAFSESDLLSG
FT                   LIIDRYGDAFVIQVRSYPMEILKEKVLKTLVEEFNPAFVYERSDFKGRREEGLKEFKGL
FT                   LYGKLENPLIIEEREFKFLVDVVEGLKTGFYLDQRDNREYVRNLVKEGDRVLDLFCYSG
FT                   GFSVYCANRGAKVVGVDINKRAVELARENAKLNSVKADFVLGNAFDFIQESKEEWDLII
FT                   ADPPAIAKTKKEKESILWAIWKLAYYSFQKLKKGGSLFICSCTYQISSEEMIRQVRLAS
FT                   TDVKRRIIIKSLNLQPIDHPYLPTFPESLYLKCLHAIVID"
FT   gene            364314..365306
FT                   /gene="draG"
FT                   /locus_tag="aq_534"
FT   CDS_pept        364314..365306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="draG"
FT                   /locus_tag="aq_534"
FT                   /product="ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_534"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06773"
FT                   /db_xref="GOA:O66816"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:O66816"
FT                   /protein_id="AAC06773.1"
FT                   /translation="MDEGVKEKFIGAVLGAAVGDALGKSVEDITEEEVFEFYGDRIRDF
FT                   VTPHPSSPAYGQLPEETSDETTIFRLLLESLVEKKALDVRDFLNRLMEWYDREEMHRYP
FT                   DPMLLTAIDLLSRGINPSTHGLTSFSVEGILRSVALGLYHYYNPELAAEGSKVVSLLTH
FT                   RSDVISDASAILGALIAHLVRGDFYLEDFREKLRLIETLKDYAKEEKHKKILDRVAELL
FT                   MESADLETAINTLGNGTFAFEAFPLALYIFLSNVENPEEALFQAVNSYGEFGGDTDAIG
FT                   FLVGAMLGAYYGEEAIPYHLRENVENSQKLRELAERLYEVVEKQVGFSQ"
FT   gene            365636..366295
FT                   /gene="lpxD"
FT                   /locus_tag="aq_538"
FT   CDS_pept        365636..366295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="aq_538"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine N
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_538"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06767"
FT                   /db_xref="GOA:O66817"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66817"
FT                   /protein_id="AAC06767.1"
FT                   /translation="MGSFIGDFVVIGKNVKIGRNVKIYPFTYVGDNTVIGDNTVIFSGV
FT                   HIYRNTVIGRNVRIHSGAVIGADGFGYHITQEGIKKIPHIGGVIIEDNVEIGANTTIDR
FT                   ALIENTLIGKNTKIDNLVMVAHNCKVGENNILVSQVGLSGSVKTGKNVILAGQVGVADH
FT                   VEIGDNVIVTAKSGVANNLAPNKTYGANLPAIEWSRWKRIYVYLLRLPELFKKITT"
FT   gene            366297..367154
FT                   /locus_tag="aq_539"
FT   CDS_pept        366297..367154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_539"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_539"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06778"
FT                   /db_xref="GOA:O66818"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66818"
FT                   /protein_id="AAC06778.1"
FT                   /translation="MLRAYIFYRLVKNTLLTAFILSLILLTLQLTRLSNVLFGIPFKDF
FT                   MGFLVVWNAYYTYFFIPEGVILSTFFLMKHFKDKKLLHVFYSFRISDFRIFLYCSIPFL
FT                   TFFLISALLSNTLLEEKVAFTRKNMLFKLQEKFFSEVPAGTFVSFGAVVLHAEKREGNT
FT                   LKEAFFKFGDITVLSEYLKYKGNGVFEFRRGTVITEEENYFVVKFNEYTLNLKQFQKKK
FT                   LREKRLKESKVVNYVNVATLPLFFFLSFTVALKFCHGGLSYYAFASLFIVVHQLIIFVV
FT                   KLML"
FT   gene            complement(367143..367787)
FT                   /locus_tag="aq_540"
FT   CDS_pept        complement(367143..367787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_540"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06780"
FT                   /db_xref="GOA:O66819"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66819"
FT                   /protein_id="AAC06780.1"
FT                   /translation="MIITWMEEFGVLFVKAFLSLLAIMNPFSSVPVVISLMNEYSKEEI
FT                   RVIALKASVYAFFILTFFLISGDLLFRFMGITLPAFKVGGGILLFLIALNLVQGEVTKE
FT                   KGKAHEIEAALRRDNIALIPLAMPLLAGPGSITTVLVLRGYLNTLEGKVALFCAIFLSS
FT                   FTAFVVYSLSTFFYRVLGRTGINLITRISGILLLAISVQFVVDGLKNLLKH"
FT   gene            368017..369240
FT                   /gene="bcpC"
FT                   /locus_tag="aq_542"
FT   CDS_pept        368017..369240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcpC"
FT                   /locus_tag="aq_542"
FT                   /product="phosphonopyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_542"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06791"
FT                   /db_xref="GOA:O66820"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66820"
FT                   /protein_id="AAC06791.1"
FT                   /translation="MDVISELVKKNGSKILLIVLDGLGGLPVKEGKTELELAKTPNLDK
FT                   LVKNSATGLHIPVDWGITPGSGPGHLGLFGYDPIKYQIGRGILEALGLGIDVKDTDIAV
FT                   RGNYATVEYRNGKPIVVDRRAGRIPTEENKRITAKLQEAIKEIDGVQVIIKPGMEHRLA
FT                   IVFRFPEKLSPGSDAINDTDPQQVGKEPLEPKGENPNAEKVAEVVRKFIQRATEILRNE
FT                   PKANYILLRGFSQKPDIPTMEERFGVKPCCIAVYPMYKGLASLVGMDVIEFEGSTIQDE
FT                   IDTLKKVWNEYDYFFVHIKKTDSYGEDGNYEGKVSVIEDFDAHLPQFLELKPDVLAITG
FT                   DHSTPSILKGHSWHPVPLLIHSPYVLGGTSERFTERECLKGELGIIPAVKITQLLLANA
FT                   LRLKKYGA"
FT   gene            369242..369778
FT                   /gene="hpt"
FT                   /locus_tag="aq_544"
FT   CDS_pept        369242..369778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="aq_544"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_544"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06788"
FT                   /db_xref="GOA:O66821"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66821"
FT                   /protein_id="AAC06788.1"
FT                   /translation="MKEIRGKKLKLLLKEEDIKRRVKELAKEIESSYSWEEPIVVVGLL
FT                   KGAFIFLADLVRAFDRFVFVEFMQVSSYGKGMKSSGTIKIVKDLDMDIEGKEVLLVDDI
FT                   LDTGLTMKEIHDYLLMKKPKVLKTCVFLDKKERRKVDFNADFVGFEVPDKFLVGYGLDW
FT                   GEYGRNLPEVYMVED"
FT   gene            complement(369760..370959)
FT                   /locus_tag="aq_545"
FT   CDS_pept        complement(369760..370959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_545"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_545"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06792"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66822"
FT                   /protein_id="AAC06792.1"
FT                   /translation="MQMYTDGERVFISRNYRVEGISKKDWIEKGEKKVVWQSAKLSETP
FT                   TLLTNTRFYLFGAGATYLMRMDRRSGQTEEIDFEKEIVDITSDLRDVYFITHEGIYKLD
FT                   AERFEKAKIERLAVSDILEKPIKTLDMIEDYLYVCAGNWLYKIRKDGEKVMEKALVDVR
FT                   KVLADYEGPVVITEDKVIYFTDELDTLANGFYEGEYIKAEHGAYQTYLLSSTHFSVFGR
FT                   TGERIAHVEYEHYRTFTEGLNHIYYYDEKEGDITYAFKRDLLGDDFINIDLVDTIALIF
FT                   ASLMAVEKAGHRVRIKEKRGFIDVDVNHKHVDMEKIFLTLSKYFPEIFYLYKNPGYYDE
FT                   IDNFAQNYDLFIKEGDQVKLNLDLLEKFSEIRQDFKTLQEDIVRDILPSRADFFQSSTM
FT                   "
FT   gene            371023..371922
FT                   /gene="dapE"
FT                   /locus_tag="aq_547"
FT   CDS_pept        371023..371922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="aq_547"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_547"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06782"
FT                   /db_xref="GOA:O66823"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:O66823"
FT                   /protein_id="AAC06782.1"
FT                   /translation="MVIREAVKETLKELIRIPSVSGKEKGVLEYVENRLKSLGIPLKRQ
FT                   EIEKDRYNLVYDNGSEYLISVHVDTVPPAGFRDAYRPKEVNGRIYGRGASDVKGAIASL
FT                   ITAVEWFKKDFPEKELPVSLAFVVDEEQNTALGSENLPKCLNGKRKCIVLEPTYGLVCT
FT                   KQYGAYEFSVKIKCKSAHGSEFEKVENPVKVFIKLLNKLEEVLKREVNVIMVRSGTKVY
FT                   TVPKTCEALLEFKVFEGERKEELEKKVQEVVSALNTECEITVKLEGFEEFQEFNTDGLL
FT                   DVVKKALLKGGRRSKRKG"
FT   gene            complement(372081..372647)
FT                   /locus_tag="aq_548"
FT   CDS_pept        complement(372081..372647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_548"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06795"
FT                   /db_xref="GOA:O66824"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66824"
FT                   /protein_id="AAC06795.1"
FT                   /translation="MDLTFEKINENPTRAWASLVVVELKTLKPVYQHVVKDIVDFPYIP
FT                   TFLAFREMPLLLKLYETAKVKPDVYFIDGQGIAHPRGCGIASHFGVETGEVTVGVAKSK
FT                   LFGYAKEPAPQRGSYTYLKYKGKIIGAVVRTKDNTAPVYVSVGHRISLKTAIDLVLKTS
FT                   KYRVPEPTRLAHNLLQVVRRKELRR"
FT   gene            complement(372746..373339)
FT                   /gene="trpG"
FT                   /locus_tag="aq_549"
FT   CDS_pept        complement(372746..373339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="aq_549"
FT                   /product="anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:aq_549"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06781"
FT                   /db_xref="GOA:O66825"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:O66825"
FT                   /protein_id="AAC06781.1"
FT                   /translation="MKVLMIDNYDSFTYNLVQYLGSLGADVIVRRNDQIRLEEVREINP
FT                   DAIVISPGPCTPKEAGISVPLIKTYYKEYPILGVCLGHQSIGYAFGAKIVRAKRLMHGK
FT                   TSQIFHTGEGVFKNLPSPFTAVRYHSLVIDKNTLPEELKITAWSDDEEIMGIEHKEYPV
FT                   YGVQFHPESVLSEHGMEILKNFLELAEERKLVKK"
FT   gene            complement(373336..375117)
FT                   /gene="nuoD1"
FT                   /locus_tag="aq_551"
FT   CDS_pept        complement(373336..375117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD1"
FT                   /locus_tag="aq_551"
FT                   /product="NADH dehydrogenase I chain D"
FT                   /db_xref="EnsemblGenomes-Gn:aq_551"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06787"
FT                   /db_xref="GOA:O66826"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR026662"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66826"
FT                   /protein_id="AAC06787.1"
FT                   /translation="MPWAKEGDLQELLKAFPQASVVELQNSTSVIVPKDILIDVLKYLK
FT                   EKLGYKLFLDHSVVDLKDLLENEKEFNKVVKQNLIAFPEDRESRFQAFYILYNVDERKR
FT                   VIVKTRTNGKLPTIEKLWFAGKWAERECYDMFGIEYEGHENLVRAFMWDTYPYFPLRKD
FT                   FPLEGIPEQELPSLNEVVFGDNLEGLMNYDRMHTRVPTLEDLEVTEKKRLKKKAQIVLN
FT                   WGPLHPGTHGTMWFLFDLEGERIVQTDVILGQLHRGVEKLAEHEMYNQFLVYTDRMDYL
FT                   SALCSNQAWVVAIERLMGIHDKVPPKAKYIRTMMSELQRINSHLLWLGTYALDLGALTI
FT                   FLYAFKEREKIMDIIEGITGARLTISYPRIGGVRMDLPEGALEVIKAFIKKFPEELKDW
FT                   ETILTRNRIWLRRNKEVGIISKEDAYFHGVTGPVIRGSGIPYDIRKFEPYDAYDEVEFD
FT                   IPVGEIGDCYDRYLVRIEEMKQSIRIIEQCVAKLEKMSKNEPFFYEGEGKKLKLSLDGI
FT                   GVKAPVGEIYSSGENPRGELGFYVVSTGGTSPYRVKIRPPSYYNLCIYPHLMKDRYVAD
FT                   AVTILASIDPVVGETDR"
FT   gene            complement(375161..376495)
FT                   /gene="sms"
FT                   /locus_tag="aq_552"
FT   CDS_pept        complement(375161..376495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sms"
FT                   /locus_tag="aq_552"
FT                   /product="ATP-dependent protease sms"
FT                   /db_xref="EnsemblGenomes-Gn:aq_552"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06790"
FT                   /db_xref="GOA:O66827"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66827"
FT                   /protein_id="AAC06790.1"
FT                   /translation="MGKNKTAYVCQECGYKSVKWLGKCPSCGEWNTLVEEFEPQSFSLV
FT                   KKEPSLVLPVTDWEKEEHERETTGFESLDNALGGGLVKGQVILIAGEPGIGKSTLLLQI
FT                   SDRVANGKKVLYVSGEESGTQIALRAKRLGINNENLLVYPEVNLEKILQTLEKEKPSLL
FT                   VLDSVQTIFSERLESSAGSVSQVREVTYRITEFCKEKNVPAFIVGQITKEGSIAGPKVL
FT                   EHIVDTVLQFEGERFNFYRIVKVIKNRFGSTGEIAVFKMTDKGLEEVPEPSAFFISEKA
FT                   NAPGSVVFPHTEGSKPVLLEVQALVIPALYTTPQRRTQGFDPNRLALILAVLEKEAKIF
FT                   TRDQDVFVNVAGGMSVKEPAADLAVAMAVVSSKKEKEVPKDFVIFGEVGLSGEIRAVHF
FT                   GDLRLKEAKRFGFKKALIPKSLEIEIDGMEIYPVSHIQEAIEVLF"
FT   gene            complement(376504..377196)
FT                   /gene="frdB1"
FT                   /locus_tag="aq_553"
FT   CDS_pept        complement(376504..377196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB1"
FT                   /locus_tag="aq_553"
FT                   /product="fumarate reductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_553"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06784"
FT                   /db_xref="GOA:O66828"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:O66828"
FT                   /protein_id="AAC06784.1"
FT                   /translation="MLFMHLKLKVFRYNPETGERKYDYFEVPYEEGMTFLRAFQKIKEE
FT                   IDPSFSFRAFCRAGICGTCTVFIDGFPKLACKEQTLPYVLSEQIVTVEPLDKFEVIRDL
FT                   VVDNEEVINRMKKFRTWIKEYQGEVRIPPEVNKKIEKGADCILCSACQSYCPQVLEEEY
FT                   AGPLFFAKIYRFLEDPREEDKEFRIKEALEGHLYHCLSCNKCNNACPKEVEPATLIREL
FT                   MLVKSEIS"
FT   gene            complement(377232..377948)
FT                   /locus_tag="aq_554"
FT   CDS_pept        complement(377232..377948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_554"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06794"
FT                   /db_xref="GOA:O66829"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66829"
FT                   /protein_id="AAC06794.1"
FT                   /translation="MRLDKYLSKSLHISRKEAKELIREGRVKVSGKVVKQAEYRVKEGE
FT                   EVEVEGKSVKPKKNVYLMLYKPKGYLSTTEEDKKYPSFLELIREHFPSRKLFSAGRLDV
FT                   DAEGLLLITDDGELAHRLTHPKWKVEKEYIVRLDRDIGDEELKKLYEVKLEEKPVQLVK
FT                   AEKLSGDTVKAILTEGRHHVVKRLFKAVGHNVVYLKRTRVGNLRLDENMEPGEWRELTE
FT                   EEVKELKRLVKYNPQN"
FT   gene            377884..378687
FT                   /locus_tag="aq_555"
FT   CDS_pept        377884..378687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_555"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_555"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06793"
FT                   /db_xref="GOA:O66830"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66830"
FT                   /protein_id="AAC06793.1"
FT                   /translation="MSSFASFLDMWRDLDKYLSSLTIFNIQSSFMRIFLLFLFFVLFTF
FT                   GVEGYVIEEINGSTGLRIHKEIKRKVYITEDALITETEKEFMVQKIENGLPRIYRVIKS
FT                   SKSYMDFSKMTPLFLVSLPFLDCKQRVCVVNRGAFRPTNEYKKIRGFKARKVVVESHAL
FT                   GKKTTLIQWYTKEWKELVEANRLEDKFYVNFIRAIMKEKNLSEANIPLKEIQNFLKEIN
FT                   EKFGGVVRTQQQMPLFNTYSEVISVKKTEIPDYIYKLPEGYTKIK"
FT   gene            378689..380425
FT                   /gene="pbpA2"
FT                   /locus_tag="aq_556"
FT   CDS_pept        378689..380425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA2"
FT                   /locus_tag="aq_556"
FT                   /product="penicillin binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:aq_556"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06783"
FT                   /db_xref="GOA:O66831"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:O66831"
FT                   /protein_id="AAC06783.1"
FT                   /translation="MEYLRVYQKRERVFKRRVILFVILSFLAVLLLLGRILYINLFKED
FT                   ALKGAVKDAEVVQIQTYRGSIKTSDGKILALSYPVAYVYASKFYRFRDTVKREKFIKEL
FT                   SKLLGVRESVLRKRIKENESKTFFELITFPVHLKDEVRKLIKSIDYDEESKEFTKPYLS
FT                   SFVGVDERYKRYYPHGNFASNLLGFVTEKGYAAEGIERLFDEYLRGGEEPIKYLVYKNK
FT                   GITVVESLGTQIYTPKDLTLSIDFRVQALLEEVKKRIVKKWRPKKVVLIVMETSTGKVR
FT                   GYTTYPDYDPNKYERYPYWRIRNFGVTDRFEVGSVFKPFLVAFALDRRKIRKDTLININ
FT                   YGKIKVHKKYVRDVTPYLWKKEYITPRELLVHSSNVGAIRVGLMLKPEEYYELFKTFKL
FT                   LRSPGVLEGEVKPSISDLKYKVNRAYASIGQGVAFNPLHLITSFNALVNGKYVKPSFVE
FT                   EEKTEAEKIQIKPSTVKWIRDVLIEVVEKGTGKRAKSEYYFAGGKTGTAQKYDSALKTY
FT                   SKEKLVTYFLGFFPSEPKFTVLILVDEPKGKNLYGGTVAAPYFKEIIEKIGVIYGVKRD
FT                   RT"
FT   gene            complement(380398..381060)
FT                   /gene="bioD"
FT                   /locus_tag="aq_557"
FT   CDS_pept        complement(380398..381060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="aq_557"
FT                   /product="dethiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_557"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06785"
FT                   /db_xref="GOA:O66832"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66832"
FT                   /protein_id="AAC06785.1"
FT                   /translation="MRLLITGTDTGVGKTFITYNLAKELKERGYKVGCLKPVETYVREV
FT                   PEDGSLLSKATGQSVNEIVPVRFSLPLAPYAATLEEGRDFALEELGKHYEELSKKYKFL
FT                   LVEGAGGIAVPIKKNYTYANLARDWKLKVLIVGRAGLGTINHTFLTWYYAKATGLEVIG
FT                   IILNGFTGEDVSERTNPQIIEEMTGIKPYKVPRIQDVELPKDIRTGLADYVLSRFTP"
FT   gene            complement(381057..381704)
FT                   /gene="thiE2"
FT                   /locus_tag="aq_558"
FT   CDS_pept        complement(381057..381704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE2"
FT                   /locus_tag="aq_558"
FT                   /product="thiamine phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_558"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06786"
FT                   /db_xref="GOA:O66833"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66833"
FT                   /protein_id="AAC06786.1"
FT                   /translation="MNLTIYLITDDKYFKDRDLFNTIEQALQGGVTAVQYRFENKTTRQ
FT                   MYEELVKLRELTRKYNADLVVNDRVDLALAVEADGVHIGKDDLPPEVVRKIVGDKMYIG
FT                   YTANSLEEVKRAQELPVDYIGFGSIYHTSTKENYKLVGVEALKEAVKISQKPIVCIGGI
FT                   MPYRVPEVVRAGCRNIAVSSGILGFADVKKAAESIKRAYQETLRMLMLMGKV"
FT   gene            complement(381742..383304)
FT                   /gene="recN"
FT                   /locus_tag="aq_561"
FT   CDS_pept        complement(381742..383304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="aq_561"
FT                   /product="recombination protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:aq_561"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06789"
FT                   /db_xref="GOA:O66834"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66834"
FT                   /protein_id="AAC06789.1"
FT                   /translation="MLGRLYIQNFFFIRDVEVEFERGLNVITGETGTGKSMTISAIEFL
FT                   MGKQGDYPEGTAVELELLGEEEIILRREVKKGRSRYYVNGKGASKSTVLELLEGKISLQ
FT                   GQNEFINLFREDFQRKLLDTFANLNDKVKELEKVYNSLRKKEQELFEFLRKKEELIQKK
FT                   DYLEFRVREVEEIGISSEEYEELKNKANLINNLEKVKKAVGESLYKLLEGENSVYEILG
FT                   EIRKNLAKVESYSGKFSELIEKIANLEEEVYELYNSLKEEMPEISEEEVNEINEKLFRI
FT                   QRLEEKYKKSFPEILKEVEEIKEELSNLNSVDFKEEELREEVEKLREEYDKLAEEVSRD
FT                   RRKKAEDLEERIEEILKELNLERAKLKVEIKESEPTKYGKDKIEFLFSSYGKDFKPLEE
FT                   VASGGELSRLFLALSLILPASETYVFDEVDAGISGETSFKVAKFLKELSKKMQVIVITH
FT                   SAPLCAAGDKNFKTEKKFLGDIPYIVVRELSEEEKVEEVARLMGMKSEKTLEGAKELVE
FT                   AFK"
FT   gene            complement(383315..383386)
FT                   /locus_tag="aq_t06"
FT   tRNA            complement(383315..383386)
FT                   /locus_tag="aq_t06"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:383352..383354,aa:Thr,seq:cgt)"
FT   gene            383468..385324
FT                   /locus_tag="aq_563"
FT   CDS_pept        383468..385324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_563"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06808"
FT                   /db_xref="GOA:O66835"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:O66835"
FT                   /protein_id="AAC06808.1"
FT                   /translation="MRHNLLLKLLALWGVSLTILLVFALIFIRKSTLKPAKDRALTTAQ
FT                   LVRDALTTLMVSNAMDKREIFLEEIKKVQGLKEIRVIRGEAVVKQYGPGLYSERPKDPL
FT                   EKEVLATGKVKEEILEDINRVLYRVIIPYKAEPSPILNCMQCHKVKPGEVLGAVSITMD
FT                   LTPYRNFGFFIFFSLGAIALTVAFITFLIVYGNIKNVSTFIDELDKVFSAFEKGIFYER
FT                   LSLETLKGEIKDFGKKINKVLDILDNAFKDIREKVYALLGYSIMETENELRDTEKVIDE
FT                   LVRISQFKRTIELDNSLEEVYKRLESVLSNYMSLDKFSIYEVTDDNRIKKVAVHGRELW
FT                   CSEIILKDANECRAKRTGQDVDSEEFECVCPNFAYCANENSNKKYCYYCIPVNVGGKIG
FT                   NVVQLVYERELKDFVKLLIPYIKGYLREATPVIESKKLMEKLKMQSYIDGLTGAFNRRF
FT                   LEEIADKIVAQTLRRNSNLGILMIDVDFFKQVNDTYGHDAGDEVLRQIARVIKDNIRKA
FT                   DYLIRYGGEEFLVLLTDVKEGYAEKVAEKLRKIIEETPITLPNCQTIRKTVSIGISEFP
FT                   KDCEGKFWKCVKFADVALYKAKEEGRNRVVRFKPEMWQEKEY"
FT   gene            385335..386282
FT                   /gene="rfaE"
FT                   /locus_tag="aq_565"
FT   CDS_pept        385335..386282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="aq_565"
FT                   /product="ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_565"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06797"
FT                   /db_xref="GOA:O66836"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:O66836"
FT                   /protein_id="AAC06797.1"
FT                   /translation="MLSEERVKELLKKLKDLKILVVGDVILDTYLYGNVERISPEAPVP
FT                   VLEVEGEEFRLGGAGNVAKNLSSLGVETYLCGVVGKDEAGKRLRELIEGNSIRSFLIED
FT                   ERPTTKKTRVVSRNQQLLRIDWEDRSYISGKALEKILDVIKNLQVDGIIVSDYAKGVIT
FT                   EEVIKTIREKGVFYSVDPRPKHRELYRKAYLMTPNEKELREMSKFEGSVEELGKKLKEE
FT                   LELETLIVTRGEKGMSLFTEKGVKHFPARARKVYDVTGAGDTVIASITAFKLAGATWEE
FT                   CCELGNVCGGIVVGEFGTATVTPEKLLKAVKLNS"
FT   gene            386285..386986
FT                   /gene="birA"
FT                   /locus_tag="aq_566"
FT   CDS_pept        386285..386986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="aq_566"
FT                   /product="biotin [acetyl-CoA-carboxylase] ligase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_566"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06798"
FT                   /db_xref="GOA:O66837"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="PDB:2EAY"
FT                   /db_xref="PDB:3EFR"
FT                   /db_xref="PDB:3EFS"
FT                   /db_xref="PDB:3FJP"
FT                   /db_xref="UniProtKB/TrEMBL:O66837"
FT                   /protein_id="AAC06798.1"
FT                   /translation="MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGRLGRKW
FT                   LSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKV
FT                   SGVLCELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISE
FT                   NLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKE
FT                   ILSGEFSLRRS"
FT   gene            complement(386954..387418)
FT                   /gene="rimI"
FT                   /locus_tag="aq_567"
FT   CDS_pept        complement(386954..387418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="aq_567"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_567"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06803"
FT                   /db_xref="GOA:O66838"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:O66838"
FT                   /protein_id="AAC06803.1"
FT                   /translation="MLKVREMEREDVERVYEINRESFTTDAWSRFSFEKDFENKFSRRF
FT                   VLEEDGKVVGYVIFWVVKEEATIMTFAIAPGYRGKGYGEKLLREAISRLGDKVKRVVLD
FT                   VRKSNLRAINLYKKLGFKVVTERKGYYSDGENALLMELKISRPSEAELSR"
FT   gene            387432..388265
FT                   /gene="deoD"
FT                   /locus_tag="aq_568"
FT   CDS_pept        387432..388265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="aq_568"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_568"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06801"
FT                   /db_xref="GOA:O66839"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66839"
FT                   /protein_id="AAC06801.1"
FT                   /translation="MLGIIGGSGLYNLPGIKVKEEVQVKTPFGEPSSPVVIAEVEGKKV
FT                   AFLARHGRGHEYPPHLVPYRANLWALREVGVKRVLGISAVGGINELLMPGDFVVIHDYL
FT                   DFTKTRRSTYYEGKFSVKVEGEDKVAKLLREGKVVHVDMSEAYCPEMRKVLIQILKEKN
FT                   FRFHPKGVYACTEGPRFETPSEIKMLKLLGADVVGMTGYPEVALARELTMCYASLCVVA
FT                   NPAAGIAGYRLTSNEVIQLMKRKEEEIKEVVLKFIKELPEIRSCDCEKSLEGAEV"
FT   gene            complement(388545..389645)
FT                   /locus_tag="aq_572"
FT   CDS_pept        complement(388545..389645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_572"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06809"
FT                   /db_xref="GOA:O66840"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:O66840"
FT                   /protein_id="AAC06809.1"
FT                   /translation="MKIALFTDSFRKDLGGGTQVARQLAFGLSKKGYEVLVITGSTAEE
FT                   ETPFKVLKLPSIKYPFYHNVEIALPNVELLKELKNFNPDVIHYHDPFLAGTMALLMGKI
FT                   LKIPTVGTIHIHPKQLTYHGIKIDNGVIAKKLVSFFGNFTDCVVFVSKYQKKLYEELDS
FT                   FCVKVIYNGIPDYFFVSEKRKLRNPRNRILTVSRLDKDKNPEFALKCVAEISKEVPVEY
FT                   TIVGEGNEKEKLEKLARKLGIKANFLGFVPREELPELYLSHDVLLNTSKTETFGLSFAE
FT                   AMATGMPVIALKEGSAPEIVGDGGILCEEKVECVKKAFLKLYQNPELYFKLSQKAPERA
FT                   HVFRCERFLKDYESLYEEVIRTSVPR"
FT   gene            complement(389655..390935)
FT                   /gene="nuoF"
FT                   /locus_tag="aq_573"
FT   CDS_pept        complement(389655..390935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="aq_573"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /db_xref="EnsemblGenomes-Gn:aq_573"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06800"
FT                   /db_xref="GOA:O66841"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="PDB:6HL2"
FT                   /db_xref="PDB:6HL3"
FT                   /db_xref="PDB:6HL4"
FT                   /db_xref="PDB:6HLA"
FT                   /db_xref="PDB:6HLI"
FT                   /db_xref="PDB:6HLJ"
FT                   /db_xref="PDB:6HLM"
FT                   /db_xref="PDB:6Q9C"
FT                   /db_xref="PDB:6Q9G"
FT                   /db_xref="PDB:6Q9J"
FT                   /db_xref="PDB:6Q9K"
FT                   /db_xref="PDB:6R7P"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66841"
FT                   /protein_id="AAC06800.1"
FT                   /translation="MRSYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEK
FT                   ALNMSPEEIIDWVDKSTLRGRGGAGFPTGKKWKFAVQNPGPRYFICNADESEPGTFKDR
FT                   IIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEEAKKKGFLGKNIL
FT                   GSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRLKPPYPVQKGLWGKPTVVNNVE
FT                   TIANVPFIISMGWEEYRYIGPSDYAGPKLFPVSGKVKKPGVYELPMNTTLREVIFKYAG
FT                   GTLGNKKVKAVFSGALDCFSSEELDIPMDYSPLGFGGTGTVIVLTEEDDIVEAALKIAE
FT                   FYEHETCGQCTPCRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVA
FT                   GRLIRQTLEKFPEEWEKYRKKSASLPL"
FT   gene            complement(390910..391392)
FT                   /gene="nuoE"
FT                   /locus_tag="aq_574"
FT   CDS_pept        complement(390910..391392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="aq_574"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /db_xref="EnsemblGenomes-Gn:aq_574"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06799"
FT                   /db_xref="GOA:O66842"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="PDB:6HL2"
FT                   /db_xref="PDB:6HL3"
FT                   /db_xref="PDB:6HL4"
FT                   /db_xref="PDB:6HLA"
FT                   /db_xref="PDB:6HLI"
FT                   /db_xref="PDB:6HLJ"
FT                   /db_xref="PDB:6HLM"
FT                   /db_xref="PDB:6Q9C"
FT                   /db_xref="PDB:6Q9G"
FT                   /db_xref="PDB:6Q9J"
FT                   /db_xref="PDB:6Q9K"
FT                   /db_xref="PDB:6R7P"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66842"
FT                   /protein_id="AAC06799.1"
FT                   /translation="MFKTEFEFPEELKTKLQEHINYFPKKRQAILLCLHEIQNYYGYIP
FT                   PESLKPLADMLELPLNHVEGVVAFYDMFDREDKAKYRIRVCVSIVCHLMGTNKLLKALE
FT                   NILGIKPGEVTPDGKFKIVPVQCLGACSEAPVFMVNDDEYKFESEVQLNEILSRYT"
FT   gene            complement(391412..392047)
FT                   /locus_tag="aq_575"
FT   CDS_pept        complement(391412..392047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_575"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06810"
FT                   /db_xref="GOA:O66843"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:O66843"
FT                   /protein_id="AAC06810.1"
FT                   /translation="MKWVSGIVYSDRRTYADRFWADGEIFAVADGMGIGKGAVAAAEKA
FT                   VDLIPKFKPYNSEEKIRENFSKINRELIKELGKLEDSVLSGTTLSLLSFNERNFYIGHV
FT                   GDSRIYLFRKGRLYRLTEDQVKIKGNKKVVKVLGLEWNPEVYTFSSHYEEGDLFLLASD
FT                   GFVEVLSEGEIEEALSCCDLEKGAERLKNMARQKGGRKEMVFLIVKTD"
FT   gene            complement(392044..392859)
FT                   /gene="stpK"
FT                   /locus_tag="aq_576"
FT   CDS_pept        complement(392044..392859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stpK"
FT                   /locus_tag="aq_576"
FT                   /product="ser/thr protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_576"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06804"
FT                   /db_xref="GOA:O66844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:O66844"
FT                   /protein_id="AAC06804.1"
FT                   /translation="MEDFKSGDLILGYYKVLEKLGEGNFGKVYKVEALKGRYKGKVFAL
FT                   KVASNPYSVHYLWKEAQTLILFHHQNIVSLQSYLYKKDKKELYLIYEYMDFGTLKDYVE
FT                   KKGKLSPEEALKVLRHVVNALEYLHSRGYIHSDLKPENVFGKRVLGGVLWKLGDFSLVR
FT                   IRGDVSIIDVKGTIGFIAPEIFRGEIHRSSDIYSLGCLTLYMLTGKVPFEGKDFKERKE
FT                   KNKRGEVEIPEEIPGKLKDLLERMLEVDYKRRFRTARELKEYMVKEGLI"
FT   gene            392890..393504
FT                   /locus_tag="aq_577"
FT   CDS_pept        392890..393504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_577"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_577"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06805"
FT                   /db_xref="GOA:O66845"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66845"
FT                   /protein_id="AAC06805.1"
FT                   /translation="MVEVLRSSTFLLLRNWEFTLAWIVFFTIPLVITPLPYVGFLAFFF
FT                   ILLFFNSTTQYFVKVLSKNEKSLEIKEIFKIKKPVFSFSLGESVYLFFTALLYYLFTKF
FT                   YAVLFFWWWFYKPFLEKELYYARTFEDGFKALLILLLRPNWKYIKLGLRWSFIGLVLLT
FT                   IAVLLVLSIAGVLLASFVVLLLSVVLAHFTAETILRIKTLA"
FT   gene            complement(393496..394074)
FT                   /locus_tag="aq_578"
FT   CDS_pept        complement(393496..394074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_578"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_578"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06806"
FT                   /db_xref="GOA:O66846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:O66846"
FT                   /protein_id="AAC06806.1"
FT                   /translation="MKFSEFIKEVQNLQELAEGWRGKVYTGYWRGKKVAIKVAKAPDKV
FT                   KAIQKEAEILEKLKGLKGFPQILFKGEDFFVYEFIEGKPFGKLKIGEEEKKRLLKEVLE
FT                   KAYLLDRMGINRDEFSNIYKNVLVGDKGEVFVIDFDRGTFKKNPSNVRQFLQLLKREGF
FT                   LSQEEAIELGKRYKENPEEVIKEIRKVLS"
FT   gene            394092..394601
FT                   /gene="def"
FT                   /locus_tag="aq_579"
FT   CDS_pept        394092..394601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="aq_579"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_579"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06802"
FT                   /db_xref="GOA:O66847"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66847"
FT                   /protein_id="AAC06802.1"
FT                   /translation="MVRDIVIYPNEILKKPTEKVDVIDKEVKNLIRDMFDTMYEAEGVG
FT                   LAANQIGVPLSVMVIDTSPKEDAPPLKLVLINPEIKEGEGKIKYKEGCLSFPGLSVEVE
FT                   RFQKVKVNALNEHGEPVELTLEGFPAIVFQHELDHLKGITFVDRLKGWRRRMALEKYQK
FT                   LLKSRK"
FT   gene            394598..395125
FT                   /locus_tag="aq_581"
FT   CDS_pept        394598..395125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_581"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_581"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06807"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66848"
FT                   /protein_id="AAC06807.1"
FT                   /translation="MSTKEIICTLKGQFFLSPREEKFLRLLEEMGIPEEDIQEGIRECL
FT                   KSVSPKKRKNFPLFKCFSKILEVNKVRALERGKREHLDWKRVFERKVSVVKHLLDFNYT
FT                   EPKTEEEAEKTLQEIERKIFKKLWENLDKERKREIYNKYKEVKEDEELFKELIKHELRK
FT                   IFQIPVLSLYVD"
FT   gene            complement(395126..396610)
FT                   /gene="trpE"
FT                   /locus_tag="aq_582"
FT   CDS_pept        complement(395126..396610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="aq_582"
FT                   /product="anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:aq_582"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06796"
FT                   /db_xref="GOA:O66849"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66849"
FT                   /protein_id="AAC06796.1"
FT                   /translation="MNLNLSLEEVRKLSENYNVIPLYTELLVDTETPLSIFLKLKEKGQ
FT                   FNILLESAEGGEKWGRYSFIITGSSFYLRTRKDIGEIYERGKVNFFETKDPLSKIKEVV
FT                   KKFIPYHDERLPRFWGGLVGYFAYDVVKFYEPVEDKNPDPIHTYDIYLVLTDVVVIHDN
FT                   LTGKIKVVVPIFAQNGIEEEYERAKNLIRDTVKKLKERGTTFLNVVEKEPDFKNWRSNF
FT                   TKEEFEDIVKKAKEYIAQGDVIQVVLSQRFRKRFKGNPDNIYRVLRFLNPSPYMYYLDF
FT                   DQLKVIGSSPEILVRLEEGRIETRPIAGTRKRGRTEEEDKRLEEDLLSDEKERAEHLML
FT                   VDLARNDIGRVAKTGSVRVENFMRIERYSHVMHIVSDVVGELREGYDALDVLKATFPAG
FT                   TVSGAPKVRAMQIIEELENERRGIYAGSVGYISFQGNMDMAIAIRTAVYRDRDIFVQAG
FT                   AGIVADSVPEKEWEETVNKAKALMKAIEIAEESQEE"
FT   gene            397306..399423
FT                   /locus_tag="aq_585"
FT   CDS_pept        397306..399423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_585"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06820"
FT                   /db_xref="GOA:O66850"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:O66850"
FT                   /protein_id="AAC06820.1"
FT                   /translation="MKVMHILFLIILAFAFAEDTIPIKNITGSGSISVYKDGKVFHYKI
FT                   LEYFDERKKTLKAYVVRESIEEKKLHYGNFTIINADFQNLKLATILISLSKIANLNIVF
FT                   SKELWKSRQEKFEPSKEYREEEGSLLRKEKGFLLQFSTLPRKVKVTRKEPVQEKEEYRI
FT                   PSYLLHNVSLIINSPTPGYTLFTLFDTLLREYDLIAVKLSNNLIKISKKETLAFDVEGV
FT                   DQSSINKLISKIKQYTSPSAKVLYDKDLGKIMVIDMAENIEKLRDLRVDLIELLMSRET
FT                   TPGEKEKSKETTPREIETKVFYFKNKRDLEIALSRLKENFSGEVILNIDKDFNAIIVTS
FT                   NRSVIKSVGTLLKDLTESIDKAYLITKIFYVRYISPYELKKKIEPMLSEVGEVYTLSVS
FT                   NTDEKKELISYKNTPPATAFNEGTLEKEKAFFVPFNNAILIKDYPERIEKIREKFKKFL
FT                   SEKPIKIKIRAKLVEVEKSLLRELGISWRTVFSKAYIPEFWQGETAFRTVTPGQPQSGL
FT                   LTFTFQRNRLNLLEFKLLAYEQEGRAKNVAESYVITVNGEPAVISSGLEFPVTEVSLSG
FT                   GIANVEPKYESIPIVLITTPVVLPDGNILLSVYLARRQINSVQEFPVTQTLTQKIPVFS
FT                   TSRIDVKIPIKNGETVVIGGAVEKSDSITESGVPKLREVPLLGWLFKTQTKQLRDRELL
FT                   IFITPEIIEED"
FT   gene            complement(399420..400712)
FT                   /gene="neaC"
FT                   /locus_tag="aq_587"
FT   CDS_pept        complement(399420..400712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="neaC"
FT                   /locus_tag="aq_587"
FT                   /product="N-ethylammeline chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_587"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06815"
FT                   /db_xref="GOA:O66851"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66851"
FT                   /protein_id="AAC06815.1"
FT                   /translation="MEKYDLLIKNVLIPEKEGEWDIAVKDGKIEKIGKNIVGEAKYTIN
FT                   GKGKIAFPSFANMHTHISMTLLRGLGADLPLHDWLQKVIWPLEGEFVSPEFVKDGALLG
FT                   IVESIRSGTTLFMDMYFFEEAVAEACEDVGIRAGLGFGILDFPTKVAKTPEEYIQRARK
FT                   FAEEFKNRELVFPVICPHAPYTCSPNTLRMAKELADEYGLLLHIHVAETKEEVERIKEQ
FT                   YGKTPVEHLESIGFLDKNVLCAHMVWTTEKEREILKERDVKIAHCPESNLKLASGIAPV
FT                   PDYVKRGITVTLGTDGAASNDNLNMLEETSTCAKFHKGYNLDAKAIDAGTALKIATENG
FT                   FKVAGIKAGKVEEGYEADLILVDTDFPEFQPLYDPISQFVYSANSECIDTVICKGKVLM
FT                   EKRELKTVDQEEIFAKARKWREKILSKLSSL"
FT   gene            400746..402107
FT                   /gene="xanB"
FT                   /locus_tag="aq_589"
FT   CDS_pept        400746..402107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xanB"
FT                   /locus_tag="aq_589"
FT                   /product="mannose-6-phosphate isomerase/mannose-1-phosphate
FT                   guanyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_589"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06811"
FT                   /db_xref="GOA:O66852"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:O66852"
FT                   /protein_id="AAC06811.1"
FT                   /translation="MKILILSGGKGTRLWPLSRENFPKQFIRLFSKHSLFQETVKRAKK
FT                   LAKDEDIVVITGEKYEWIIRSELEEIDANEVRVVVEPEGRNTAPAIALGVKYLIHSETP
FT                   PSETVLVLPSDHLIKDTEKFVEAVKKGEKYAKEGYIVLFGEKPTYPETGYGYIRLNGKL
FT                   EEGVYEIEKFEEKPDYEKAKEYVSDGKHFWNCGIFLFTLDRIVKDYTQLMPEIPFHEKW
FT                   EDFIKDFKNFEEISFDYAILERTKKLAVVKMDAGWSDVGSWKAVYDNLPKDEKRNVLIG
FT                   DVKAMDTECSLLLSQGKNLIACIGLEDFVVVGTEDATLIVKRDYSQKVKEIVKELEEEN
FT                   DERAIEHVTSFTPFGSITKLDRGERYKIRKVVVKKDKEIPLRMHHHRTVHFVVLKGTAK
FT                   VKVGDKEEFVHENESFFVPKSTPYKIINVGKIPLEMIEVQSGEYLGEDDVETLE"
FT   gene            402088..403089
FT                   /locus_tag="aq_591"
FT   CDS_pept        402088..403089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_591"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_591"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06816"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66853"
FT                   /protein_id="AAC06816.1"
FT                   /translation="MLKHLSEKFIYYMAEYFFEFEKRKHYYKLANNLYNSYLKGKKFNR
FT                   SLLKKVKEDLNLWIDNPNQIQVYSRFLNEVEKEGVKSFGEGLAIIPLINLYREVWRELE
FT                   EEQNKVEKLREYILKLDSCEICTRGLEGEEFFNCLTQNVDFLTATHIANFFFEEEFLPL
FT                   NEEIAQILNISKENYFEVIKKLKGANLKNLYGALYVLLQRDSVKVNHVKRLLGISREAE
FT                   LLKEAQYAWNTGDFYRAHEILEEVWGLFKNEEIKKCYRGLIRAAIALHRFKEGNPQSGA
FT                   NVVKQALLDMANCPDNFRGINLGEIRAYLEEVLGTKEIGNPPELKYNIKSEE"
FT   gene            403089..403162
FT                   /locus_tag="aq_t07"
FT   tRNA            403089..403162
FT                   /locus_tag="aq_t07"
FT                   /product="tRNA-Ile"
FT   gene            403186..404499
FT                   /locus_tag="aq_592"
FT   CDS_pept        403186..404499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_592"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06821"
FT                   /db_xref="GOA:O66854"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:O66854"
FT                   /protein_id="AAC06821.1"
FT                   /translation="MFGLIQKHKRIAVIIVTLASLSFLFWMFSVSDVKQMLTGNPCVAT
FT                   VGDECITLREYRFELLKYSNFLQDERTEKLARRVALNSLITKEVLYLKAKELGWYVSDE
FT                   EVVEVIKNDENFKEKGKFSVEKYRETLNRFGLTPAEYEEIVRKSLMAQRVLNFLREGVY
FT                   VLPDELDIQKRFYSLRVEGKLYLIKPSDVKVDYEPSEEEIKEYYEKNKEKFKEEEKEVV
FT                   YVWSLKDKEKVKEYYENLKKGSIPSGYTEFNENLPPKVKEAVKELNQENRIKVVRVGEN
FT                   YYLLYYKGKENAGYKPLEEVKEEIKKELVAKKQREKLKEFAQEVFKNLKEGKEVGVKPL
FT                   AFSSASLEEIQRILMVEQKDLLNLVFGKEKVYGPYPSLAGYGILVVKNRKFEELKPEQV
FT                   KEIERELKDNKFNDLAGLFVEKLIKEYGVKVNEQLAGI"
FT   gene            complement(404496..406211)
FT                   /gene="frdA"
FT                   /locus_tag="aq_594"
FT   CDS_pept        complement(404496..406211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /locus_tag="aq_594"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_594"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06812"
FT                   /db_xref="GOA:O66855"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:O66855"
FT                   /protein_id="AAC06812.1"
FT                   /translation="MEIKKYDVVVIGGGGAGLRTAIEVAKDPNISVALVSKVYPTRSHT
FT                   GAAQGGMNAALGNVIPDDSPEVHAYDTIKGSDFLADQDAVFFMTEKAPEIIYELDRWGV
FT                   PFSRLPDGRIAQRPFGGASFPRTVFAADKTGHVLLHTLFEQALARDNITFFNEYFLLDL
FT                   IHDGERVKGVTIYDIRNGEVLFLQAKAVVLATGGFARIYWFRSTNAIGNTGDGQAVALR
FT                   AGVPLKDMEFIQFHPTGLAKTGILLSEACRGEGGYLLNKEGERFMKRYAPDKMELAPRD
FT                   IVSRAIETEIREGRGVGEGARAYVYLDLRHLGEEKIKERLPQVRQLAIDFEGVDPAKEL
FT                   VPIRPSAHYCMGGIHVENYKTSETPLKGLYAVGECACVSVHGANRLGGNSLTELVVFGK
FT                   YCGMAVREFVKETDFAPVSESEPKKSEEFIEELMKREGNESLAQVRAQMGEITWAKMGI
FT                   FRDEKSLKEAYDELSELLERWNNIPVVDKAKVFNTNLIEVLELRNMLELARVVAYSALH
FT                   RRESRGGHSREDYPQRDDKNFLKHSLVYYDKNGNLKLEYIPVRITKYKPEERKY"
FT   gene            complement(406507..407820)
FT                   /gene="purB"
FT                   /locus_tag="aq_597"
FT   CDS_pept        complement(406507..407820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="aq_597"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_597"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06813"
FT                   /db_xref="GOA:O66856"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66856"
FT                   /protein_id="AAC06813.1"
FT                   /translation="MIERYTRKEMGDVWSEVNKFKKWLDVEIAVCRAWAKLGKIPRDAL
FT                   KKIEEKTYVDKKVVEKIKEKEKVFKHDVLAFVSVIAEQVGEEGRYIHMGLTSSDVVDTA
FT                   LALLIREAIDIILKDIDKVMEEIKRLAFEHKDTLMMGRTHGVHAEPYTFGLKMCVWYDE
FT                   MRRQKERLLFARENVLYGKISGAVGTYSNIPPEVEKLALEELGLKIEPASTQIVHRDRH
FT                   AQLLTTLGLIASSLEKFATEIRHLQRTEVLEVLEPFTKGQRGSSAMPHKKNPIHSERIC
FT                   GLARVIRANSIPAMEDVVLWHERDISHSSVERVILPDSFIALDYILNLFYEILKGLVVN
FT                   KERMRKNMELSKGLYASSKILVLLTQKGLSRDYAYDIVQRCAMKAWESDKTFKETLLED
FT                   PEVTKYLTEEEIEKALDPWEFLKNRDYVYEKVFGDEMG"
FT   gene            complement(407862..408254)
FT                   /locus_tag="aq_598"
FT   CDS_pept        complement(407862..408254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_598"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_598"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06817"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:O66857"
FT                   /protein_id="AAC06817.1"
FT                   /translation="MAKMLINVESTKDFEQVVQAVQEKSKENGFGVMSVHEVHKILESK
FT                   GMPISYKCTIVEICQPKAASQVLSKKPEVSTAMPCRISVYEQDGKVVLSTIAPTELLKL
FT                   YQADEFKELAEEVENTIKKIMEEAAK"
FT   gene            408354..409550
FT                   /gene="rpoN"
FT                   /locus_tag="aq_599"
FT   CDS_pept        408354..409550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="aq_599"
FT                   /product="RNA polymerase sigma factor RpoN"
FT                   /db_xref="EnsemblGenomes-Gn:aq_599"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06814"
FT                   /db_xref="GOA:O66858"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="PDB:2AHQ"
FT                   /db_xref="PDB:2K9L"
FT                   /db_xref="PDB:2K9M"
FT                   /db_xref="PDB:2O8K"
FT                   /db_xref="PDB:2O9L"
FT                   /db_xref="PDB:5UI5"
FT                   /db_xref="UniProtKB/TrEMBL:O66858"
FT                   /protein_id="AAC06814.1"
FT                   /translation="MLNQRLEVRQKLNLKLLLKQDLELLTYQTQELEKLIHEEVLVNPL
FT                   IKGVFKKIPKSFEVKETVPYQIPYTPSELEELQQNIKLELEGKEQELALELLNYLNEKG
FT                   FLSKSVEEISDVLRCSVEELEKVRQKVLRLEPLGVCSKDVWEFLELQIEEIYPEEEEIL
FT                   KKALRDLKRGKKLKPEIKGKLSRLRLFPLSSSAEKVYTFAKVDAIIEEENGEFFIYLYE
FT                   DFIDIDLNEEYWELYKKSRNLQKELKEAFERYESIRKVLDIRRRNLRKVLEKIVERQKD
FT                   FLTGKGSLKPLTLREVSSEIGIHESTLSRIVNSKYVKTPVGTYSLRTFFVRESAEGLTQ
FT                   GELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREMLGIPSSRERRI"
FT   gene            complement(409567..410049)
FT                   /locus_tag="aq_600"
FT   CDS_pept        complement(409567..410049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_600"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_600"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06818"
FT                   /db_xref="UniProtKB/TrEMBL:O66859"
FT                   /protein_id="AAC06818.1"
FT                   /translation="MGTMPRRALGWTAEVLKRLHGINYPITKDTLREKLAGMSIRGVPV
FT                   ERVIDEIEVDKFDTPRDVLHYIAEAVHKLEERGEIPTETRKGIRWAAEVLKRIHGEHFP
FT                   MDKQKLKEKLAGLYWRGVPIEKVIDAMEVEQVESPADLLHQLSIAIKKLEEQGEVA"
FT   gene            410406..410942
FT                   /locus_tag="aq_601"
FT   CDS_pept        410406..410942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_601"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_601"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06819"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:O66860"
FT                   /protein_id="AAC06819.1"
FT                   /translation="MMGLKVLLYDPDGEIAHFLEDIFEVTGHTLYPAGSEEEVFEYLKN
FT                   EPEFFFLPFSLKEAWVNSLKERATIPIFFLFSEEEEERAKGLGIPEVNLVRVPFNPLEL
FT                   FERLGLLHKMKPKDFQEIGLFNTLVKSHLEEKGVKVKIKGSGGECLVNTYPVSLSCRLE
FT                   ELKELLKKRLRTGRR"
FT   gene            411154..411972
FT                   /locus_tag="aq_603"
FT   CDS_pept        411154..411972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_603"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_603"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06829"
FT                   /db_xref="GOA:O66861"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66861"
FT                   /protein_id="AAC06829.1"
FT                   /translation="MDTLAFINRALVEEGYSLKDIKLVLITDFEPSSVEAIRRLLAVNQ
FT                   GVSFIGRKYVKEVLEKFGLRNVRFRAVEEIPSLEFKLPESGTVKVLPFRNSPQEASAGY
FT                   LLEEERILFSGKFLGSFGEKGDTIQIFHRVFFPCRNILDYNVGLLESIGEEFEVFPFYG
FT                   EKQKLSAKTLKEYFNYTVKGSVLEREVILGLVNGVLLNLSDEERENLLSSIGYLAEVDD
FT                   KVIVDFYTEPNLFYEEFVNTLPDAVKSKEEFYRIVEKLLEHNFYVPLRAV"
FT   gene            412006..412791
FT                   /gene="lpxA"
FT                   /locus_tag="aq_604"
FT   CDS_pept        412006..412791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="aq_604"
FT                   /product="acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_604"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06825"
FT                   /db_xref="GOA:O66862"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66862"
FT                   /protein_id="AAC06825.1"
FT                   /translation="MKVHSSVLIEGEVEIPEDVEIGAYTVIQGNVKIGKGTKIGNRVTI
FT                   KGNVTIGENCKIFDGAVIGEAPQHLKYEGEETSVEIGNNVIIREYVTIHRGTKLDKGKT
FT                   VVGDNVMLMAYSHVAHDCVVGNNVIMANCATLGGHVVVGDYALIGGLSAVHQWARVGEH
FT                   AMVGGLTGVSLDIPPYTVASGQHAKLYGINIIGLRRRGFPEEVIKAISKAYRIIFRSPL
FT                   PRQKAPEIVFQELGQYEEVRKMVEFIKSSKRGVARHHKD"
FT   gene            412805..414199
FT                   /gene="glmU"
FT                   /locus_tag="aq_607"
FT   CDS_pept        412805..414199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="aq_607"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_607"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06824"
FT                   /db_xref="GOA:O66863"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66863"
FT                   /protein_id="AAC06824.1"
FT                   /translation="MRAVILAAGLGTRFKSEKPKVLHEILGKPMLWYVITNVRNGRIDD
FT                   IAVVVGHKAQEVMEAFKNENLKFFIQENPKGGTADAVLAAKDFFSSYEGYVLIINGDSP
FT                   LVSGETIRNMQQFIHMVRTYEGIKLGGVVLTTHLPDPTGYGRIIKEEGTDRIIRIVEEK
FT                   DATPEEKAITEINAGTYIFYAPYLLEALYRIKPSPVTGELYLTDVIEYMVNKGYEVRSF
FT                   MAKEPTEALGVNTRWDLALVENVIKLKIARYWAERGVTVHYPETVWIEPDVSIEPDVEI
FT                   FPDVMLKGKTKIKKGSVIGKGSVIKDSLVEENVIVREYSVIENSEIKKRAVVGPFARIR
FT                   NESVIGEEAEIGNFVEVKKSSIGKGVKAKHLAYIGDATVGENTNIGAGTVFANYDGKRK
FT                   YESYVGKSAFIGSNSLLIAPIRVGDWAYIAGGSVVNKDIPEGALAVSRPELKIFEGRGK
FT                   KKLQKD"
FT   gene            complement(414196..415425)
FT                   /gene="thrC1"
FT                   /locus_tag="aq_608"
FT   CDS_pept        complement(414196..415425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC1"
FT                   /locus_tag="aq_608"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_608"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06822"
FT                   /db_xref="GOA:O66864"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:O66864"
FT                   /protein_id="AAC06822.1"
FT                   /translation="MAKVKGLKCRECGREYPAEPIHVCEFCFGPLEVVYDYDEIKKNIS
FT                   REKIEKGPKSLWRYVDLLPVENPTVGLTAGFTPLKKAEKLGEVLGLKNLYIKDDSVNHP
FT                   TLSFKDRVVSVALSKAKEFGFDTAACASTGNLANSVAAHSAQAGMNCFVFIPANLETQK
FT                   IIGSLVFNPTVVAVEGNYDDVNRLCSEIANDLGWAFVNINIRPYYAEGSKTLAFEVAEQ
FT                   LGWRAPDVVVAPAASGSLYTKIWKGFNELKKVGLIDEVKTRMYGAQAEGCSPIAQAWRE
FT                   GRDFIKPVKPNTIAKSIAIGNPADGIYALQVARESNGAWETATDEEIIEGIKLLAQTEG
FT                   IFTETAGGTTIAVLKKYVEKGMISPEETVVVYITGNGYKTMEVLEGKLSTPVKIKPTLK
FT                   DFKEKVLARV"
FT   gene            complement(415436..416548)
FT                   /locus_tag="aq_609"
FT   CDS_pept        complement(415436..416548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_609"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06832"
FT                   /db_xref="GOA:O66865"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:O66865"
FT                   /protein_id="AAC06832.1"
FT                   /translation="MGFRLGIVGLPNVGKSTLFNALTKTMKAQAANYPFCTIEPNVGVV
FT                   EVPDERLYKLAEIEKSQKITPTFIEFVDIAGLVKGASKGEGLGNQFLSHIREVDAVAMV
FT                   LRAFEDENIVHVEGSVDPVRDKEIVEIELIAKDLESVNRRIEKVQKVAKGGDKKAREEM
FT                   EHLNALKEILENLEPIRKYADKLPPETLEYAKKTLFLLTVKPVMYIANISEKDLPEGEG
FT                   NPHVERIKEMANQENAPVVVISAELEAQLAGLSEEEQKEMLEAYGLKEPGLNKVIRTGY
FT                   RLLDLITFFTAGEREARAWTVKRGTKAPQAAGKIHSDMERGFIAAEVISYEDLIKAGSW
FT                   AKAKEQGLIRLEGKDYEIQDGDVVYFRFNV"
FT   gene            complement(417224..418105)
FT                   /gene="deaD"
FT                   /locus_tag="aq_613"
FT   CDS_pept        complement(417224..418105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="aq_613"
FT                   /product="ATP-dependent RNA helicase DeaD"
FT                   /db_xref="EnsemblGenomes-Gn:aq_613"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06826"
FT                   /db_xref="GOA:O66866"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66866"
FT                   /protein_id="AAC06826.1"
FT                   /translation="MTIPVALQGRDCLIQAKTGTGKTAAFGLPILNSLKEGEKALILAP
FT                   TRELALQIRDNFRDFARYLNVRTFAFYGGTKVFGDLKVLRGGKVDVVIGTPGRIKDLIE
FT                   RGALKTDDVRYFVLDEVDVMLDMNFKEDIDFIYSQLPEEKQVFFVSATFPKEVRELSHR
FT                   YTKKPEFIKVESRELEPQIEERLLRVYSIREKIELLEDVLRDFNKVIVFVNRKRDAKFL
FT                   GEKLSTKGFRVGALHGDLPQRRREEILKKFRRGFINVLVATDVASRGLDISEVEAVVNF
FT                   HLPEDPKFTFTE"
FT   gene            418639..419037
FT                   /locus_tag="aq_615"
FT   CDS_pept        418639..419037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_615"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_615"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06830"
FT                   /db_xref="GOA:O66867"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66867"
FT                   /protein_id="AAC06830.1"
FT                   /translation="MKKALFLVGLVFTAGVISSCGGVSSQRTYEGAAVGAAVGAAAGVL
FT                   LDKENRWRGGVIGAALGAILGGTITEIAQRAAKEAAQNNKPVVYRAEDGSQMVRAEPVE
FT                   KRGNCTLVKTKYYQNGKLVKVEEKEVCE"
FT   gene            419071..419574
FT                   /locus_tag="aq_616"
FT   CDS_pept        419071..419574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_616"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_616"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06831"
FT                   /db_xref="GOA:O66868"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66868"
FT                   /protein_id="AAC06831.1"
FT                   /translation="MRLKKLPIRRKMPMELAYIEKLFREEVGLDIKEHKDKAEQISETV
FT                   VEIYEELLRKGIENANYNGRDYVSYYDLPITEDLERYMNRFIQDRGEEVLKAFVDYLAK
FT                   LEEELLKAEEALPPLDEELHQKKADILGGIMLMFASVAKQINGDRKLYAESIPVTREVL
FT                   RTMI"
FT   gene            419585..420088
FT                   /gene="pfpI"
FT                   /locus_tag="aq_618"
FT   CDS_pept        419585..420088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpI"
FT                   /locus_tag="aq_618"
FT                   /product="protease I"
FT                   /db_xref="EnsemblGenomes-Gn:aq_618"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06827"
FT                   /db_xref="GOA:O66869"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:O66869"
FT                   /protein_id="AAC06827.1"
FT                   /translation="MRKVLIFLEELVEDVEFIYPYLRFKEEGFEVVSAAPKLGEYKGKK
FT                   GMTFRPDKTIKDVYHQEFDCVFIPGGYAPDRLRRYPEVLHIVKKHYDSGKLVCAVCHGP
FT                   WVLISAKVVKGKKVTGFFAIKDDLINAGANYTGKPVEVDGNLITATDPKSMLEMMKVII
FT                   SRLK"
FT   gene            420088..420924
FT                   /gene="yfeA"
FT                   /locus_tag="aq_619"
FT   CDS_pept        420088..420924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeA"
FT                   /locus_tag="aq_619"
FT                   /product="adhesion B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:aq_619"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06823"
FT                   /db_xref="GOA:O66870"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:O66870"
FT                   /protein_id="AAC06823.1"
FT                   /translation="MKKFLIILLSFVLFVFPEDLILVSIYPFYDVVKDISGKYYRVESL
FT                   VPPKADYHVYELTPRELIKLYRAKVVFVSGVPLGEWEEKVEKIAKGKVYSLSKGIELIT
FT                   YGHEELGKDPHFWVSPKRMLKVAKNVEEALTETFKKNFSENYKNVEQELKKLDEAYTKT
FT                   LSKCEYKKFGAVHGAFGYLAKDYGLEQVLLREEHGHGDISPSELKKLVKLIKKKEIKVV
FT                   LIPKGVHSKFAEILKETYNITVYEVNVKIIPEEEGDNYYKIMERNLKVLKEALKCG"
FT   gene            420915..421613
FT                   /gene="abcT2"
FT                   /locus_tag="aq_620"
FT   CDS_pept        420915..421613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT2"
FT                   /locus_tag="aq_620"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:aq_620"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06828"
FT                   /db_xref="GOA:O66871"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66871"
FT                   /protein_id="AAC06828.1"
FT                   /translation="MRVIEVKNLTFSYDGKHNVLEDVSFYVEKGDFLGIVGPNGAGKST
FT                   LLKLILGFLKPKSGEIYLFGKKIEEFKDWKRVGYVPQRLSVEHAFPGTVKELLSSVCED
FT                   KKEIDYLVEFLKLKNIVNKQFTKLSGGQQQRVLLAMALSYNPELILLDEPTVGLDVHAI
FT                   NHFMSILLDLNMNHKKSIVMISHDIGTLLKHASKILCLNKKVCYFGEPEGAIEYIEEAF
FT                   GLRGFLHGVS"
FT   gene            421671..422402
FT                   /locus_tag="aq_621"
FT   CDS_pept        421671..422402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_621"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06833"
FT                   /db_xref="GOA:O66872"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:O66872"
FT                   /protein_id="AAC06833.1"
FT                   /translation="MTGVFLILRRYAFLGAGLSHAAFGGIALSFLLGTDVYLTTVIFTI
FT                   LVANFVQFLTQTKKVPGDTAIAVIFSSGMALAVTILGIVRGFGENLFSYLFGNILMVTK
FT                   EELFYTAGVFLITLLFIGIFYKKLLLTTFSEEMAKVKGINISFLNYSFVTLTALVVVAS
FT                   IKAVGVILASSLVVIPAMSGLILAGSFLSSLIISSVVSTLSVVLGIYISFNYDVPPSGS
FT                   IVGIAILLFLASFLLRKLPLK"
FT   gene            complement(422376..423338)
FT                   /locus_tag="aq_622"
FT   CDS_pept        complement(422376..423338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_622"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06834"
FT                   /db_xref="GOA:O66873"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:O66873"
FT                   /protein_id="AAC06834.1"
FT                   /translation="MAFISFRDFMEKAVKDYYSSQRALKDFFTAPELDRAFGEALAEFF
FT                   SQHLSEFERPALVELGAGRGLLAYDILNYYRANYPDLFNRLKYYIYEFSPYLISKQREV
FT                   LKNFKNVEWVEELPKVEGIVFSNEFFDALPVHIVKGGKELYVDEKGSEVWLSLENEKVK
FT                   EFLRRMNYENLNQIVEVCLDCIDMLKKISESLVEGYHFVIDYGYTSEEITKYPEGTVVA
FT                   YKEHKVVKDFLKEAGNADITAHVNFSALMEYGRDFGLETILFQSQRDFLMHIPTFLNEL
FT                   EKLSWEESAESVERLSRLKTMLISMGDRFKVLLQRKLSQ"
FT   gene            423373..425553
FT                   /gene="mrcA"
FT                   /locus_tag="aq_624"
FT   CDS_pept        423373..425553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="aq_624"
FT                   /product="penicillin binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:aq_624"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06835"
FT                   /db_xref="GOA:O66874"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="PDB:2OQO"
FT                   /db_xref="PDB:3D3H"
FT                   /db_xref="PDB:3NB6"
FT                   /db_xref="PDB:3NB7"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66874"
FT                   /protein_id="AAC06835.1"
FT                   /translation="MKKLVIGILGIVIALFVGLLVFLIPIYKNLPDPKLLESWTPPQAS
FT                   EVYDAKGRLYGTIGIQKRFYVSIDKIPEHVINAFVATEDRNFWHHFGIDPVAIVRAAIV
FT                   NYRAGRIVQGGSTITQQLAKNLFLTRERTLERKIKEALLAIKIERTFDKKKIMELYLNQ
FT                   IYLGSGAYGVEAAAQVYFGKHVWELSLDEAALLAALPKAPAKYNPFYHPERALQRRNLV
FT                   LKRMLEEGYITPEQYEEAVNKPLTVKKENKYKFSDYFLDMVKSYVFNKYGEIAYKGRLK
FT                   IYTTIDLDYQKIAQKSLEEGLKRVAKIIGLPFLPKSEEDMELAYEKEAQLKRLKRGKIY
FT                   VAKILKYDGNFMKVEIHGKKLKGEIKGLNTEGHKYVFVKYLGGNRAEIIPDLEGSLVSI
FT                   DVKTGEIKAIVGGRSYAYSQFNRAVKALRQPGSAIKPVIYLSALLKGMTQISTIDASSK
FT                   PYYDPSKGEDWIPKNYDEKEYGNVTLRYALAHSINTAAVNLLDKVGFELVLEVGKKVGL
FT                   DNLKPYYSLALGTVEVTPLQLTAAYQVFANLGTECKPFFIKKIVDENGEVLEENVPECE
FT                   EVLPKPETRVPVDMLRAVVLEGTARRASVLDRIVAGKTGTTDDFQDAWFVGFSPYIVTG
FT                   VWVGYDVKKSLGKHMSGSRVALPIWIDYMKVVTRMYPNEDFELPPENIVVNINPKDLVL
FT                   ADETCEGVPMVFVKGTEPHITCSDLNAILGLR"
FT   gene            425550..426671
FT                   /gene="bioF"
FT                   /locus_tag="aq_626"
FT   CDS_pept        425550..426671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="aq_626"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_626"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06836"
FT                   /db_xref="GOA:O66875"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66875"
FT                   /protein_id="AAC06836.1"
FT                   /translation="MRWIEEELKRIKEANLYRERILLEGVKDFCSNDYLGLRKHPEVVE
FT                   ESIRVLKEAGLGSGASQLVSGYTKHHRELEEKLAEFKGTESCVLFGSGFLANVGTIPAL
FT                   VEEGDLVLSDELNHASIIDGVRLSKAQKRVFKHKDYEELEEFLKKNRKKFRRVLIITDT
FT                   VFSMDGDVADLKRLTQICEEYDCMLYIDEAHTTGTIGKGGLDYFGIEHKEYIIVMGTLS
FT                   KALGSYGAFVCGTKLLIDYLVNKARSLIFSTSLPPSVCAGAKKAIEIIEENPKLIEFLR
FT                   KKEKEILEILEQFSLDYKYYSTPIIPIMVYDEKETVRIKEELLKEGVFIQAIRYPTVPK
FT                   GKARLRLTASLNYTRKDLEFLKNALEKVLKGRA"
FT   gene            complement(426668..427594)
FT                   /locus_tag="aq_627"
FT   CDS_pept        complement(426668..427594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_627"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_627"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06840"
FT                   /db_xref="GOA:O66876"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:O66876"
FT                   /protein_id="AAC06840.1"
FT                   /translation="MGVDFRDKQLIENPPGHYTNALSKMHTNFQFMRITPAVSYKINEM
FT                   ISVGGALHIAWGSLDVGAEMCQFEDTDGDMMPSPTRCWNAGGGQSQDFGIGVSLGIAFN
FT                   MGDFIYAGLMYQSPVSMKYKNVFDSNGDGKFEDMKLQQPQEVGLGIGVKPLENLKLGLD
FT                   IRWIDWSGADGYGDFDWEDQWVFGLGVEYKPMDSLALRAGWNYGKTPIRDKDNLDPMTP
FT                   KNSVPSFDTRFSDFQLYWFNLVGFPAFAEHHLTLGLNWKITPNFNIDLSYVYALPKTVT
FT                   AKAAQGAGEVSTKMVQHSIGVGLNWAF"
FT   gene            complement(427634..428011)
FT                   /locus_tag="aq_628"
FT   CDS_pept        complement(427634..428011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_628"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_628"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06841"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66877"
FT                   /protein_id="AAC06841.1"
FT                   /translation="MKKKFAVIGSILALAPFALATNGDNMIGIGPASRGMGGIGTGMPV
FT                   GPIDSIFRNPAWMSYFNTKRFFLSFGGILFMPNVKVSSKMFMDFEPRNSGGGGYFQTNG
FT                   RVKSDADTFIVPEVGIVHKVN"
FT   gene            complement(428466..431936)
FT                   /gene="xcpC"
FT                   /locus_tag="aq_629"
FT   CDS_pept        complement(428466..431936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpC"
FT                   /locus_tag="aq_629"
FT                   /product="chromosome assembly protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:aq_629"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06839"
FT                   /db_xref="GOA:O66878"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66878"
FT                   /protein_id="AAC06839.1"
FT                   /translation="MEKRAYIEKIVVEGFKSYGTKRKEIPLGEGFIAVVGPNGAGKSNI
FT                   GDAISFALGLSSAKALRAKNLSYLIFSKNGQKADHAYVEVHFKNLGAFPVEDEEVVISR
FT                   KVSKDGRSIFKINGQVVRERDLKDFLAKAGIYETAYNVVYQGDIVKFLKMTPVERRKII
FT                   EEISGIGEYERKKEKALEELAEVELKIKEIDLILEEISNQLKRLKEEKEKLEKFKELQR
FT                   IKRETEAKILLKEKEKLLKERERILNELSSLRESLEDITFQIQENEKELNERERLLKEV
FT                   NEKIMPFKEKVGKFTAEIENAERSIKEKERELKESENRVKNLEELINNLLSDKENLERE
FT                   VGTLQLELEKLKEEYKSLKEVEREKLRELEEEEERLKITFDEVKKLEEEKEKLTEKLNS
FT                   LNKEKQELEIQRANLKNKIERIKEDINKLISEREEKIKEIKEKEQEIKRLKAIKKKEEE
FT                   ELRNLTQELNIYEKRLSEVRKKLEEVLKEKGAIEREVRSFSDVSDVFKDIKGVYGSVSE
FT                   LIRVKNPEHITAIEVAGGGRLKFIVVEDEEVAKECIQLAKRMNLGRFSFIPLNRVRVEE
FT                   RPLRYPRTKGAVDFAVNLVEYDPKFEKVVKFVFGDTLIVENFESAKAIGIGNYRMVTLE
FT                   GELFEKSGVITGGAVKPSGELNKRYYEEELQRLNAEEEKLKNEESIIQKKIREIRNLIS
FT                   EKTALLKVSERKIEELSSEGLEQYEEKFKEKLENSKEYLKILEEKLLNVEDKLKELAEE
FT                   IEYYEEKLNNLKLKEGDIKRHYSREGVEEKRREYSKVRKQVSEIEKSLNEIERELNKKT
FT                   YELEYLEKEIQEKEREREYLTERIKSLKKEIENLILFKEKTLQEVKEAEVKVYDYIKQK
FT                   EELEKEILNLKSKLGKLKIKEEELKEKIFEKEKNLKVLEEKIENLNEELKEYEDLKLGA
FT                   DEESIPKLKEKLKRVTEEIQKLGSVNFRAEEDYAEELKRFNDYKEKQQKLKEESKAIKK
FT                   LIEETENKKRKVFLEAFNQINKSLKRIFSFLSPGGKAQMFLDNPEDPFSGGVQLTVKPR
FT                   GKDVQYLEAMSGGEKTLAALSLIFALQEYKPSPFYYFDEVDAHLDEVNAKKVGELIREK
FT                   SKEAQFIVVTLREVVTSFADKIVGVSARGGISEVFFLKNEGLEEIIKEA"
FT   gene            complement(432190..433143)
FT                   /locus_tag="aq_632"
FT   CDS_pept        complement(432190..433143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_632"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06843"
FT                   /db_xref="GOA:O66879"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:O66879"
FT                   /protein_id="AAC06843.1"
FT                   /translation="MAQVKTQRLYYSLKDYFKEKYGKRVQKITVALPFTCPNRDGTKGR
FT                   GGCTYCYDGSKPSMLSPVIPLEVQIKEGIERAKKKYGEDIYFTIYYQSYTNTYADIETL
FT                   KKVYDTALKFEGVVGIDVGTRPDCAPEEVLDLLEYYANKGLEVWVEYGLQSANFETLKK
FT                   INRQHGVSDFVDAVLRTKKRNLKVCAHMIIGLPGETREDFIETAKLIASLPIDGIKIHP
FT                   LHVIKGTVMEKQYLNEEFKTLTLEEYAEYCADVIELLPPDMVVHRITGETDEERLIAPE
FT                   WCTFKYKNAVIQKVRETLERRGTYQGARYPFYKYGV"
FT   gene            433166..435328
FT                   /gene="ligA"
FT                   /locus_tag="aq_633"
FT   CDS_pept        433166..435328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="aq_633"
FT                   /product="DNA ligase (NAD dependent)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_633"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06838"
FT                   /db_xref="GOA:O66880"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66880"
FT                   /protein_id="AAC06838.1"
FT                   /translation="MFTPEREKELQEKTRELLRKIKDVKVLSFEEAKKLAEDLREVIRY
FT                   HDYKYYVEANPVIPDYDYDRLFRALKEIEKKYPELITPDSPTQRVASEISGEFPTVKHY
FT                   TPMLSLDNAYSEDELREFDRRVRQITGLEVVEYAVEPKLDGAGIALVYENDLFVRGATR
FT                   GDGEYGEDITNNLKTIKTIPLKAEFSRFGIKLAEIRGEVVIRKDEFQKLNKERMEEGLP
FT                   PFANPRNAAAGSIRQKDPKEVAKRNLEAIVYHLSYVEPPETEPPTHYESLKMLHTLGFK
FT                   TLFKDTKVCKGIDEVIEYCKEWEKKRDSYPYEIDGMVVKVNDRRLWKVLGYTSHHPRWA
FT                   IAYKFKPRRAVTKLVDVVFQVGRTGTITPVGKLEPVELGGVTVSSVSLFNEDFIREKDI
FT                   RIGDWVVVERAGDVIPYVVEVLKEKRTGEEKPVEFPKYCPSCGSELVKLPEEVAIRCIN
FT                   ISCPAQSVLRIKHWASRDAMDIRGLGDATIKLLFNRGLAKDVGDLYYLKLTDILKLPGF
FT                   GEKSAMNLLKAIEESKNRPLDRVLYGLGIRYVGQTTAKKIAEIINSVWDLKDIPLEKLM
FT                   RLEGIGYKVARSIKEFFNIPQNLEVLKKLEKAGVNLAKKVKEKVADVLKGKTFVFTGTL
FT                   DCCSREKAGEIVEMLGGKFSNSVTSKTDYLVVGKDPGATKLSKAKKYGVKTITEEEFVN
FT                   MIKDYVDLEKIKKEDKKEKPKIGRLF"
FT   gene            complement(435320..435748)
FT                   /locus_tag="aq_635"
FT   CDS_pept        complement(435320..435748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_635"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_635"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06842"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:O66881"
FT                   /protein_id="AAC06842.1"
FT                   /translation="MKIGFISKKGAVRALLAEAIAREILKKMGIKAEVYSAGLEPERTT
FT                   PREVIEVLKEKGYPTKSLYPKPIRKIPYKSLDVVVILDNEIKDKCPFEISHKRRENLHI
FT                   DEPKNLSIPELRRIRDKIEEELKKLFGVNKEVKKKVSK"
FT   gene            complement(436576..437487)
FT                   /gene="lysR1"
FT                   /locus_tag="aq_638"
FT   CDS_pept        complement(436576..437487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR1"
FT                   /locus_tag="aq_638"
FT                   /product="transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_638"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06837"
FT                   /db_xref="GOA:O66882"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:O66882"
FT                   /protein_id="AAC06837.1"
FT                   /translation="MIDISKLKTFVTVAELGSFSKASEVLYITQPAVTQQIKALEKTVG
FT                   AKLFQRQGGRMVLTEEGKRIYEIAKLLLNSYEGLMEEIARIKKDLKDTLFLVLSATPSE
FT                   YIIPKIIAEFHKEFPSSKIKIFTGNSHDVEEGLVSGVLNVGIIERKPSDKFVDIPFLED
FT                   EIVFFTYPEHPIAKEGEIEPERLYELDLVMREAHSGTRKLVREKLEELGIMFDKLNIKI
FT                   ESTSSRNIIQIVKNGYGCSFLSKGLLNGEIKAGNLVVVKIKGFEIKRRFHIIYPKNSTI
FT                   TFLASNFIQYLLEKTKEVELTV"
FT   gene            438038..438991
FT                   /gene="thy"
FT                   /locus_tag="aq_640"
FT   CDS_pept        438038..438991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thy"
FT                   /locus_tag="aq_640"
FT                   /product="thymidylate synthase complementing protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_640"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06847"
FT                   /db_xref="GOA:O66883"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66883"
FT                   /protein_id="AAC06847.1"
FT                   /translation="MMKIYLMGSDQRIVRCARVSFAKDSYVDEKRDKRLIRYLFKHRHA
FT                   SPFEHNIIAFEWKKEKWIELLSKLENPTVQVYYSNGFVFLNLRNAINVWELLPDAVKER
FT                   IKEAFPTTYGVIQRRGEIEDEELYSLPYTKDKAYVKEKIETSSGWIGLVDKLELETDMD
FT                   FYTFVVECPLFVARQWMRHRFGSYNEVSKRYVGKEFLEFYLPKYIRKQAEKNKQASVDE
FT                   PISESEVFIKKIENLISKSVKLYEEIIEKGGAKELARGVLPQFMKTRFYWTVPRISLDN
FT                   FITLRTHEGAQKEIREFAEAIKEMVGYRGTDKKNVI"
FT   gene            complement(439003..440085)
FT                   /locus_tag="aq_642"
FT   CDS_pept        complement(439003..440085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_642"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06852"
FT                   /db_xref="GOA:O66884"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66884"
FT                   /protein_id="AAC06852.1"
FT                   /translation="MGEFLELDGSYGEGGGQIVRTALFLSTLLQVPVRIYNIRAKREKP
FT                   GLKRQHLNIVKLLKRFAKAKVKGDELGSIELEYKPQKLKPGYYEVNFDTAGSIPLFLQT
FT                   ILPLSLFVPGEVVIKVIGGTDVPKSPTIDWVRFVFLHYIYKVPEFIRLEVLKRGFYPAG
FT                   GGIVQLSVRNKLEKQPENLQEVKEYLKDKVNLYRTERGEIRKIHVFSVAHEELRERKVA
FT                   ERQAKGAIEALKNLGYPEPEVYRQYANANSIGTSITIWLEDTKGNVLGADNLGKKGKLA
FT                   EVVGAEAVKKLHEDWSSGATVDRHLADHLIPLMALVGGEIRVPQFTGHLLTNIWVCEQF
FT                   LGKIFEVDEKEKIVRTQGIS"
FT   gene            complement(440091..440774)
FT                   /locus_tag="aq_644"
FT   CDS_pept        complement(440091..440774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_644"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_644"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06849"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:O66885"
FT                   /protein_id="AAC06849.1"
FT                   /translation="MIFYLLPSEKKQSTMDLVKEDYFSIWENREKNRFPELNPYRKELI
FT                   EYFKVETKPLAPAWRRYNGKFWDSLEFWCLPPEVQQNIIDRGIIISPLFGMLGVNDPIP
FT                   RYSVTFQDKYKGKKLTEFWKEVLKDISKKMFESSVIFDFLTTEQRETLTFPEDVTFVRF
FT                   DYIRKGKKVVNPMPHRAYTLRYIVEKNVDLNSLEKINFYDYKVSKIEKEGNVIRVIMES
FT                   EGRYI"
FT   gene            440821..442143
FT                   /locus_tag="aq_645"
FT   CDS_pept        440821..442143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_645"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_645"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06850"
FT                   /db_xref="InterPro:IPR018633"
FT                   /db_xref="UniProtKB/TrEMBL:O66886"
FT                   /protein_id="AAC06850.1"
FT                   /translation="MELHFADEPLKVSEEINKSILETLQEKEQIEVRGDYIIFKNFTGV
FT                   VGDCLVIPRKLAEHFKLINESGEKTQNFYERYKELFGKFLKYILKKLAKEHIIYTLSLS
FT                   SFPVDESKLNESKIFKLLVLLEKKEELINSLRLILSIPHKNLVEYETYKSLNEVSYVDS
FT                   NVIIDIVQNPEKLYETEKGIIEHEGKRYSPTAVLQYEFEESFDTPENRFVKHLLKELEI
FT                   LLSEELKDFFFLEELKEIKEEIEYTLRSDVFSEVGDLNFFPSNSQVLMKKAGYRELFQI
FT                   YRLLHLSFVPRIFEDLDLAFSLKDMATLWEYYVLIEILREFKEKFGTYKVIIDFEEKVE
FT                   GKTVYEEAQFKFENDLILYYQKSLYAYSGLRFRPDFYVKFKDNRFIFDAKFRIFENNEK
FT                   DLLQNMHYYRDGLKVTSAVAVCFGEKNKRVLFGRRMEVKNQ"
FT   gene            442506..443915
FT                   /locus_tag="aq_647"
FT   CDS_pept        442506..443915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_647"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_647"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66887"
FT                   /protein_id="AAC06851.1"
FT                   /translation="MNLKKIKEISLPEEITKSLLSEHQGRRVCKKFDQFSKENQEKLLN
FT                   FLSKEISNMQEATRIETGQQEKGTCLKNSSLKLDSHIVNSFYNALKTKGFVILAGLSGT
FT                   GKTKIFEEFVKCFPENHNLFFPIRPDFKDSKSLLGYYNPLKGEYHSTPLLEFILEASKN
FT                   YLEKGKNADTFFVLFDEMNLARVEYYFADFLSVLEAKRFENKDEAVKTNSFNEFLESLE
FT                   KDLSVLNEENYKFTSQSIKLHNEDTKDVPKELFLPPNLYFIGTVNIDETTYMFSPKVLD
FT                   RAFTIEFDVGSFKDYLEFLKANSDDENSNIDENLKEDFINKGEFAVIDKQKIKEFFENE
FT                   ENKKYLKDLEEINNTLKRFGLHFGYRVFDEIVMFLYNSQNSYFKFENLDEAFDLAVKMK
FT                   VLPKFHGTRQRLEKPVVELLNKLGVKNPEEKITDGIPPIDEIAETQFKHTVHKLLEMFY
FT                   KLKTQGFASFL"
FT   gene            complement(443927..444000)
FT                   /locus_tag="aq_t08"
FT   tRNA            complement(443927..444000)
FT                   /locus_tag="aq_t08"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:443964..443966,aa:Arg,seq:cct)"
FT   gene            444064..445179
FT                   /locus_tag="aq_648"
FT   CDS_pept        444064..445179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_648"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06853"
FT                   /db_xref="GOA:O66888"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:O66888"
FT                   /protein_id="AAC06853.1"
FT                   /translation="MELQVETVFQTVRDKEFLRIADKVLNEKRINQEEALYLYRSNELT
FT                   ALGLLAEYINRKKNGMYAYFIVNRQINPTNVCMYQCDFCAFGVKKSDPKAYEMSMEEIL
FT                   KKVEELYLMGGREVHIVGGIPSYWDYDKYVSIVREIKKRFPEIIIKAWTAVEIHHMAKI
FT                   SGKSYEEVLSELKEAGLDALPGGGAEIFSERVRKIIAPYKANAEEYLEVHRVAHKLGIP
FT                   SNATMLYGHVETLEERVEHMEMLRRLQDETGGFQVFIPLAYWPEGTRLGGTRTSSVDDL
FT                   KTIAISRIYLDNFDHIKAYWVTLGEKVAQVALNFGADDLDGTIQEEKIVHAAGTKSAYG
FT                   HSVDKLVNLIKKAGKTPAERDTFYRVVRVYD"
FT   gene            complement(445163..445759)
FT                   /locus_tag="aq_651"
FT   CDS_pept        complement(445163..445759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_651"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06854"
FT                   /db_xref="GOA:O66889"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:O66889"
FT                   /protein_id="AAC06854.1"
FT                   /translation="MILKASKEALKEAVEILKKGGIIVAPTDTLYGILADATNEEAVKR
FT                   LYKIRRPSGKPFLVLLPDESWLEKLCLDVKEEHKKLLKVEGLTLVFRKTCDKLDYVSKG
FT                   TLAVRLPQKGFIRDLLSELKKPVVAPSVNPEGKKPAESVEEAYNYFGNKVDLYIDAGVI
FT                   KGEPSTILDLTEGVKILREGKVKKEEIEKILNRKL"
FT   gene            complement(445756..446805)
FT                   /gene="nlpD1"
FT                   /locus_tag="aq_652"
FT   CDS_pept        complement(445756..446805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD1"
FT                   /locus_tag="aq_652"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_652"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06844"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:O66890"
FT                   /protein_id="AAC06844.1"
FT                   /translation="MNPFTVLILGILSALTLYASECSVYYKVKKGDSLWKIAKEYKTSI
FT                   GKLLELNPKLKNRKYLRPGEKICLKKKISKSKKVVKTKTKTNYKKSYVVYRVKRGDSLI
FT                   KIAKKFGVSVKEIKRVNKLKGNRIYVGQKLKIPVYKEVKTVKKEQKVYRTTSKYPKVVK
FT                   ERVRKRVIVIYRVRRGDTLIKIAKRFRTSVKEIKRINRLKGNLIRVGQKLKIPVYRWVY
FT                   IEKYAKIPKISLAFLPVDGKVVRDKRGVTIYTDCGKPVKAVESGKVIYSGNDISVYGNI
FT                   VILDHGTYTTVYAYNERNTVKADQKVKKGETIGYVGIKPDEGRCALHFEIRDKQGNLYN
FT                   PLMYLSKKK"
FT   gene            complement(447062..448048)
FT                   /gene="fliG"
FT                   /locus_tag="aq_653"
FT   CDS_pept        complement(447062..448048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="aq_653"
FT                   /product="flagellar switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:aq_653"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06845"
FT                   /db_xref="GOA:O66891"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="PDB:3HJL"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66891"
FT                   /protein_id="AAC06845.1"
FT                   /translation="MAQEKSALSKAQKAAVLLLSLPEEVSMNIVKELSEEELQKLFALA
FT                   KDLESVPEEEIENIAEELLDEIKKAGIKIKKPEEFIENIKKVIPPTLAEKFRGILELGD
FT                   AEKILKEIEKVDSRILASLLKNEHPQTIALFLSQLSPKKSAEIIQNLPEELKKEVVKRI
FT                   ATLENVNVQYVKELAQILLEEISSLGAKEALKLEGTAVAAELLNTLDKETRELILQSIG
FT                   QEDPLLEERIREKMFTFEDIRKLSDRDIIEILKVVDKNTLMIALLGAPEDIKQKFLSNM
FT                   SKRAAKLFLEDMEALGPVKKSEIEKAQRQVVNIIRKMIDEGKIEIGD"
FT   gene            complement(448050..448742)
FT                   /gene="frdB2"
FT                   /locus_tag="aq_655"
FT   CDS_pept        complement(448050..448742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB2"
FT                   /locus_tag="aq_655"
FT                   /product="fumarate reductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_655"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06846"
FT                   /db_xref="GOA:O66892"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:O66892"
FT                   /protein_id="AAC06846.1"
FT                   /translation="MKVKIKRYSDGDFRWEEYEVDGEGKTVLEILQNIKEIDPTLSFRA
FT                   MCRAGICGTCVVKVNGEHKLACNTRVYDDITLEPVDVAPPIKDLVVEHEFIYEKLKKGR
FT                   VWFEPLPTNIPLKPDELKNTEKSWDCILCGICNYVCPAIQADKNFGLPSTFTKAYGVVF
FT                   DKRNKKGLDKLKDLVPLNIQSCTHCKNCTFSCPKDCNPELLIKILENNMVQRGLIQRKE
FT                   QDFGFLGF"
FT   gene            448782..450404
FT                   /gene="topA"
FT                   /locus_tag="aq_657"
FT   CDS_pept        448782..450404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="aq_657"
FT                   /product="topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:aq_657"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06848"
FT                   /db_xref="GOA:O66893"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66893"
FT                   /protein_id="AAC06848.1"
FT                   /translation="MELFIVESPTKAKTIQKFLGKGFLVKATLGHVKDLPEKELGVDLR
FT                   TLKAKYVYKRGKKKLVEQLKKLSRRSSIVYLGTDPDREGEAIAYFLKKDLEKVNKNIKR
FT                   AVFYEITPEAIRESIRNAGDVNMNLVYAQFARRILDRLIGYLISPILWKEFKNYKLSAG
FT                   RVQSPALRLIVEREREIQNFKVKKYYYVKALLRKGSEEFWAIYDYRYENPSDAKIIAKK
FT                   LEKGYFSVYKVEKKKEKVSPPKPFITSDLQSEANAKFGFSSERTQKLAQELYEKGYITY
FT                   PRTDSYRMNEKKAKEFMNYIEKKYGKEYVGRLRRFREKATAQGAHECIRPTSLREEIPE
FT                   REELRLLYDLIFRRTIASLMKEMLLEREKVTVEAITPELKHPVYLVAKGLKIVFDGWSR
FT                   VYPSEITEEKLPELYEGDLLDLVKTTLEERKTQPPPRYTEGTLIKTLEKLGIGRPSTYA
FT                   TIVKTLKERGYVEVKKKALVPTEIAFQVVEFLMERFPTLMDYKFTAQMEEKLDLVEEGK
FT                   LNWKSVVYEFMEKIFGKELEMVR"
FT   gene            complement(450408..450480)
FT                   /locus_tag="aq_t09"
FT   tRNA            complement(450408..450480)
FT                   /locus_tag="aq_t09"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:450445..450447,aa:Phe,seq:gaa)"
FT   gene            450916..451977
FT                   /gene="mbhS1"
FT                   /locus_tag="aq_660"
FT   CDS_pept        450916..451977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhS1"
FT                   /locus_tag="aq_660"
FT                   /product="hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_660"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06862"
FT                   /db_xref="GOA:O66894"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:O66894"
FT                   /protein_id="AAC06862.1"
FT                   /translation="METFWEVFKRHGVSRRDFLKFATTITGLMGLAPSMVPEVVRAMET
FT                   KPRVPVLWIHGLECTCCSESFIRSATPLASDVVLSMISLEYDDTLSAAAGEAVEKHRER
FT                   IIKEYWGNYILAVEGNPPLGEDGMYCIIGGRPFVEILKESAEGAKAVIAWGSCASWGCV
FT                   QAAKPNPTTAVPIDKVIKDKPIIKVPGCPPIAEVMTGVIMYMVLFDRIPPLDSQGRPKM
FT                   FYGNRIHDTCYRRSFFNAGQFVEQFDDEGAKKGWCLYKVGCRGPTTYNSCGNMRWYNGL
FT                   SYPIQSGHGCIGCAENNFWDNGPFYERIGGIPVPGIESKADKVGAIAAAAAAGGAIIHG
FT                   IASKIRKSGEKEE"
FT   gene            451992..453893
FT                   /gene="mbhL1"
FT                   /locus_tag="aq_662"
FT   CDS_pept        451992..453893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhL1"
FT                   /locus_tag="aq_662"
FT                   /product="hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_662"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06861"
FT                   /db_xref="GOA:O66895"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:O66895"
FT                   /protein_id="AAC06861.1"
FT                   /translation="MKRVVVDPVTRIEGHLRIEIMVDEETGQVKDALSAGTMWRGIELI
FT                   VRNRDPRDVWAFTQRICGVCTSIHALASLRAVEDALEITIPKNANYIRNIMYGSLQVHD
FT                   HVVHFYHLHALDWVSPVEALKADPVATAALANKILEKYGVLNEFMPDFLGHRAYPKKFP
FT                   KATPGYFREFQKKIKKLVESGQLGIFAAHWWDHPDYQMLPPEVHLIGIAHYLNMLDVQR
FT                   ELFIPQVVFGGKNPHPHYIVGGVNCSISMDDMNAPVNAERLAVVEDAIYTQVESTDFFY
FT                   IPDILAIADIYLNQHNWFYGGGLSKKRVIGYGDYPDEPYTGIKNGDYHKKILWHSNGVV
FT                   EDFYKGVEKAKFYNLEGKDFTDPEQIQEFVTHSWYKYPDETKGLHPWDGITEPNYTGPK
FT                   EGTKTHWKYLDENGKYSWIKAPRWRGKACEVGPLARYIIVYTKVKQGHIKPTWVDELIV
FT                   NQIDTVSKILNLPPEKWLPTTVGRTIARALEAQMSAHTNLYWMKKLYDNIKAGDTSVAN
FT                   MEKWDPSTWPKEAKGVGLTEAPRGALGHWVIIKDGKVANYQCVVPTTWNGSPKDPKGQH
FT                   GAFEESMIDTKVKVPEKPLEVLRGIHSFDPCLACSTHLYNEKGEEIASVRVQGVVHV"
FT   gene            453886..454572
FT                   /gene="hoxZ"
FT                   /locus_tag="aq_665"
FT   CDS_pept        453886..454572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxZ"
FT                   /locus_tag="aq_665"
FT                   /product="Ni/Fe hydrogenase B-type cytochrome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_665"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06857"
FT                   /db_xref="GOA:O66896"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:O66896"
FT                   /protein_id="AAC06857.1"
FT                   /translation="MFKRIFIFSASLRIWHWINFLTIMVLFFTGLYIGTPYFTTSSGYE
FT                   ATYAYDKNITMGFIRFLHFSAGYVLLFSFLFRIFIAFFRKGDRLFIPKFWTIEYWEGIK
FT                   ETLKEYLLIGSRKPMIRNPLARTAYFFVYLMIFFMIATGFGMYGLSDPDGFWASVFGWV
FT                   VWSLGGEFEAHYWHHIVAWLIILFFIVHVYFVSREDFVHKNGEVSSMFNGSKFFKKDPV
FT                   DLKDIK"
FT   gene            454585..455127
FT                   /gene="hupE"
FT                   /locus_tag="aq_666"
FT   CDS_pept        454585..455127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupE"
FT                   /locus_tag="aq_666"
FT                   /product="HupE hydrogenase related function"
FT                   /db_xref="EnsemblGenomes-Gn:aq_666"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06859"
FT                   /db_xref="GOA:O66897"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:O66897"
FT                   /protein_id="AAC06859.1"
FT                   /translation="MRKFLPFVGLASFAFAHPGHFHGVNPFNSGLIHPLTGLDHLSVMV
FT                   AVGLLGSYYAGKKAFLPALTFVSFMTLGSILGLLGVSVPFVESGIILSVALMGILLFAK
FT                   DLKLSYVLPLIGIFGILHGVAHGYEAPQTLHPVYYVLGFVLSTAALHFTGLLFGKALKE
FT                   KLVRVSGLLLLALAFLL"
FT   gene            455140..455628
FT                   /gene="hupD"
FT                   /locus_tag="aq_667"
FT   CDS_pept        455140..455628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupD"
FT                   /locus_tag="aq_667"
FT                   /product="HupD hydrogenase related function"
FT                   /db_xref="EnsemblGenomes-Gn:aq_667"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06858"
FT                   /db_xref="GOA:O66898"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:O66898"
FT                   /protein_id="AAC06858.1"
FT                   /translation="MITVLGIGNILLSDEGLGVRTVEELQRRYEFPENVKVLDGGTLGI
FT                   DLLYHIEGTEKLLIIDAVLGGKKPGTFYKIKNENVKKYFKSKVSMHELGIQEVLALLEV
FT                   LEKPIKEIVVLGLEPKSLEVSTELTPEIQEKIPLLVEEALSQLKEWGVEVKEKSHEQC"
FT   gene            455615..455953
FT                   /locus_tag="aq_668"
FT   CDS_pept        455615..455953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_668"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_668"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06865"
FT                   /db_xref="InterPro:IPR010893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66899"
FT                   /protein_id="AAC06865.1"
FT                   /translation="MSSVKFLQNLKRINEEDLRNLMEKGETFVLYVRSERLYDKVKEIF
FT                   DVDVVFPELAKSFEGIPFYWGDADELKELNVIPPSVLIFKEGKPVEFLQGIKTWAEYTR
FT                   KLKESLLC"
FT   gene            455947..456342
FT                   /locus_tag="aq_669"
FT   CDS_pept        455947..456342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_669"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_669"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06866"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="InterPro:IPR038527"
FT                   /db_xref="UniProtKB/TrEMBL:O66900"
FT                   /protein_id="AAC06866.1"
FT                   /translation="MLMNAIPILKEILQALKDLYEKGEEHVIYINKLPITPEDRELLLD
FT                   VLGEGQVKITYSSKTQPAEWKETGIFGVWIGIIKNRDDKPVLETIEITYFPKLASAQKE
FT                   DVQESIKYLEEKISEIETKLKEEEKNV"
FT   gene            456335..457114
FT                   /gene="hypB"
FT                   /locus_tag="aq_671"
FT   CDS_pept        456335..457114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB"
FT                   /locus_tag="aq_671"
FT                   /product="hydrogenase expression/formation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:aq_671"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06860"
FT                   /db_xref="GOA:O66901"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O66901"
FT                   /protein_id="AAC06860.1"
FT                   /translation="MCKDCGCSIPEHNHEHEHHHHHHHTNPALGDKKTVEVLKKILSAN
FT                   DEQAESNRRHFERHGILAVNLMSSPGSGKTTLLERTIELLKDELKIGVIEGDLETNRDA
FT                   ERIKKKGAPAYQITTGQACHLDAFMVHEGIHHLPLEELDIVFIENVGNLVCPASYDVGA
FT                   HLNVVLLSTTEGEDKPEKYPVMFKNSQLMLITKADLLPYMDFDVEKAVESARKVNPSLD
FT                   VITLSAKTGEGMELWLDYLKFKLKVLRNALQKAKASP"
FT   gene            457083..459323
FT                   /gene="hypF"
FT                   /locus_tag="aq_672"
FT   CDS_pept        457083..459323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="aq_672"
FT                   /product="transcriptional regulatory protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:aq_672"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06863"
FT                   /db_xref="GOA:O66902"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:O66902"
FT                   /protein_id="AAC06863.1"
FT                   /translation="MPFKRLKLHLKGAVQGVGFRPFVYRIAKELGLKGFVINDSKGVYI
FT                   EVEGEEERLKKFLFKLNREKPPLARIYSQEIQFLEPVNYEDFVIRKSEEKGEKEVLVLP
FT                   DIATCEDCLRELFTPEDRRYMYPFINCTNCGPRFTIIERLPYDRKNTTMKVFEMCPECK
FT                   REYENPLDRRFHAQPNACPKCGPWVSLYKDGKLIAEKNEALELLIEEIKIGKIVAVKGV
FT                   GGFHLICNATNEESVRTLRKRKRRSEKPFAVMFKSLEQVEAYANPTELEKALLISPERP
FT                   IVLIQKKKELAPSVSPGLKRVGAFLPYSPLHHLILNSLDFPVVATSANISEEPIIKDNK
FT                   EALEKLGELADLILVHNRDIKRRCDDSVVKVVSGVPTPIRRSRGYAPLPVEVPFELPKR
FT                   VLAVGGMLKNTFALGFKNQVILSQHIGDIENLNTLKVFEESVFDLMELYEFEPDVVVCD
FT                   MHPRYETTRWAEEFSRKRGIPLIKVQHHYAHMLSCMAENGIKEKVLGIAWDGTGYGEDG
FT                   TLWGGEFLVADYTSYERAFNFKPVKLIGGEKAVKEPRRVALSLLFDIFGEEALNLDLLP
FT                   VKSFSERELKNLYLAWKKGINSPLSSSVGRLFDALASLLNLKQILSYEGQGAMMVEDLY
FT                   DPLVKDNYPYEIRGKEVDLRKAFLEVLKEKDKSLAASRFINTLAKVCEDIALMVGIERV
FT                   CLSGGVMQNDPLVTKIKELLEKEKFKVYTHQKVPPNDGGIALGQAVFGLSLV"
FT   gene            459334..459732
FT                   /gene="atpC"
FT                   /locus_tag="aq_673"
FT   CDS_pept        459334..459732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="aq_673"
FT                   /product="ATP synthase F1 epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_673"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06856"
FT                   /db_xref="GOA:O66903"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66903"
FT                   /protein_id="AAC06856.1"
FT                   /translation="MIQVEIVSPQGMVYSGEVESVNVPTVEGEVGILENHMYLMTLLKP
FT                   GLVYFNGDDKNGIAVTYGVLDVTPQKVLILAEEAYEVGKLPPASKLKEEFEEAVKKMAT
FT                   AQTMEELKEWEKEAEKARTLLELVEKYR"
FT   gene            459716..460435
FT                   /locus_tag="aq_674"
FT   CDS_pept        459716..460435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_674"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06868"
FT                   /db_xref="GOA:O66904"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O66904"
FT                   /protein_id="AAC06868.1"
FT                   /translation="MKSTDNSKPVPFFRGKLKFFQPKEHKISVDLVLFLSKIKPPKRNY
FT                   RIIDLGAGFGFLSITLAKKYGVKVVAFEYDERMVKLLRKNVKLNGVEHLVEVVEGDIKE
FT                   IEKHLSRGSFNLVVSNPPFYPINYSPNPEPYHFEVYATLKDFVRASSYLLKDGGELYLL
FT                   SPCFRLYELTEYLSNFNLPLRKLSLIYPTPLKRARLAITVSVKNVKGQLECDKPLIINK
FT                   ENGEYTEEVKQLLENFL"
FT   gene            complement(460432..461010)
FT                   /locus_tag="aq_676"
FT   CDS_pept        complement(460432..461010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_676"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06869"
FT                   /db_xref="GOA:O66905"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="PDB:5XJ5"
FT                   /db_xref="PDB:5XJ6"
FT                   /db_xref="PDB:5XJ7"
FT                   /db_xref="PDB:5XJ8"
FT                   /db_xref="PDB:5XJ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66905"
FT                   /protein_id="AAC06869.1"
FT                   /translation="MKALFLVIFAYLLGSITFGEVIAKLKGVDLRNVGSGNVGATNVTR
FT                   ALGKKYGVLVFFLDFLKGFIPALIAVKSFGIDSWVLTFTGLASVLGHMYPVFFGFKGGK
FT                   GVATALGVVFAVSPSVALFSFLVWLGIFLWKRYVSLASITATISAFLFLFVAGYPVNVL
FT                   FMAIVIGALIIYRHRENINRLLTGREHRF"
FT   gene            complement(461021..461599)
FT                   /locus_tag="aq_678"
FT   CDS_pept        complement(461021..461599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_678"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_678"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06867"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66906"
FT                   /protein_id="AAC06867.1"
FT                   /translation="MLIVLLALLLLSCSPKYKIVKEYVLPQNTLCVQDCKEKFLECKKA
FT                   CFESYNACLKESVERARKVYLSLLKDYERKSREYEKAYENYLKELRTYRETLYRIKEDL
FT                   KFYERICSAYKDKEACDKKEWLKKRIRFYERRKPLPPQKPTMPSYEILLKREREACSCE
FT                   CGCEKLYDACFESCRGKVRIKKVCVENCD"
FT   gene            461663..463174
FT                   /gene="atpA"
FT                   /locus_tag="aq_679"
FT   CDS_pept        461663..463174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="aq_679"
FT                   /product="ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_679"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06855"
FT                   /db_xref="GOA:O66907"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66907"
FT                   /protein_id="AAC06855.1"
FT                   /translation="MATLTYEEALEILRQQIKDFEPEAKMEEVGVVYYVGDGVARAYGL
FT                   ENVMAMEIVEFQGGQQGIAFNLEEDNVGIIILGSETGIEEGHIVKRTGRILDAPVGEGL
FT                   VGRVIDPLGNPLDGKGPIQFEYRSPVEKIAPGVVKRKPVHEPLQTGIKAIDAMIPIGRG
FT                   QRELIIGDRATGKTTVAIDTILAQKNSDVYCIYVAVGQKRAAIARLIELLEREGAMEYT
FT                   TVVVASASDPASLQYLAPFVGCTIGEYFRDNGKHALIIYDDLSKHAEAYRQLSLLMRRP
FT                   PGREAYPGDVFYLHSRLLERAAKLNDDLGAGSLTALPIIETKAGDVAAYIPTNVISITD
FT                   GQIYLEADLFNKGIRPAINVGLSVSRVGGAAQIKAMKQVAGTLRLELAQFRELEAFVQF
FT                   ASELDKATQQQINRGLRLVELLKQEPYNPIPVEKQIVLIYAGTHGYLDDIPVESVRKFE
FT                   KELYAYLDNERPDILKEISEKKKLDEELEKKIKEALDAFKQKFVP"
FT   gene            complement(463190..464380)
FT                   /gene="arsA1"
FT                   /locus_tag="aq_682"
FT   CDS_pept        complement(463190..464380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA1"
FT                   /locus_tag="aq_682"
FT                   /product="anion transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_682"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06864"
FT                   /db_xref="GOA:O66908"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66908"
FT                   /protein_id="AAC06864.1"
FT                   /translation="MRIILFSGKGGVGKTTISAATGYKLSQLGKKVIVVSLDPAHSLAD
FT                   SFDVPEEERRKAKGLPIKINENLEIQEIDIQEEIERYWGEVYRFIELLFHTTGLHEILA
FT                   DELAILPGMEEITSLLYVNKYYREGNHDVLILDLPPTGESIRFVSMPTVMKWYMKKIFK
FT                   TERLIMKVARPTVGRMTDVPLPDEEYFKALETFYERLKGVDEILINPDITSIRIVSNPE
FT                   KMVLKESQRAFLYFLLFGVNVDAVIVNKVIPEEVIQQENCSFLEKWLNIQKKYVKEIES
FT                   YFSPVPVFKVPLLEEEVVGLERLEKLAQLIYGDEPPDKIFHKEIPYKIEQLDGKYVIRI
FT                   KAPGVKKESISLVKGEDEIVVRVGNFKAHVMLPRKLRNLEPERAKVEKDEILIFMS"
FT   gene            464435..465184
FT                   /locus_tag="aq_684"
FT   CDS_pept        464435..465184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_684"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_684"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06876"
FT                   /db_xref="GOA:O66909"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:O66909"
FT                   /protein_id="AAC06876.1"
FT                   /translation="MKIAHISDLHVKCEWYEDRLGNNLVKYLNAQKPDLLIITGDLTDY
FT                   GYYAEYKRAYSFLELIEVEKRVVVPGNHDARNEGYELFEEFFGTRMPYYEDEYMVIIGM
FT                   DSSLPDREEGHIGRKGYKFLRETLKDKGDKLKIVALHHHVVPIPATGSDLAILTDAGNL
FT                   MKVVDELGVELVLTGHKHKAWVWKLNETYYVTAGTATTRRLKAKDYPSFYMLYLEDEKN
FT                   IRMEKVNTETLKVEEVYTLNFEEGKER"
FT   gene            465181..465615
FT                   /gene="arsC"
FT                   /locus_tag="aq_685"
FT   CDS_pept        465181..465615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="aq_685"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_685"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06873"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:O66910"
FT                   /protein_id="AAC06873.1"
FT                   /translation="MKIAFICTGNSARSQMAEGFAKYYAKKYGLDLEVYSAGSNPAKRI
FT                   APEAIKVMKEKGIDISAQYPKKLEDIPLNEMDLIITLCGGAKESCPTVPGARQEHWDLP
FT                   DPAAYEGSEEERLEFFRKVRDEIEKRVIKLMEELKEKVKA"
FT   gene            465627..468407
FT                   /gene="uvrA"
FT                   /locus_tag="aq_686"
FT   CDS_pept        465627..468407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="aq_686"
FT                   /product="repair excision nuclease subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:aq_686"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06874"
FT                   /db_xref="GOA:O66911"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66911"
FT                   /protein_id="AAC06874.1"
FT                   /translation="MDRIVIRGARQHNLKNIDVEIPKNKLVVITGPSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLGVMEKPEVDSIEGLSPAIAIDQKTTSKNPRSTVGTVTEI
FT                   YDYLRVLWANVGKPHCPHCGNLLSGLSAHEILDRIVEKYKGKRVMILSPIVRGKKGEFR
FT                   ELLRQIEKWGYSRVKVDGELRRVIEVPPLEKNKKHTIELVIDRLTVSEEERARLLEDVE
FT                   KALEFSSGLVKIEEVESGKEELFSEKLVCPEHGFSIPELSARLFSFNSPYGACPSCKGL
FT                   GVKWEIDPAVLIDPEKPAVKAVKIVESGYFNYLRFPIANVIRKLGYDPRTPWKKLPESV
FT                   RATVLYGSESLNFEGIIPHLERRFLEEESERIREEIEDYIVEKPCPECKGARLRKEALA
FT                   VLIDGKSIWDVVNMPVGKAKEFFEELYEKLEGKEKIIADRLLKEIIERLGFLVNVGLDY
FT                   LSLSRSATTLSGGEMQRIRLATQLGSKLTGVLYVLDEPSIGLHPRDTSKLINTLKGLRD
FT                   LGNTVVVVEHDPETIESADHVIELGPGAGKHGGYLVAQGTVEEIKSHPSSLTGAYLSGR
FT                   KEIPVPKERRKPSGKFIRIVRAKEHNLKNINVDIPLGLFVCITGVSGSGKSTLIYDILY
FT                   KYAKNYFYGTHEQVGEVEKIEGLENIDKVINIDQSPIGRTPRSNPATYTKVFDLIRNLF
FT                   AQTPEAKARGYKPGRFSFNVKGGRCEACQGEGVIKVEMHFLPPVYVTCEVCKGKRYNRE
FT                   TLEITYKGKNIADVLEMTVDEAYDFFENHPAIRRKLQILKDVGLGYIKLGQPAPTLSGG
FT                   EAQRIKLARELSKKETGRTLYLLDEPTTGLHMDDVKKLIDVLQRLVDKGNTVVVIEHNL
FT                   DVIKCADWIIDLGPEGGERGGQVVAVGTPEEVAQNPNSYTGKYLRKYLKKETLKV"
FT   gene            complement(468404..469414)
FT                   /locus_tag="aq_689"
FT   CDS_pept        complement(468404..469414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_689"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06878"
FT                   /db_xref="GOA:O66912"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:O66912"
FT                   /protein_id="AAC06878.1"
FT                   /translation="MEFKCRIHEKIREGEELNEVDKRNLKEVIKRMFNFFVEHNIVPVP
FT                   RNYAKWFFVFCYIVENNIEATTEQIIDIYYKIFKEAKIDLRLSNEIERILTEVRHTVYE
FT                   YLETVEKYDKKIEKHEKTLEDYSRQEEISILKDILKEVSELRKVNQELIAKLQEKQKET
FT                   ERLKKELDALKKQAFIDYLTGLKNRRSIQKALEDYFKDYKNYGYPFSVIMMDLNNFKEI
FT                   NDEYGHLVGDCILKGIGEILRKYLRAKDAIGRYGGDEFLIILPGVKLEDAVNIARRLKT
FT                   VIQNHTFYCEDKELKVSASFGILEVNENFNSPEEILKEVDKKLYEAKKNPDHIAY"
FT   gene            complement(469427..470764)
FT                   /gene="gidA2"
FT                   /locus_tag="aq_691"
FT   CDS_pept        complement(469427..470764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA2"
FT                   /locus_tag="aq_691"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:aq_691"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06872"
FT                   /db_xref="GOA:O66913"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66913"
FT                   /protein_id="AAC06872.1"
FT                   /translation="MKEKVIVIGGGLAGSEAAWRLANEGHRVILYEMRPKKMTPAHKTG
FT                   NLAELVCSNTLGGLELTTGAGLLKAEMQKLGSLVIEAAKVARVPAGGALGVDRKIFSEY
FT                   ITEKIESHPNITLIREEVKEIPEDEVVVIATGPLTSDALSEKIKELVGYDTLYFYDAIA
FT                   PIVEAESVDFSKGFWGSRYGKGGDDYFNCVLTEEEYKKFYEELLKAEKVKPKDFEKAVH
FT                   FEGCLPIEEMAERGYKTLLFGPMKPVGLVDPRTGKEPFAVVQLRKENKEGTLLSLVGFQ
FT                   TKLTYKEQKRVFRLIPCLRNAVFVRLGSMHRNTFIQSNKVLTHYLNLKKKENIFFAGQI
FT                   TGVEGYVASSATGILAGINAGRLARGEKPLKAPTETMLGALVNYIVTKEGELQPMNPVF
FT                   GLLPPLEKKVRDKKKRKELMAKRALETMEKWIKENNLVPEGLVKVC"
FT   gene            470797..471501
FT                   /gene="kpsU"
FT                   /locus_tag="aq_692"
FT   CDS_pept        470797..471501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsU"
FT                   /locus_tag="aq_692"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_692"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06870"
FT                   /db_xref="GOA:O66914"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="PDB:2Y6P"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66914"
FT                   /protein_id="AAC06870.1"
FT                   /translation="MRRAVIIPARLGSTRLKEKPLKNLLGKPLIRWVVEGLVKTGERVI
FT                   LATDSERVKEVVEDLCEVFLTPSDLPSGSDRVLYVVRDLDVDLIINYQGDEPFVYEEDI
FT                   KLIFRELEKGERVVTLARKDKEAYERPEDVKVVLDREGYALYFSRSPIPYFRKNDTFYP
FT                   LKHVGIYGFRKETLMEFGAMPPSKLEQIEGLEQLRLLENGIKIKVLITENYYHGVDTEE
FT                   DLKIVEEKLKNL"
FT   gene            complement(471539..472783)
FT                   /locus_tag="aq_693"
FT   CDS_pept        complement(471539..472783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_693"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_693"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06877"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66915"
FT                   /protein_id="AAC06877.1"
FT                   /translation="MLKRLMLASAILPVVSFAESDPLDVLLKKLEEKGVITKEEAKEVK
FT                   KVAKKHPHLKVKIRLQPRIDFGDIYKENNDYKSRSDFYFRRVRLEISKEWKNIPFGKKL
FT                   KINFTLHSDKGERDYDYKKGEKEHHSFDPKVKYAYADWTFVDEFAVRIGKNKIPYSRVS
FT                   LTSSSRQLLIERPYVTEDAKKWLGDYDSNQIMFHGKVAGGIFRYMLSIWDGSTIESKNK
FT                   TGGTVKADTSLGDAYAIRLEFSPPGFVEKKKDDTGIGEKNKGDVISVGLNYAKNSDFDI
FT                   TDKNIKNEEATVWGGDIFGRFHLGPGALVAQAEYVKMKYDKLDLEEKGYYIQAGYLIPT
FT                   PYGKFEPAARYEHFKQEDKKNDVTKHKKDIITLGFNHYIKGHKIKWGYNVLFIDNKEKD
FT                   EKDQTVHQIQMQFYF"
FT   gene            complement(472894..476142)
FT                   /gene="acrD1"
FT                   /locus_tag="aq_695"
FT   CDS_pept        complement(472894..476142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrD1"
FT                   /locus_tag="aq_695"
FT                   /product="cation efflux system (AcrB/AcrD/AcrF family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_695"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06875"
FT                   /db_xref="GOA:O66916"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:O66916"
FT                   /protein_id="AAC06875.1"
FT                   /translation="MYGLAGRLANFFIDSKLTPILILVSLALGLFAVLTTPREEEPQIV
FT                   VPMIDIFIPYPGATPEEVEARVVFPLEKILWELKDIEYIYSASTNDMGIVTARFYVGTD
FT                   PVKALVDLNSKMMSALDKAPPGVILPPVVRLMSIDDVPILTLTLWGENYDWYELRRLAA
FT                   TLQNEIKKIENVANVYLIGGRPRQIRIILDPAKMAAYGISPLYIDQLLRSANAQAISGK
FT                   INKGNMEYLVKTGPFFKSVRDVENVVVGVRNGRVIFLKDVAKIVDGPSEIKDYVFFGIG
FT                   EAHEYKGIEGKPGELYPAVTIAVAKRKGTNAVVVAEQVIEFVESLKGKVIPSDVNITVT
FT                   RNYGETAQEKALELLEHLFIATFSVVLLIAVSLGVREAIVVGLAVPVTLSIALFLNEMY
FT                   GFTLNRVTLFALIFSIGILVDDAIVVVENIHRWFEMQKLPPRDAIVHATDEVGNPTILA
FT                   TFTVIAALMPMAFVTGMMGPYMRPIPINASVAMFFSLLVAFIVTPWAAYHILKKEREHE
FT                   EINIRKTLFWKLYCHIMYPLLASKLKRYAFYLFVLALMGGSVGLLFTKTVLVKMLPYDN
FT                   KSELEIVLDMPEGTTLEDTLKVAKEIADYVGRYSIVTDYQIYAGTAAPFTFNGLVRHYY
FT                   LRQASNLAEIQVNLVGKHDRDLQSHEFAKLIRPKVHEIASKYGAKYVAVVEVPPGPPVL
FT                   SPIVAEVYAPDMKVQREFAWRVLKIFKDSPAITDEGIYLEYPAPMIRFEVKEDKVKLAG
FT                   LTKQEVVYTLKALIGGWQAGIMQTTDTEHVPIIIRLDEKYRVPELLKNVKIPNREGKLI
FT                   PLSELVEIKEGPIPETIYHKNLRRVIYVIGDVAGREEAPIYGILDVRDKILNIENPYGE
FT                   VGELWMSLPVLEDRVYVKWDGEMHITLEVFRDLGLAFAVAVFVMYVLVLGWFKDFRIPG
FT                   IILAPIPLTLVGIIPGHWLMDKIMGNVFFTATSMIGFIALGGIIVRNSILLVDFAEQRL
FT                   KEGLPVHVAVVEAGVIRTRPILLTAAAVIIGAFVIIFDPIFNGLAISLIFGTIGSTTLT
FT                   LVLIPVMYYASKIKRMPPEACPTPEMIKRDLMAD"
FT   gene            complement(476147..477271)
FT                   /gene="acrE"
FT                   /locus_tag="aq_698"
FT   CDS_pept        complement(476147..477271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrE"
FT                   /locus_tag="aq_698"
FT                   /product="acriflavin resistance protein AcrE"
FT                   /db_xref="EnsemblGenomes-Gn:aq_698"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06871"
FT                   /db_xref="GOA:O66917"
FT                   /db_xref="InterPro:IPR005695"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:O66917"
FT                   /protein_id="AAC06871.1"
FT                   /translation="MKTLIKYMVFLVIPIVLIIMWLAGVFHPKIHAEEVKRETKTVSGL
FT                   VVEPVKVVKEVPVEYPGTIVAGDRAEISTRVMGYVVDVKVKEGDFVKKGQTLFVIDPRD
FT                   VKAQINIMKQRIAQAQKNYEAAKAHYEAVKKTYERFKKLLKEGAITQHEFDQVEAQYLA
FT                   AKAKLQAAKAEIRVAREAYNSAKAQLSYAEVKAPFDGYVIQKMVDRGDIANPGMPLAVL
FT                   ETRPYKVEVSFPEKYFGEINIGDTLEVYVEKLGRVFPAKVVEVEPAVDPVSRTFKVKAL
FT                   IDDNNVKSGLFVKVFKLEKIEEPTVLIPEKAIYKRWDFTGVWVVKPDGTLQLRLIRLGR
FT                   KLGNYYEVLAGLSPGERIVVEGIERACEGCRVGG"
FT   gene            complement(477268..478581)
FT                   /locus_tag="aq_699"
FT   CDS_pept        complement(477268..478581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_699"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06879"
FT                   /db_xref="GOA:O66918"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:O66918"
FT                   /protein_id="AAC06879.1"
FT                   /translation="MVLIGFLLLVGLSFAAELPLKVFIKDALQNNLELSSQRREVKASE
FT                   YEYKSVRGLLFPTVKLEETYTKTDISSYYLFTKLNQERITLQDFTPSKLNDPGSIQNFE
FT                   TKLTLEIPIWMGGKLRAFKNMAKNKWKGDKTIYGRKEEEVILKVYEAYANAVLAKNAVE
FT                   VAKQAVKDAEEHVRLAEKAYKTGVALFADVLRAKVYLSKAKEKLVQAQNNYEVAKKALE
FT                   LLTNKNYGEFDVKDFSKCPSVKVEELKSKALNHREDYLALKYYIKSLKEGQKSALGDIL
FT                   PQVFAFANYSMYDENTPFGSQGEGYMLGVGLKWNFNTGLSPIYKKKSFKEKELALKRKR
FT                   ELLAKAIMFEIDKAFAEYENALKTLESAKSRKEEAKEVLRVIEKRYEVGMARMVDLLDA
FT                   QTQLDMARFEYAKALRDCNVAYAKALFSAGLLKEEVLK"
FT   gene            complement(478635..479876)
FT                   /locus_tag="aq_701"
FT   CDS_pept        complement(478635..479876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_701"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06891"
FT                   /db_xref="GOA:O66919"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:O66919"
FT                   /protein_id="AAC06891.1"
FT                   /translation="MKKSKILVHICCAPDAIYFLKKLREDYPESEIIGYFYDPNIHPYE
FT                   EYRLRYLETERICKELGINLIEGEYDLENWLERVKGYEDEPERGKRCQICFDYRLEKSA
FT                   EVAKELGCDALTTTLLMSPKKSIPQLKKAGEEATKRTGIEFLAPDYRKGGGTQEMFKLS
FT                   KEREIYQQDYCGCIYGLFKQKNGKIFWDLVGFLGRRPGSKEERNFIKEIRIFAEENSFP
FT                   VKEYEFPFLNWKVLKGKIEVDGEVIPSYVYPYSQSIRGIVKGKVEHVHGDKLFLNKQFV
FT                   RIILKEPFGDVPLLENTPLSNPTFIVPYAYREKILKGKVKAELQTEFMPEKSSVLFIGS
FT                   PSAKELWGVPADTLQDGRGVSKEEVIELIENNGEKIMKEEVGLIILGAESLRGGSSFVK
FT                   DFLGREVKLILEWK"
FT   gene            complement(479863..480273)
FT                   /gene="merR"
FT                   /locus_tag="aq_702"
FT   CDS_pept        complement(479863..480273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR"
FT                   /locus_tag="aq_702"
FT                   /product="transcriptional regulator (MerR family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_702"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06883"
FT                   /db_xref="GOA:O66920"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:O66920"
FT                   /protein_id="AAC06883.1"
FT                   /translation="MKKRKAYYTIGVVAKMYNIHPQTLRLYEREGLLKPSRSEGNTRLY
FT                   TDEDLERLEFILFLTRELGVNLAGVDIILNLKEQMEQMQKQIDQLMEFIQNELSKLQGE
FT                   AYQRAIVKVPKTKVMKFEEVIVSRQKKSDEEE"
FT   gene            complement(480279..481409)
FT                   /gene="dnaJ2"
FT                   /locus_tag="aq_703"
FT   CDS_pept        complement(480279..481409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ2"
FT                   /locus_tag="aq_703"
FT                   /product="chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:aq_703"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06881"
FT                   /db_xref="GOA:O66921"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66921"
FT                   /protein_id="AAC06881.1"
FT                   /translation="MASSTKKDYYEILGVPRNASQEEIKKAYRRLVRKYHPDICKKPEC
FT                   EEKFKEINEAYQVLSDPEKRKLYDMYGHAAFEGAGAQQRVETTEIPPIEEILREFFDFD
FT                   IGSIFERATGRRRARRRRSVKGEDIVVPVEITLEEAFKGTTVPIEVEREVPCSACGGTG
FT                   YDESKSRTCPTCGGRGETVQGNWFFQVRQTCPTCGGEGVIYENCHACTGRGYGLVKETI
FT                   KVKIPPGVRDGSKLVVEGKGHAGRYGGPPGDLYIIVKVKPHKIFERKGDDLYVDVNITY
FT                   PEAVLGTEVEVPTLDGEKVKVKIPPGTKEGELIKVPGKGMPRLKGSGRGDLYVRVHIDV
FT                   PKIGVLSKLLGDGKKVEELLKQLQEVLPKPERIVER"
FT   gene            complement(481480..482343)
FT                   /gene="truB"
FT                   /locus_tag="aq_705"
FT   CDS_pept        complement(481480..482343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="aq_705"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_705"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06885"
FT                   /db_xref="GOA:O66922"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66922"
FT                   /protein_id="AAC06885.1"
FT                   /translation="MDGALLIDKPKGITSTEVVERVKEKLKARKAGHTGTLDPIATGLL
FT                   IILINKATRFSQFFIGMPKTYRFTVKFGAETDTYDAQGKVVETYEGELNCDKLKEVLNE
FT                   FRGEILQTPPPFSAKKIKGRRAYELARKGKKVELKPVKITVYSLELLSCNPREKEAEFL
FT                   AEISSGGYVRSLAYDIGKKLGIGGYMKELRRLKIDEISVEEAVSLEEFLSSENPEEYVL
FT                   PVDTLFRVIPEVRLNTFEAGKILQGKRILIKNYDYEGLVKIYEDSKFIGIGELKGGVLS
FT                   PKRLLV"
FT   gene            482374..483567
FT                   /gene="trpB1"
FT                   /locus_tag="aq_706"
FT   CDS_pept        482374..483567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB1"
FT                   /locus_tag="aq_706"
FT                   /product="tryptophan synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_706"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06880"
FT                   /db_xref="GOA:O66923"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66923"
FT                   /protein_id="AAC06880.1"
FT                   /translation="MYNYPDERGYFGPFGGKFVPETLMYALEELEEKYRELKSDPEFQK
FT                   ELDYYLREYAGRPTPLYFAEKLTKYVGGAKIYLKREDLLHTGAHKINNTIGQCLLTKRM
FT                   GKKRVIAETGAGQHGVATATASALFGLECVVYMGEEDAERQALNVFRMKLLGAKVEIVK
FT                   SGSRTLKDAINEALRDWVTNVESTHYVIGSVVGPHPFPMIVRDFQSVIGRETKEQILQK
FT                   EGRLPDAIVACVGGGSNAMGIFYPFVEDKGVQLIGVEAGGYGLETGQHAASICGGSVGI
FT                   LHGMKSYFLQDEEGQIQPTHSISAGLDYPGVGPEHALFHEIKRAKYTTATDEEALEGFK
FT                   LLARTEGIIPALESAHAVIKAVEVARELGKDGIVVINLSGRGDKDMAHVMKHLSLEG"
FT   gene            483583..484644
FT                   /locus_tag="aq_707"
FT   CDS_pept        483583..484644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_707"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06892"
FT                   /db_xref="GOA:O66924"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66924"
FT                   /protein_id="AAC06892.1"
FT                   /translation="MEILVIGGGVIGLSIGVELLLAGHDVRLLVRDKREGASWVAGGML
FT                   APFSEGLRGDFLRFSVESLRLWHDYLERLKEISGRKVFFSQGILRVAFDEKEEKKLRED
FT                   VKFYSQEVCQNLISYDAEELLKEFPYLSSEVRYGVIYGDEGNVDTEELMEALYVAFEKL
FT                   GGEIINEDAVKILRNGERIEKVFGFFEEFTADYYVFATGAWLKEHFGFPVFPVKGQILR
FT                   VEAPLKDYVVYSSRAYIIPREKDLLIGATTENAGFDTKTTLEGVKKLSEGAISSVPQLK
FT                   EAQLLEVRVGFRPGTPDELPVFYFGENFSVYGGHYRNGILLAPATAEVALKLIDQGEVS
FT                   EYFKTFSPYRFKE"
FT   gene            484648..486630
FT                   /gene="hyuA"
FT                   /locus_tag="aq_708"
FT   CDS_pept        484648..486630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyuA"
FT                   /locus_tag="aq_708"
FT                   /product="N-methylhydantoinase A"
FT                   /db_xref="EnsemblGenomes-Gn:aq_708"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06888"
FT                   /db_xref="GOA:O66925"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:O66925"
FT                   /protein_id="AAC06888.1"
FT                   /translation="MRVYVGVDTGGTFTDFVYWDGKEWRVLKIPSTPSNPAEAVLKGLE
FT                   KLRRGKALDVVHGSTVATNALLERKGAKTALITNKGFEDVIEIGRQNRERLYDLYYRKP
FT                   KPLVPRELRFGLNCRINAKGEVLKPINREELKEILKALKEKGVESVAVCMLHSYANPEH
FT                   EKEVEEELKKNLSVFVSLSSEILPEFREYERCSTTVINAYVSPKMSKYLYYLKDRLREG
FT                   DLFRVMQSNGGLISPETASKEAVRTILSGPAGGVIGALHLGKLAGFEKLITFDMGGTST
FT                   DVSLIYGTPNITTESKIDGLPVKVPMIDINTVGAGGGSIAYVDEGGALRVGPQSAGAQP
FT                   GPICYGRGGKEITVTDANLFLGRLVPEHFLGGEMKLYPELLEEPFKEMAKKIGLAPTEL
FT                   AEGIIKVANSSMERAIRKVSVERGYNPEEFALFSFGGAGGLHAVLLAKSLNIPKVIIPR
FT                   NPGLLSAVGMLFADIVKDKVTTVMLKEEEAKPETLEKLFLLMEEKVLSEMEGEGFPPEK
FT                   VFVERFLDVRYKGQSYEITIPFGENFKETFEKEHERLYGYAHRGRKIEIVNLRIKATGI
FT                   KEKPPLKEFKERGDKYPKDAILGEREVVFEGRLETFKVLDREKLVYGNVIDFPAIVVEY
FT                   SSTTLIPPYATAEVDRYGNLIITLL"
FT   gene            complement(486617..487135)
FT                   /gene="nucI"
FT                   /locus_tag="aq_710"
FT   CDS_pept        complement(486617..487135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucI"
FT                   /locus_tag="aq_710"
FT                   /product="thermococcal nuclease homolog"
FT                   /db_xref="EnsemblGenomes-Gn:aq_710"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06884"
FT                   /db_xref="GOA:O66926"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:O66926"
FT                   /protein_id="AAC06884.1"
FT                   /translation="MKKFLIPFLTFLGFTFSSELIPCKVVRVVDGDTFRCVPEGKSRFI
FT                   KVRLMGIDTLETNNMKKGMGQAKWFYGGIRTVKEFGKKAKEFSKRLIDKKVVYLELPVR
FT                   KMDNNGRYLAYVWLDEYRNKMLNLLLVKEGLAFVFIIPPQVKYLKELGEAQEEAYKDRR
FT                   GFWKYFKGE"
FT   gene            complement(487132..487647)
FT                   /locus_tag="aq_711"
FT   CDS_pept        complement(487132..487647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_711"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_711"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06889"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66927"
FT                   /protein_id="AAC06889.1"
FT                   /translation="MRDFYLFLGAVFLLVLGVWAYNAYKEHKINSFKEISYKVYLFEKG
FT                   KLKKEEILKITKGTPFYPYVLAKFGNFQEIYEDIEEENMKKFYKERLSADFYLNKKYGK
FT                   ALENLKEIKKEDFNYPSAKSLEAFSYEKLGKINKALSLWSAIKEEYPNTYFGNLSQVKI
FT                   FLLKEKER"
FT   gene            complement(487644..488198)
FT                   /gene="frr"
FT                   /locus_tag="aq_712"
FT   CDS_pept        complement(487644..488198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="aq_712"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:aq_712"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06886"
FT                   /db_xref="GOA:O66928"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="PDB:1GE9"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66928"
FT                   /protein_id="AAC06886.1"
FT                   /translation="MIKELEDIFKEAEKDMKKAVEYYKNEIAGLRTSRASTALVEEIKV
FT                   EYYGSKVPIKQLGTISVPEHNQIVIQVWDQNAVPAIEKAIREELNLNPTVQGNVIRVTL
FT                   PPLTEERRRELVRLLHKITEEARVRVRNVRREAKEMIEELEGISEDEKKRALERLQKLT
FT                   DKYIDEINKLMEAKEKEIMSV"
FT   gene            complement(488204..488926)
FT                   /gene="pyrH"
FT                   /locus_tag="aq_713"
FT   CDS_pept        complement(488204..488926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="aq_713"
FT                   /product="UMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_713"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06882"
FT                   /db_xref="GOA:O66929"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66929"
FT                   /protein_id="AAC06882.1"
FT                   /translation="MEEKPKYKRILLKLSGEAFAGEQGYGIDPAFLEYISHEIKNVYDL
FT                   GVQVAIVIGGGNIFRGFQGKEIGVDRATADYMGMLATVINALALQSALENHVNIPTRVL
FT                   SAIEMRQVAEPYIRRRAIRHLEKGRIVIFAGGTGNPFFSTDTAAALRAAEIGAEVLIKA
FT                   TKVGGIYDKDPEKYPDAVLIKEISYLEVINMGLKVMDHTALTLCKENEIPIIVLNVKEK
FT                   GNLRRAVLGEEVGSVVRG"
FT   gene            complement(488926..489798)
FT                   /gene="tsf"
FT                   /locus_tag="aq_715"
FT   CDS_pept        complement(488926..489798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="aq_715"
FT                   /product="elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:aq_715"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06887"
FT                   /db_xref="GOA:O66930"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66930"
FT                   /protein_id="AAC06887.1"
FT                   /translation="MRMAVSMEDVKKLREMTGAGMLDCKKALEEAGGDIEKAKEILRVK
FT                   GLAKAEKKAGRETKEGLIYVIVSEDRKKGAMIELNCETDFVARNEEFRKLAERITRHIL
FT                   EKDENKNKSGEGSEILSQELYDEPGKTVETLIKEAIAKIGENIRLSRYCRYDTEDYLHS
FT                   YVHGGGRIGVLLDFKAPELNDQVLRLVQDVAMQIAAMRPEYVRIEDIPQEVLERERRIL
FT                   REQALQEGKPEHIVDKIVEGKLKKFYQEKVLLEQPFIKEEKKQVKDVIKESGLNVEIKR
FT                   FCRFELGGL"
FT   gene            complement(489875..491269)
FT                   /locus_tag="aq_716"
FT   CDS_pept        complement(489875..491269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_716"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_716"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06890"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:O66931"
FT                   /protein_id="AAC06890.1"
FT                   /translation="MPKPLRCITIAFTDLPNEYKIVLGYLTYHSGRLFNQALYSIKTKQ
FT                   AKVNTYDLYNKLKDNSLHLKNLQSRCAQIVLDELVRAFKNWFEFLHNPEKFKGQEVKPP
FT                   KFRPKNKPHRTITYDQTGFKVVGTKIRLSLSKALRQWLKEKHGIELKYLWLDTGLELDE
FT                   RLIKNIQIVPKANAKEFELHIIYEKPQNGEKLLKQDKVMVLDPNSSNFFAIVIEGIPQP
FT                   YIIDGNGLKSLLRKYLKKIASLQSRLEGAKKKGFLTHFLEERISRLWLKVKRLLKHYAH
FT                   TISNLILELALKYGVRKIYIGDAARNKNKESKLSSVADQIWSLLPHGKVKEYLEYKAKE
FT                   YGIEVEYISEAYTSGVDSSVEGAVNKETYTPEARVKRGLFRTRLLGFLNADVNACRNLL
FT                   KKLGKFDLISGILRPIRLRVFFKLRESSSAIPLYGGIGRSRGGVNLPVVVRHSKEGVNP
FT                   PEAPHL"
FT   gene            491380..493458
FT                   /gene="glgP"
FT                   /locus_tag="aq_717"
FT   CDS_pept        491380..493458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="aq_717"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_717"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06896"
FT                   /db_xref="GOA:O66932"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66932"
FT                   /protein_id="AAC06896.1"
FT                   /translation="MEEEKVKEGLWELAYNLWWTWNPPAKELFRSIDPLLWKETKENPI
FT                   ELLRKTKLLENKLKDEDFISHFKYVYSLYKTYMNRHSKYEDTYKKPIVFLSPEYGLHHT
FT                   LLIYAGGLGFLAGDILKESSDLGFPLIGVGFMYPQGYVKQRIRVDGWQEDLDAQNQKEL
FT                   MPVKKVLDKEGKWLKCYVYVRDEKVYFGVWEVNVGKTKLYLLDTNVEENTPWNREISSR
FT                   LYVPDKDLRLRQQIVLGFGTVILLEKLGIDAGGFHINEDYPSFVFLAEIFKLLKKGLTW
FT                   DKAIEEVRKISLFTTHTPLRVAVNTYPFHMIEEQFLFVKDVYGIDVKKVLELGTNPEDP
FT                   SEGFNSTIMSLRLAKYVNAVSKRHQEVSSKMWSFLFKEKENPIDYVTNGVHFPTWICSD
FT                   LRRLYEEYLGENFVELHDHKSLWELIRDIPDEELWEYHIRNKERLIEHIKDRARERWVK
FT                   EKADPSILMAEGLFLDSDVLTVGFARRMTGYKRPDLIFTDVERLKKIVNDSERPVQIIF
FT                   AGKAHPADIEGKKIIQRIFNFAKDPEFGGRIAFVEDYDELLAHYMVRGVDVWLNNPLPP
FT                   LEACGTSGMKASMNGVLHLSILDGWWIEGYNGKNGWAFGDYEVEGDRNRADAEAIYNIL
FT                   ENEVIPLYYERDERGVPVKWISMMKEAIKSITPNFCSRRMLKDYINKFYSKILKEEG"
FT   gene            493455..495950
FT                   /gene="mpg"
FT                   /locus_tag="aq_718"
FT   CDS_pept        493455..495950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpg"
FT                   /locus_tag="aq_718"
FT                   /product="mannose-1-phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_718"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06893"
FT                   /db_xref="GOA:O66933"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:O66933"
FT                   /protein_id="AAC06893.1"
FT                   /translation="MKGVILAGGFGTRIQPLTNSIPKPMLPVANRPIMEHVVHRLKEAG
FT                   IEEIVVLLYYQAEVIKNYFKDGSDFGVKITYVQPEADYGTAGAVKQAQNYLNETFIIVS
FT                   GDVITDFNLSELIAFHKSKSSKFTLALYSVENPLQFGVVITNKEGKVLKFLEKPGWGEV
FT                   FSDTVNTGIYVVEPEILNYIPEDKPFDFAMDLFPKLMKSGIDLWALKMRGYWRDIGNID
FT                   SYRDVHKDIFAGLVKIRIPGRIITTKEARIYVEEGTEIPENVSLKGTVILGKNVKVGEG
FT                   SELKNCVIGNNTVIGRNVKLFDSVLWWNVSIDEESEIRNGVICNDVKIGKRVKAKEGVV
FT                   IAEDCEVEDEVLFLKDVVVWPEKVIEKGSVVTKNIVCESKWEKGIFKGNKVIGRINVEL
FT                   TPDNATKLGMALGSVLPPKSTVILARDYHRASRTIKRSFLGGILSTGINVIDLHLSPLP
FT                   VMRFTLTEDKKAVCGVYFSISQEFPGSVEICVFDENGLPIDTNFQKKIERVFFREAYRF
FT                   ETFTDLGLIKEKPYFSENYVTKLLSSIDGDSIKLSSNKVVYDALHSPISPFISEVLGKL
FT                   EIENVILNALYDERKLSRISTYASSSEGNVSKVLKALSYDVGFVMEPSATKLKLVDDRG
FT                   RTISGDRLLLVVLMLLDKSAEKQLRVYLPVWAPEVLDAILNNVIVERGKFTNLRKSFIE
FT                   DFYMLADTDGSFTFTEFSYSPDALYASLKIMEMLTKLKVKVSEIYDSLPEYYFLHEVVS
FT                   CSSEKKGTVLRKISEMAEGKEASFIEGVKIYEDYGNWVLVLPDSYKDLIHVYVQSTERE
FT                   RAEELIKNYMEIVRGICKK"
FT   gene            495947..497380
FT                   /locus_tag="aq_720"
FT   CDS_pept        495947..497380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_720"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06900"
FT                   /db_xref="GOA:O66934"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:O66934"
FT                   /protein_id="AAC06900.1"
FT                   /translation="MKKLFLVFWWHMHQPLYREPYTGEYLLPWTFFHAVKDYYDMPAYL
FT                   KDFEIKLNFNLTPVLIDQIQEYAQGKAKDVFLEAIRKDPDDLEKEEVEKLIEFTKLNYE
FT                   KPIYRFERIRELMNKEKLNREELLDLQTLNLLAWCGRTLRKDLKDLLNKGRNYTQEEKE
FT                   YVLNKYFEIIKKTLSIYREIKEEGKGSVSTSPYYHPLIPILLNPNCVYETTPNVKIPDF
FT                   AVSFREDASKHVELAKEKYFEIFGEHPVYMWPPEASVSNEALELYYEKGINMLATDEVI
FT                   LKNSVERASPYLRYYFRELISVFFRDKTLSDLIGFSYHAWNAEDAVRDFIGRLKKIHES
FT                   VDFQPVVFVVLDGENCWEYYEENGIPFLEKLYSTLEKEEWIETLTLEEAMRKEDVKTEV
FT                   IESVKAGTWFDGNFLKWIGNKEKNEYWKILIEAKKKAKNDYILVAEGSDWFWWQGEEKA
FT                   PFVEVFDKLFRSFVRRAQE"
FT   gene            497377..498768
FT                   /gene="glgA"
FT                   /locus_tag="aq_721"
FT   CDS_pept        497377..498768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="aq_721"
FT                   /product="glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_721"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06894"
FT                   /db_xref="GOA:O66935"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66935"
FT                   /protein_id="AAC06894.1"
FT                   /translation="MRVLFCSSEIYPYAKTGGLADFSFCLIKYLKKYGVKVKGVMPYYK
FT                   TLKAENLRKTDKGVTLNLNGKDYTFEVYESEDCYFLRNDELFGRDYIYGPPGWGYEDND
FT                   IRFGGFSRAVSELISTGQLEADVVHANDWQTALIPLFLKEVFKTPVKTVFTIHNLAYQG
FT                   LFPKETVERVGIPPYLFHMEAVEFWGLVNFMKGGIVFSDLITTVSPTYAKEIQTQEYGY
FT                   GLEGVLKKYSYKLRGILNGIDYEVWNPEKDKYIYQNYSLRNYSKKFKNKEFLSKELGIE
FT                   AEKPLISFINRFTHQKGVELILNCAEEMSKLNANFVFLGTGEYENAFLDVSKIYKNFKV
FT                   FAEFNEGFARKLYASSDFILMPSYFEPCGLTQMIGMRYGCVPIVRKTGGLRDTVKDISE
FT                   GGYGITFEEPSKETFLCSLKRAIELYENAKKFRNSVKIVMSLDFSCDRMTKEYIECYEE
FT                   VQSHQ"
FT   gene            498743..500635
FT                   /gene="glgB"
FT                   /locus_tag="aq_722"
FT   CDS_pept        498743..500635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="aq_722"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:aq_722"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06895"
FT                   /db_xref="GOA:O66936"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66936"
FT                   /protein_id="AAC06895.1"
FT                   /translation="MKKFSLISDYDVYLFKEGTHTRLYDKLGSHVIELNGKRYTFFAVW
FT                   APHADYVSLIGDFNEWDKGSTPMVKREDGSGIWEVLLEGDLTGSKYKYFIKNGNYEVDK
FT                   SDPFAFFCEQPPGNASVVWKLNYRWNDSEYMKKRKRVNSHDSPISIYEVHVGSWRRVPE
FT                   EGNRFLSYRELAEYLPYYVKEMGFTHVEFLPVMEHPFYGSWGYQITGYFAPTSRYGTPQ
FT                   DFMYLIDKLHQEGIGVILDWVPSHFPTDAHGLAYFDGTHLYEYEDWRKRWHPDWNSFVF
FT                   DYGKPEVRSFLLSSAHFWLDKYHADGLRVDAVASMLYLDYSRKEWVPNIYGGKENLEAI
FT                   EFLRKFNESVYRNFPDVQTIAEESTAWPMVSRPTYVGGLGFGMKWNMGWMNDTLFYFSK
FT                   DPIYRKYHHEVLTFSIWYAFSENFVLPLSHDEVVHGKGSLIGKMPGDYWQKFANLRALF
FT                   GYMWAHPGKKLLFMGGEFGQFKEWDHETSLDWHLLEYPSHRGIQRLVKDLNEVYRREKA
FT                   LHETDFSPEGFEWVDFHDWEKSVISFLRKDKSGKEIILVVCNFTPVPRYDYRVGVPKGG
FT                   YWREIMNTDAKEYWGSGMGNLGGKEADKIPWHGRKFSLSLTLPPLSVIYLKHEG"
FT   gene            500632..502089
FT                   /gene="malM"
FT                   /locus_tag="aq_723"
FT   CDS_pept        500632..502089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malM"
FT                   /locus_tag="aq_723"
FT                   /product="4-alpha-glucanotransferase (amylomaltase)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_723"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06897"
FT                   /db_xref="GOA:O66937"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="PDB:1TZ7"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66937"
FT                   /protein_id="AAC06897.1"
FT                   /translation="MRLAGILLHVTSLPSPYGIGDLGKEAYRFLDFLKECGFSLWQVLP
FT                   LNPTSLEAGNSPYSSNSLFAGNYVLIDPEELLEEDLIKERDLKRFPLGEALYEVVYEYK
FT                   KELLEKAFKNFRRFELLEDFLKEHSYWLRDYALYMAIKEEEGKEWYEWDEELKRREKEA
FT                   LKRVLNKLKGRFYFHVFVQFVFFKQWEKLRRYARERGISIVGDLPMYPSYSSADVWTNP
FT                   ELFKLDGDLKPLFVAGVPPDFFSKTGQLWGNPVYNWEEHEKEGFRWWIRRVHHNLKLFD
FT                   FLRLDHFRGFEAYWEVPYGEETAVNGRWVKAPGKTLFKKLLSYFPKNPFIAEDLGFITD
FT                   EVRYLRETFKIPGSRVIEFAFYDKESEHLPHNVEENNVYYTSTHDLPPIRGWFENLGEE
FT                   SRKRLFEYLGREIKEEKVNEELIRLVLISRAKFAIIQMQDLLNLGNEARMNYPGRPFGN
FT                   WRWRIKEDYTQKKEFIKKLLGIYGREV"
FT   gene            502101..504608
FT                   /gene="ctrA1"
FT                   /locus_tag="aq_724"
FT   CDS_pept        502101..504608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctrA1"
FT                   /locus_tag="aq_724"
FT                   /product="cation transporting ATPase (E1-E2 family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_724"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06899"
FT                   /db_xref="GOA:O66938"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:O66938"
FT                   /protein_id="AAC06899.1"
FT                   /translation="MLKAHSLSPEEILRILKTDRRGLSEEEAKKRLKIYGKNEIEEEEE
FT                   SLIKVFFRQFNNPFVYILFVASGISAYIGKKEDSLIILAIIFVNSLLGFFQEFRAITSL
FT                   KALKKLTEVKTKVYRDGKLKVIPASELVPGDVVYIQEGDVVPADIRLIESVGLMVDESV
FT                   LTGESVPVEKNADVVLPEDTPVYNRSNVVFKGTHVVKGWAVGVVYATGRQTEFGKISEK
FT                   AKEKSPETPLMRALKKFSLAWMVIIFFLLSILFLIGIYQGRDIYEVLLLIVSELVSAVP
FT                   EGLPLVITFTLVIGAIALSRRKVLIRYLPATETLGSTTFICSDKTGTITEGKLKVQEFF
FT                   ALNEKFLNLISALCNSSDGESGDPVDLALLRWLEENDIDWKKLREEYRTVKVFPFDTKK
FT                   RYMAVIVEKEGKYYLLVKGAFETLSNFSEGISEELIKVHDVLAENGLRVLFFAYAEIPE
FT                   PVEDIESLKLKPAGFVGFLDPPKEGVKEAVVNARRAGIRVIMITGDNLKTAVAVAKQTE
FT                   IYREGDLAVEGKDLSKYSDAELYNLLKRVSVIARALPEDKYRVVKVLQEKGEIVAVTGD
FT                   GVNDVPALKVADIGVAMGSGTEAAKSVAKMVITDNNLKVIVEAVRWGRIIVRNIKRAIT
FT                   YLLTTSFGEITLLSSAILMKLPLPLYPTQILWINIVTDGVQDKTFPFNKEEIDVMKEKP
FT                   QKPEKVFLDKRLFLRFLTGGLFIGFINLILFKHLLSVYSYEVAVTITFTSMVVNQWAVG
FT                   IQTVRDYPFFYKPWRNFQMNPYIFIGIFIGLILQLLAIYVFPNYFHAVPLSLEHWFYVI
FT                   LTTLSVFIFIEIRKLVFTIFSER"
FT   gene            504614..505618
FT                   /gene="ldhA"
FT                   /locus_tag="aq_727"
FT   CDS_pept        504614..505618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="aq_727"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_727"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06898"
FT                   /db_xref="GOA:O66939"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3KB6"
FT                   /db_xref="UniProtKB/TrEMBL:O66939"
FT                   /protein_id="AAC06898.1"
FT                   /translation="MNVLFTSVPQEDVPFYQEALKDLSLKIYTTDVSKVPENELKKAEL
FT                   ISVFVYDKLTEELLSKMPRLKLIHTRSVGFDHIDLDYCKKKGILVTHIPAYSPESVAEH
FT                   TFAMILTLVKRLKRIEDRVKKLNFSQDSEILARELNRLTLGVIGTGRIGSRVAMYGLAF
FT                   GMKVLCYDVVKREDLKEKGCVYTSLDELLKESDVISLHVPYTKETHHMINEERISLMKD
FT                   GVYLINTARGKVVDTDALYRAYQRGKFSGLGLDVFEDEEILILKKYTEGKATDKNLKIL
FT                   ELACKDNVIITPHIAYYTDKSLERIREETVKVVKAFVKGDLEQIKGNFVVGPS"
FT   gene            505654..506826
FT                   /gene="speC"
FT                   /locus_tag="aq_728"
FT   CDS_pept        505654..506826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speC"
FT                   /locus_tag="aq_728"
FT                   /product="ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_728"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06904"
FT                   /db_xref="GOA:O66940"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:O66940"
FT                   /protein_id="AAC06904.1"
FT                   /translation="MTKVVNYGEVQYGFAKRYFEEFLSERKGRIEKLLKPEKTPVLLMD
FT                   IQGVKKKYLEVKYHFPEFNVYYAVKANDDESVIRALVEVGAGFEVASSQELEKVLRLGG
FT                   KIEKVISSNPVKPPEFIEFAYQKGVRTFAVDSITEVKKIKDIAPRSKVYVRIAVPNEGS
FT                   DWPLSRKFGVSVEEAVEILEYANDLGLVPYGITFHVGSQCNNLRNWFIAVKLSAQLWEK
FT                   ARAKGLKLQMLNMGGGIPVRYNYEALSVEDIAYYVKGLMRKYFPVQPYELQIEPGRGIV
FT                   GDQGIMVTKVIGKAKRGSENWLYIDTGVFNGLAEALGGIRYPFFLEREGELKEWTIGGV
FT                   SCDSMDVVAKNVYLPEPEVGDYLYILSAGAYTTVYASNFNGFPKPEVVPF"
FT   gene            506732..507745
FT                   /locus_tag="aq_729"
FT   CDS_pept        506732..507745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_729"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06914"
FT                   /db_xref="GOA:O66941"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:O66941"
FT                   /protein_id="AAC06914.1"
FT                   /translation="MITFTYFPLELTPPFTLQTSTAFLNLRLFLFRNKFNLMNKYPSYL
FT                   NLYESGELEKRVEKALNMLEKCKVCPHTCGVNRLEDDKKGYCKVGRYAVVADYFPHFGE
FT                   EFPIRGYRGSGTIFFSYCNMRCVYCQNYDVSHLGAGRIMKPEDLAEVMLELQDYGCHNI
FT                   NLVSPSHVVPQILEALLIAVERGLRIPIVYNTSSFDSLETLKLLDGIVDIYLADLKYLN
FT                   KEYGRKYSKVKDYPSVAKEAIREMYRQVGNLEVDERGIAVRGLLVRHLVLPNDISTTKE
FT                   VMEFLRSIDPKLAVNVMKQYHPYYKAWDYPELSRRITEEEYKKALEEAQGFTLIVD"
FT   gene            507757..508590
FT                   /gene="ccdA"
FT                   /locus_tag="aq_731"
FT   CDS_pept        507757..508590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="aq_731"
FT                   /product="cytochrome c-type biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_731"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06911"
FT                   /db_xref="GOA:O66942"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:O66942"
FT                   /protein_id="AAC06911.1"
FT                   /translation="MDVTVISAFLGGLLSFLSPCILPIIPAYLSYISGVGVSDVETQKG
FT                   KVNWKVFFSALYFVLGFTLVFTGLGASATFVGQLLHDYQEWIIRVGSGLVIFFGLHFAG
FT                   VFLWKHFLKVYIPIGILIPVLYFLKLLSWNEFFNLMFAYAVVLILYLVKAHEFLYRQLK
FT                   IEAKAEISYLGAFLMGVVFAFGWSPCIGPVLGSILFLASQQETVAKGALLLFVYSIGLG
FT                   IPFLLAGLLFSLFLNFVRSFSRYFKYVEIAGGVLLVSLGLLLALDKLSLIANITF"
FT   gene            508590..509213
FT                   /gene="hisH"
FT                   /locus_tag="aq_732"
FT   CDS_pept        508590..509213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="aq_732"
FT                   /product="amidotransferase HisH"
FT                   /db_xref="EnsemblGenomes-Gn:aq_732"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06901"
FT                   /db_xref="GOA:O66943"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66943"
FT                   /protein_id="AAC06901.1"
FT                   /translation="MRTVVIDYGMGNLRSVSKALEAVGFPEVVVSNDYRVASEADVLVL
FT                   PGVGAFGDAMKNLEELNLVSVIRRHIEKGKPFLGICLGLQLLFEKSYEHGEHRGLGILK
FT                   GEVILLPLGVKIPHIGWNQLWFKKESEILEGLKEGDFVYFVHSYRVVPEDESVVLTKTD
FT                   YGEYFVSSIELDNVVAFQFHPEKSQKKGLKLLENFKRKAEKLTT"
FT   gene            complement(509203..509685)
FT                   /gene="rpsG2"
FT                   /locus_tag="aq_734"
FT   CDS_pept        complement(509203..509685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG2"
FT                   /locus_tag="aq_734"
FT                   /product="ribosomal protein S07"
FT                   /db_xref="EnsemblGenomes-Gn:aq_734"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06909"
FT                   /db_xref="GOA:O66944"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66944"
FT                   /protein_id="AAC06909.1"
FT                   /translation="MPRKGPVPPREIPPDPKYGDVLVQKLINKVMKDGKKSVAEWIVYT
FT                   ALEEAAKEVNMHPVELLHKVIEKLKPEWEVRPRRVGGATYQVPIEVPERRQISLAIKWL
FT                   VQAARERPRGRGQYTMIERLKAELLDALNERGGAYKKKEETHRMAHANMVFSHFRW"
FT   gene            complement(509689..510075)
FT                   /gene="rpsL2"
FT                   /locus_tag="aq_735"
FT   CDS_pept        complement(509689..510075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL2"
FT                   /locus_tag="aq_735"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:aq_735"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06910"
FT                   /db_xref="GOA:O70089"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70089"
FT                   /protein_id="AAC06910.1"
FT                   /translation="MPTFNQLVKYGREKRKKKSKAPALQGCPQKRGVCVRVYTVTPKKP
FT                   NSALRKVARVRLSNGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDA
FT                   AGVEGRRQSRSKYGTKRPKEEKGG"
FT   gene            510161..511558
FT                   /gene="lpdA"
FT                   /locus_tag="aq_736"
FT   CDS_pept        510161..511558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="aq_736"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_736"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06905"
FT                   /db_xref="GOA:O66945"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66945"
FT                   /protein_id="AAC06905.1"
FT                   /translation="MEFDLIIVGAGSGGYEAGLYAFRRGMKVAFVELSPETVGGNCLNR
FT                   GCIPSKYMRHGAYLLDKFQKMEQYGIISKGYDIEYKKLKEGRDNVVVTIRENFKKFAQQ
FT                   LRIPIYYGKGVLKDPNTVFVEGPEETLKAKYILVATGSSPTSVGNLVPDGKYVIDTDQI
FT                   WEIDYVPKKVLIVGGGAVGVEFAYIFRKYGSEVVLVEIKDRLLPTPDIPEDSGRYLARK
FT                   LRELGVDIRTRTSVESWEKTQNGVKAKLTDGSEVVADFILLGVGRKPNTKGIGLEELGI
FT                   EMDERGFVKTNEYAQTNIPNIYACGDITSPLMLAHKSMYEGKIAVSHILGERDWKKNER
FT                   IIPKIIYSALEVASVGLTEEQAEDEDIEVRVGVASFVSNPKAMDDGENEGFVRIVADDE
FT                   TGEILGCHIVGPHAGELIHQVVHMIKDGKTVEFASKTMYSHPSLSENIGIASSEVYYGP
FT                   ISWVKRR"
FT   gene            511622..512716
FT                   /locus_tag="aq_737"
FT   CDS_pept        511622..512716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_737"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06915"
FT                   /db_xref="GOA:O66946"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66946"
FT                   /protein_id="AAC06915.1"
FT                   /translation="MAVQDVIEALKKETLEDVGINQNLAQLVKDIKMVGNVLTIVFEPP
FT                   KQGLEDIIRAKVIDALGNLPEVQKIDVKFVKPQAQIPVKQQAPQQQQTPPPQTQQPMFT
FT                   RKKVPGVKHIIAVGSGKGGVGKSTVAANLAVALSQLGYKVGLLDADVYGPSVPTLFGLK
FT                   GERVTVDQFQRIIPVEKYGLKILSIGFMLPSEDTPIIWRGPMLMKALTEFLFSTKWGNL
FT                   DFLVMDLPPGTGDVQITLAQNVELTGAVVVTTPQDVALADVKKAVSMFREVNIPVLGVI
FT                   ENMAYFICPSDKQKYYIFGKGKVAEFANAYGLKILGSIPIDPEVAEKSDKGEPIVISHP
FT                   DSEVAKAFLSIAKVLSQVVESKVN"
FT   gene            512737..513957
FT                   /gene="nifS2"
FT                   /locus_tag="aq_739"
FT   CDS_pept        512737..513957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS2"
FT                   /locus_tag="aq_739"
FT                   /product="FeS cluster formation protein NifS"
FT                   /db_xref="EnsemblGenomes-Gn:aq_739"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06912"
FT                   /db_xref="GOA:O66947"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:O66947"
FT                   /protein_id="AAC06912.1"
FT                   /translation="MFRTKAGKKVVYVDHIATTPVAEEVLEAMLPYFREKFGNPTSLHS
FT                   FGQEAKKAVEKAREQVAQLINANIPEEIIFTSGGIEANNLAIKGIAKAYQRRGKHIVTT
FT                   EIEHHSILHPCKTLEREGWEVTYLKPDKYGLIDPEQVREAVREDTVLVSIGHSNREIGT
FT                   IQNIKELVKAAKEKNPKVIFHTDAAPSLGHYPVDVQDWGVDAASFTAHLMYGPKGVGAL
FT                   WTRKGVKVKPLIEGGTQERGVRAGTENVPGIVGFGAAAELAMKELDDRMKRLSHYRDKL
FT                   RKGLEEKVDYIEFTGHPTQRLPHHLSIIVHFVEGEAMLLRLDLMGIETASGSACVSLAL
FT                   KQSHVLTAIGIPKEVSNGSVVFSFGRENTEEDVDYILEEFPKVINWLREVSPFNPENWE
FT                   KYVKSRG"
FT   gene            513969..515030
FT                   /locus_tag="aq_740"
FT   CDS_pept        513969..515030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_740"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06916"
FT                   /db_xref="GOA:O66948"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66948"
FT                   /protein_id="AAC06916.1"
FT                   /translation="MNKLSLFVYLFFFLSFLFLFLYLLQPFFNPIVWAIVFGIVLYPLY
FT                   GFIKRKLKSENLAAFLVIFIVLVAIVIPFTIFAVITAQQIIVFSIKVVNFVQTHSVNDL
FT                   INSLKEIPFLKEKRESLEPLLNYLQSEEFRRALINALNSILTFVGDRLRSYVYTAGTSL
FT                   FHVFVFLLTLFFILRDGEKVLKEIINSIPMKREDLEEILKTIYRTVLAVIYGTVGTAVA
FT                   QSIMGFIGYSLAGVEFALIWALITFFAAFVPPFGAAFVWVPMDIYLFTTKGIKEGLILL
FT                   FFGTFLISTMDNIVRPLVMKQGIKLPYVALFFSTIGGLIKFGFIGVFLGPIILSTMLAS
FT                   VKIYRRRVIHSGI"
FT   gene            complement(515011..516285)
FT                   /gene="purD"
FT                   /locus_tag="aq_742"
FT   CDS_pept        complement(515011..516285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="aq_742"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_742"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06907"
FT                   /db_xref="GOA:O66949"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="PDB:2YW2"
FT                   /db_xref="PDB:2YYA"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66949"
FT                   /protein_id="AAC06907.1"
FT                   /translation="MKVLVVGNGGREHAIAWKVAQSPLVKELYVAKGNAGIWEIAKRVD
FT                   ISPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKA
FT                   FAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAPIVVKADGLAAGKGAVVCETVEKAI
FT                   ETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKG
FT                   PNTGGMGAYSPTPVINEEVEKRIREEIVERVIKGLKEEGIYYRGFLYAGLMITKEGPKV
FT                   LEFNVRLGDPEAQPILMRVKNDFLETLLNFYEGKDVHIKEDERYALDVVLASRGYPEKP
FT                   ETGKIIHGLDYLKSMEDVVVFHAGTKKEGNFTVTSGGRVLNVCAYGKTLKEAKERAYEA
FT                   IRYVCFEGMHYRKDIGDKAFKYLSE"
FT   gene            516321..517421
FT                   /gene="pilT"
FT                   /locus_tag="aq_745"
FT   CDS_pept        516321..517421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="aq_745"
FT                   /product="twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:aq_745"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06903"
FT                   /db_xref="GOA:O66950"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2EWV"
FT                   /db_xref="PDB:2EWW"
FT                   /db_xref="PDB:2EYU"
FT                   /db_xref="PDB:2GSZ"
FT                   /db_xref="UniProtKB/TrEMBL:O66950"
FT                   /protein_id="AAC06903.1"
FT                   /translation="MFEKQEVEQKKELKILEIIKEAIELGASDIHLTAGAPPAVRIDGY
FT                   IKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGS
FT                   VAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQT
FT                   KSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLE
FT                   TVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRL
FT                   LPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQSGQAETGMQTMNQTLYKLYKQ
FT                   GLITLEDAMEASPDPKELERMIRGGR"
FT   gene            517421..518647
FT                   /gene="pilC1"
FT                   /locus_tag="aq_747"
FT   CDS_pept        517421..518647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC1"
FT                   /locus_tag="aq_747"
FT                   /product="fimbrial assembly protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:aq_747"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06902"
FT                   /db_xref="GOA:O66951"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:O66951"
FT                   /protein_id="AAC06902.1"
FT                   /translation="MPLFKYKAVTPEGRVVEGQGEFPSVLELYERLSAQGLTLISYKTI
FT                   KEEVKKGFEINIPLPFGSVSERDWSLLCRQLSVLVGAGVSIVEAIELVAEQMQNKKLRK
FT                   ALMETAKDIEEGSSIHDALAKRKNIFPEFLINLVEVGEETGELDLVLRRAAEYYEKIAF
FT                   IKGKIKSASFYPTFVMIFATAIVWFILTFVVPKFAEIYKSLGGTLPAPTQLLIDISLTL
FT                   QRNIPYILGTLLISVAVFLYFYRTNLKFRALIHRILLRLPVFGGIFKKGAFARFARTMA
FT                   TLFASGVPLERVLEISGRVVGFIPIEKALNEARKEVLEGKNLWMALQNTEMFPKMIIAM
FT                   VRVGEETGQMDQMLNSIANFYEEEVDRSIEGLVALIEPALIVILGVIIGAILIALYLPI
FT                   FNIGSFIIR"
FT   gene            complement(518640..519428)
FT                   /gene="ispA"
FT                   /locus_tag="aq_748"
FT   CDS_pept        complement(518640..519428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="aq_748"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_748"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06913"
FT                   /db_xref="GOA:O66952"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66952"
FT                   /protein_id="AAC06913.1"
FT                   /translation="MERIETWKEKIEKRLNEILKPEGPEELIEAMKYYPLQKGKRIRPL
FT                   FTVAVASALGGNEDDAITVGSGIELIHNYSLIHDDLPCMDNDVWRRGLPTCHIKFGEAM
FT                   ALLAGDALLTYTFEVLSQRENYKTLSCEEILEINKIIAQKAGSNGMVGGQVLDIKGYED
FT                   LYEVSVKKTGALFEACFMCGAVVAKRREKLKEMESIGRKVGLLFQMVDDYLDKDGFYEK
FT                   LGECLKEEIKKLYEELKEKEIFKESQELRYLLDLIYKRIT"
FT   gene            complement(519442..520167)
FT                   /gene="truA"
FT                   /locus_tag="aq_749"
FT   CDS_pept        complement(519442..520167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="aq_749"
FT                   /product="pseudouridine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:aq_749"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06908"
FT                   /db_xref="GOA:O66953"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66953"
FT                   /protein_id="AAC06908.1"
FT                   /translation="MPNYLLRLAFVGTNFYGWQVQPNLRTVQGEIQKALSQILCEDVKV
FT                   TGCCRTDSGVHALDYIANFKTQKDFPEEKLLKALNGILPKDVGVYAVKKVSEEFNARYS
FT                   VKGKVYLYKIWNSEVRNPFLYPFSWQVKREINTEVLRNILKKFEGTHDFRALTKLEEER
FT                   NTVINLEEVSLNVEYPLIEIRLKASHFLRYMVRRIVGTAVKISLGLYSEEVLEELLQGK
FT                   GNSPYTAPPQGLHLEKVLL"
FT   gene            complement(520160..521122)
FT                   /gene="pgi"
FT                   /locus_tag="aq_750"
FT   CDS_pept        complement(520160..521122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="aq_750"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_750"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06906"
FT                   /db_xref="GOA:O66954"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="InterPro:IPR035484"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66954"
FT                   /protein_id="AAC06906.1"
FT                   /translation="MEEVYKVVEGFYNQFEWEDIAKDLTPYKGIVFCGMGGSGIIGSFA
FT                   SKWLEHRSFNKPTFVVKDYTLPPFVDRDYLVFCISYSGNTEETLSNFEEAIGRGIKPLC
FT                   ITSNGKLMERAKEEGCEIYEVPKGFQPRYSLGFMLSKVLNLLGVDKDELEDAKENLKEN
FT                   LESLKQKGKEIANRIYGYIPVVYSTPLTAHIAERWKGQINENSKSPAYFTILPEMHHNE
FT                   VMGWSNPELRNKFVYLLMFDEKDHHRVKLRVDITKKILEDFGVVPIMLKGEGNSYLARS
FT                   LYLVHLADWVSVFLAELYGYDPVPVKTIERIKEELKKHA"
FT   gene            complement(521156..523126)
FT                   /locus_tag="aq_752"
FT   CDS_pept        complement(521156..523126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_752"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_752"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06921"
FT                   /db_xref="InterPro:IPR007548"
FT                   /db_xref="UniProtKB/TrEMBL:O66955"
FT                   /protein_id="AAC06921.1"
FT                   /translation="MIIMREHALALLAVKEAKERGEPTYKVAEKTREEEVFLELEFQNL
FT                   VRLEKPLEYTLTYWGEALVNLLHEMIDKGYIPHPENWDEHFRWIGSEIISMIHSTILND
FT                   GRPGEKIEHALMERGFLEEVEVEKKGKIKTVNEYAKAVYEIYNEITPKLEISRELAEYI
FT                   RKMPPGPAEKSMLPEGKHFPLLLESMRLIAFSVPNSDVYALTGLGQAVEQTLRVMPFSL
FT                   DTLISEDILEDFVTALDEGIQKLPEAGQEVMYALGLFDDQGNLLPAGEKLLEVYKLWKK
FT                   KSYPFYRTFNLEVFEEEILKTIDKLLKKHQEQAGPLPTKEEIVREMLLRPLKEYKHLVE
FT                   YYGRKINQDFNYKKKEEIKKKFQELKTVEELFKHFYEKGGEWYKKMMDLVTEALYSLES
FT                   FDLITTELTEKGELYYVPTEHGKKVLEDLEKHGIRDITATGVKAITITKREFMAPNYEW
FT                   YKQAVDEVLVRTGAPTDSGRLYSELAYTIKRKPHLTRFELMVLHKIPKAGMFLSELFKE
FT                   FDEVMKEEVHLAVEKLQARGFLDVLPNEGLVLTKAGELIKEAVSSVPEGLGNPVNPFMY
FT                   RIVEAISKVGNLYVKEEKVRILPKQFEEVEKMTGLDHETFLNELSLLRLIGILGQNSLH
FT                   KSGLALLKAVEEIQKTPVEEV"
FT   gene            complement(523123..523422)
FT                   /locus_tag="aq_754"
FT   CDS_pept        complement(523123..523422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_754"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_754"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06922"
FT                   /db_xref="GOA:O66956"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66956"
FT                   /protein_id="AAC06922.1"
FT                   /translation="MLERLKAITNLLKGALEQRSRAEEGYIREEKVKEAIELLEALERD
FT                   IMEKELKLAKEALEKFDSNRKFYYLVGKLYVEVSKEEAQKLIEDELKMFGGEGK"
FT   gene            complement(523415..524143)
FT                   /locus_tag="aq_755"
FT   CDS_pept        complement(523415..524143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_755"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_755"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06923"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66957"
FT                   /protein_id="AAC06923.1"
FT                   /translation="MKLLAWSPVLLSSKKFPEENGKKFIPGSEIKEAIKDALVYYFLKK
FT                   DKALNTKVKNYVKRHKRTSLRKFVREIEKMVFEAEKEFIESIEVPEKVYLSSEGIKEKV
FT                   VEVYDLKRKDFKDYFKSEVFEGVAEFEVKANNYEKLRSACHSYAEALAHAELTLVRDHP
FT                   IGEIFHKNLLSEMKNWEIPLRVGFWTTAPFGGRLFWFWGDKEIRNRIRRLYRLDIRPRS
FT                   VIYVPSEKKTAGWTEVKKDA"
FT   gene            complement(524140..524829)
FT                   /locus_tag="aq_756"
FT   CDS_pept        complement(524140..524829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_756"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_756"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06928"
FT                   /db_xref="InterPro:IPR005266"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66958"
FT                   /protein_id="AAC06928.1"
FT                   /translation="MDKKELVEKIALNTLVFETLGQPEKEREFTIQDLRRWGFDLILGK
FT                   KNGVRTFFASQAGREVGDKWEEGGATYEIEEILLELPENKKLFAHIETSEGVAYIVAEL
FT                   REGKENLEILRTPAPTLLMAFFKKHRLHELANNLKSVGVITEFYKQRGRESLPLPYKKL
FT                   PLVARDFLERAKKVEKMAGFGRVALAYFGKTREKDNRFRVSWLLPTIALFDIDISEKAN
FT                   TALEEFK"
FT   gene            complement(524822..525361)
FT                   /locus_tag="aq_757"
FT   CDS_pept        complement(524822..525361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_757"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_757"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06924"
FT                   /db_xref="GOA:O66959"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66959"
FT                   /protein_id="AAC06924.1"
FT                   /translation="MKAESVSQWILVILFATLLFFAFTGIFVSTLLVVLTPEGFAFLLG
FT                   FLGALVFANKLLFGYGSFVITAEAFLTNKEIDRRELAKKTNEPVERTENLSIPALLALW
FT                   LAGLDYYRYAYYGIFTLMLIIMLLSKFDLLGALTIGNYFEGAFWGAAVITLFVFALEIT
FT                   ANYLMARINEEVSLNG"
FT   gene            complement(525358..525855)
FT                   /locus_tag="aq_758"
FT   CDS_pept        complement(525358..525855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_758"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_758"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06925"
FT                   /db_xref="GOA:O66960"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66960"
FT                   /protein_id="AAC06925.1"
FT                   /translation="MRYFVIGTMIALAGLLVGGGVGSYFTSSKLLKQFQNIPGSPIVLS
FT                   ATYNKEKHLIAYTISNPGTLPIKITEKAFVFTPGKESKEKGYVLSNIPANVTIPPLSVA
FT                   IVELKLKEGTEKLKVGDLVVATFTYTHPLSQDIYTVVHPFTYGVKEKQQTEKKEEKKEE
FT                   SK"
FT   gene            complement(525855..526304)
FT                   /locus_tag="aq_759"
FT   CDS_pept        complement(525855..526304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_759"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_759"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06929"
FT                   /db_xref="GOA:O66961"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66961"
FT                   /protein_id="AAC06929.1"
FT                   /translation="MAEEKKEVQKTPEQKMDELNRQLRGYMANIEALRAEISVINQSIT
FT                   DLRTAEATLRSLKELGKGKEVLIPVGATAQIKAKSEGVDEVIMSIGTGISAVMSYDEAV
FT                   DRIRKEIAALEALRRALEEAIADLYNKIEELLEEVRKVGQEEAKK"
FT   gene            526457..528310
FT                   /gene="gidA1"
FT                   /locus_tag="aq_761"
FT   CDS_pept        526457..528310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA1"
FT                   /locus_tag="aq_761"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:aq_761"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06917"
FT                   /db_xref="GOA:O66962"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:2ZXH"
FT                   /db_xref="PDB:2ZXI"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66962"
FT                   /protein_id="AAC06917.1"
FT                   /translation="MAWVVDEFDVVVIGGGHAGIEAALAAARMGAKTAMFVLNADTIGQ
FT                   MSCNPAIGGIAKGIVVREIDALGGEMGKAIDQTGIQFKMLNTRKGKAVQSPRAQADKKR
FT                   YREYMKKVCENQENLYIKQEEVVDIIVKNNQVVGVRTNLGVEYKTKAVVVTTGTFLNGV
FT                   IYIGDKMIPGGRLGEPRSEGLSDFYRRFDFPLIRFKTGTPARLDKRTIDFSALEVAPGD
FT                   DPPPKFSFWTEPVGSYWFPKGKEQVNCWITYTTPKTHEIIRKNLHRTALYGGLIKGIGP
FT                   RYCPSIEDKIVKFPDKERHQIFLEPEGLDTIEIYPNGLSTSLPEEVQWEMYRSIPGLEN
FT                   VVLIRPAYAIEYDVVPPTELYPTLETKKIRGLFHAGNFNGTTGYEEAAGQGIVAGINAA
FT                   LRAFGKEPIYLRRDESYIGVMIDDLTTKGVTEPYRLFTSRSEYRLYIRQDNAILRLAKL
FT                   GRELGLLSEEQYKLVKELEREIEKWKEFYKSERVSVAVGGDTRSYSVATLMTMNYTLDD
FT                   VKEKFGYEVPQHPYVKEEVEIQLKYEPYIERERKLNEKLKKLEDTKIPPDIDYDKIPGL
FT                   TKEAREKLKKFKPITVGQASRIDGITPAAITALLVYLGKLD"
FT   gene            528310..529191
FT                   /gene="genX"
FT                   /locus_tag="aq_763"
FT   CDS_pept        528310..529191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="genX"
FT                   /locus_tag="aq_763"
FT                   /product="lysyl-tRNA synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_763"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06920"
FT                   /db_xref="GOA:O66963"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66963"
FT                   /protein_id="AAC06920.1"
FT                   /translation="MDLLDAWDYFINEVRKFFKEKGYTEVSTPLLLDFPNLDSNVEPVK
FT                   VEVLERGENKVKWLHTSPEYSMKKLLSRYKRDIFQITKVFRNNEWGRLHRIEFHMLEWY
FT                   AVGCDYLYLIEELKQLLNKLFGFKEFEVITVEEAFKRHFGEGIPQEESSMKELLERKGI
FT                   DFSEDEDWETLFYRAFIEVERHLGFNRPTFLINFPERLCALAKVRNGYAERFELFIKGI
FT                   ELANGWTEETNPEEVRKRLEREAKKRNLPLDEDFIKAHEDMPECAGCSLGIDRLFSLFL
FT                   GKEELVSEFFRA"
FT   gene            complement(529169..529942)
FT                   /gene="iclR"
FT                   /locus_tag="aq_764"
FT   CDS_pept        complement(529169..529942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="aq_764"
FT                   /product="transcriptional regulator (IclR family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_764"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06919"
FT                   /db_xref="GOA:O66964"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:O66964"
FT                   /protein_id="AAC06919.1"
FT                   /translation="MEHQYKDIYIIQNVHLALEVLFLLEKKPYTFEKLQEELRISRQKL
FT                   QKILTFLLESEWISFDEENKLYRLGIKNFELGVSYLKHLDIKKASKPILEEVAKKVKEN
FT                   VYLTTRVSYEVLYIEKSEVEREVMILSRYGRVLPLYASASGKIYLSHFDEKELENYFKT
FT                   VKWVRHTPHTKTPEELLKELPKIRKEGYALNLEEYEEEVVSAAAPVYDYAGKVNYTVTI
FT                   VAPSYRMTKEDLTGWVKEILKESAQKISVKLGRIR"
FT   gene            529976..531418
FT                   /locus_tag="aq_765"
FT   CDS_pept        529976..531418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_765"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_765"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06926"
FT                   /db_xref="GOA:O66965"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:O66965"
FT                   /protein_id="AAC06926.1"
FT                   /translation="MFGLALLINTFFLVFRVLYVLFYPVDLSPEEAQYWDWSRHLDLSY
FT                   YSKPPMVAYMNFLSTHVFGNTELGVRINAILLSFLLSLITYFFAKKLFSEKVAFVASVV
FT                   PNLFTGFSINSVLFTTDSPLIFFWALSVISFYFAIEKNTLSLWILTGVFSGLAFLSKYP
FT                   AVFLLPLGILYLYLTKKELLKDLKIFSSVLVAFLIALPVLIWNAKHDFISFKHVSNLAQ
FT                   KHAHFPNFSTFFEYLGGQVLLLSVIPFFFVLYGWVRTFKERNKRLIFLTTFSLPVFLFF
FT                   AFLSLKKRVYANWAGFGYYTASILFAYYFLKSPKSLKFLTLILSAFLTLLLHFTPLFDY
FT                   LGLRNLLPPKRDPAKLLVGWEDLGKEVGRFYTGKELIFSTAYQISAELAFYVPGNPRTY
FT                   VFHVNRYTQYYLWREGLKNFKGKDAVFVSYGGVPKEVMRSFEGKEFLKEVRVVWRNQVV
FT                   RKFYIYKLKNFKGEFYENPKGY"
FT   gene            531396..532250
FT                   /locus_tag="aq_766"
FT   CDS_pept        531396..532250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_766"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_766"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06927"
FT                   /db_xref="GOA:O66966"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66966"
FT                   /protein_id="AAC06927.1"
FT                   /translation="MKIPRGIKIILRWVVTLYIYGFILYQITPFSYFETYIPEERLAPK
FT                   PYVERIFYLFGVKSNEYPSKEVLEFLKSMDVDLVYGFFPFEDYGIFKNSLKAPECHLIY
FT                   TSEISTFHRILNFLFDYVPKKITGNETRTFHYFIKPKLGKCNVIVQDVYLSPNFLDFKL
FT                   DHSRNMVYKRLWEDLQLEQNVITNGRKSVDVYAYSTKSMYYPSESTIYPFKLYAKSNEE
FT                   KTLIIVYRDGKVYRIYDERSTVLKINKPGKYSVKILTYAFSWEGYYFGLRTIAYSAPIT
FT                   LLY"
FT   gene            532257..532823
FT                   /locus_tag="aq_768"
FT   CDS_pept        532257..532823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_768"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_768"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06930"
FT                   /db_xref="GOA:O66967"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66967"
FT                   /protein_id="AAC06930.1"
FT                   /translation="MKVVRAFVGFFTSKSINEVAERIKKEVDLKIMGKWVEPQNVHMTL
FT                   QFLGDITEAQAIEVIKNLQEISKKNIPFRIKYKGLGVFPDVKRPRVLWIGVSEGANKLT
FT                   NLAKEVARLNAKKGIIPKNSKNFVPHVTICRIKSYDRKTLNELLRKYRTVEFGEDEVNK
FT                   IALISSTLTSVGPIYTVVEEFYLGG"
FT   gene            532826..533821
FT                   /gene="purM"
FT                   /locus_tag="aq_769"
FT   CDS_pept        532826..533821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="aq_769"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_769"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06918"
FT                   /db_xref="GOA:O66968"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:O66968"
FT                   /protein_id="AAC06918.1"
FT                   /translation="MVTYRSAGVDIDKANEFVKFIKEKVKKEFNLEEFGGFASGFPIKG
FT                   YKKPILFSTTDGVGTKLKVAQAVGVHNTVGIDLVAMNVNDLITTGADPFIFLDYIATGK
FT                   LDLEVMKQVMEGIIKGCREGEVILAGGETAEMPGFYPEGVYDLAGFCVGLCEEDEVITG
FT                   KEIKPGDLLLGLPSSGFHSNGYSLIRKVLEMNNVSYEDYVEELGKKVWEVLLVPTRIYV
FT                   KEIKKLKKNVKIKGIAHITGGGIPENLIRILPEGTKAVVYKKNIPQNPVFSWIQRLGNV
FT                   EEREMFRTFNMGVGMIVILDKEEFDKARELIPESFYLGEILAGRKEVEIL"
FT   gene            533978..534436
FT                   /locus_tag="aq_770"
FT   CDS_pept        533978..534436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_770"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_770"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06936"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="UniProtKB/TrEMBL:O66969"
FT                   /protein_id="AAC06936.1"
FT                   /translation="MFSMTGFGKGEAESENWKVTVMMRSLNGKGLDVSLRMPPFLMPME
FT                   LELKNEIKKHLRRGTVTVYIDLEQKVVKPPIDVEKLKANVEMLRELSNSVGLSPTDDKI
FT                   LDYAWRYSEKAEIELDEELKNVVMEALRKAIQELLESRKKEGEHLKKI"
FT   gene            534466..534825
FT                   /locus_tag="aq_771"
FT   CDS_pept        534466..534825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_771"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_771"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06937"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:O66970"
FT                   /protein_id="AAC06937.1"
FT                   /translation="MNVLDRKKEEFKERIKERVLERAKALNLPEEHPTVLNELMFLLEK
FT                   YDVNEEVQRLKAHVERFKKLLESEGEVGKKLEFLAQEMHREITTLGNKIPDFSEYTVEV
FT                   KAEIDKIKQQAANVE"
FT   gene            534837..535613
FT                   /gene="tly"
FT                   /locus_tag="aq_773"
FT   CDS_pept        534837..535613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tly"
FT                   /locus_tag="aq_773"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:aq_773"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06935"
FT                   /db_xref="GOA:O66971"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:O66971"
FT                   /protein_id="AAC06935.1"
FT                   /translation="MRLDKYLTDKGIVPSREKAQAVIMAGQVLVNGKVVDKPGYRLKGN
FT                   EKVEVKELPKYVSRGGEKLEWAIKRFSLDLKDKVVLDVGSSTGGFTDCALQHGAKKVYA
FT                   VDVGRGQMDYKLRQDPRVVLYEETDARELSEEHVPEKVDLITCDVSFISSTKVLPNVFK
FT                   FLKEDGLLLVLVKPQFELCPRKVKKGVVREKEHKREALQKVVNFLKENGFRILGVIKSK
FT                   PKGTKGNEEFFVLAGRKGEEVNLSEAIEKALEEVVD"
FT   gene            535610..536590
FT                   /locus_tag="aq_775"
FT   CDS_pept        535610..536590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_775"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06941"
FT                   /db_xref="GOA:O66972"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:O66972"
FT                   /protein_id="AAC06941.1"
FT                   /translation="MRRFLILLYVFLVSSVLGFIAFEIFTPLYVPKKTVEIKYGTPVPE
FT                   IAQILEENKVIKNKYYFLILHAFKRGKLEAGEYEFEGWLSTYDVYKILEEGKAKLYKVT
FT                   VKEGYDVFDIAKVLEENGICKEEDFLKYALSEEVARKYNLSVPSMEGFLFPDTYYLSRN
FT                   MHPLKVIDIMYKNFLEKTEEMRMELRKKHISLETWVTVASMVEKETHLDEEKPLIAAVI
FT                   YNRLKKGMKLQIDPTVIYVAKRRGIWKGELYKSLYKIDDPYNTYMYYGLPPGPISNPGL
FT                   SSLRAALYPAKVNYLYFVAKPGYKGHLFAETYLEHLRNMRRVGRR"
FT   gene            complement(536587..538119)
FT                   /gene="nadB"
FT                   /locus_tag="aq_777"
FT   CDS_pept        complement(536587..538119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="aq_777"
FT                   /product="L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_777"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06932"
FT                   /db_xref="GOA:O66973"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66973"
FT                   /protein_id="AAC06932.1"
FT                   /translation="MNYFLRFDTSLLPEEEAKVLICGSGIGGLATAISLKELGIEPLIL
FT                   TRGIGNTYYSQGGIAAAVLPDDSPYLHYCDTLRAGRYLNHELHTKLLTYEGIFRILDLE
FT                   RWGVDFDKKNGFYETTLEGGHSKPRVLKVKDYTGREIYTKLLKKTEELGIKILHGELQE
FT                   IIIEENGVQGVIYSEEGSLKFIRTPLLILATGGAASMYYYTSNPKKVRGDAIGIAFRMG
FT                   ATVKNPEFVQFHPTVLKGTNLLISEAVRGEGAILVNDRGERFVNELLPRDEVARAIYNQ
FT                   IKRGREVYLDLRPVAQKGIKIEERFPTIYSFLRERGYDPYREPVPIIPAAHYYIGGIEV
FT                   DDRGRTSIQGLYAVGECSCTGIHGANRLASNSLLEGVVFGHRTAYQVYLDLKILKPSKV
FT                   NFRSERAGSDKPNLGIEELKKLMWNYVGLERDEEGLTYVKKRILSVLSQAKHWEPTPQN
FT                   RQLYDILLVALCTVEGALMRKESRGVHYRKDYPTEREVYRRDTIITRDLFEL"
FT   gene            complement(538097..539083)
FT                   /locus_tag="aq_778"
FT   CDS_pept        complement(538097..539083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_778"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06942"
FT                   /db_xref="GOA:O66974"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66974"
FT                   /protein_id="AAC06942.1"
FT                   /translation="MKKVNVVAIGGGTGLSSLLRGLKIEVGRSIGRLSAIVTVADSGGS
FT                   TGRLRKIYNIPAPGDIRNCIVALSDAEELMQKLFQYRFKGDGLEGHAFGNLFLTALTDI
FT                   TGSFLKAIKETSKILKTKGDIIPSTYENVNLVAEFDDGKVIKGEEEITEYGKKGHKVVN
FT                   IWLEPKNPKAPEEAIERIKEADLIIIGPGSLFTSILPNFLVPQIREAVKESRALKVFVV
FT                   NVMTQPGETDNFTAWDHIDTFLKFSGIDLVDVAVVNTQMPSNGLLKKYLEQNQEPVTPD
FT                   VGRIGREGITVYAENLIGESGDFVRHDPQKLTEVILKILENELLSKV"
FT   gene            complement(539080..539592)
FT                   /locus_tag="aq_780"
FT   CDS_pept        complement(539080..539592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_780"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_780"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06938"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66975"
FT                   /protein_id="AAC06938.1"
FT                   /translation="MIRLIPFILLLIISCAPKICPKPKEILNRVFQKPPEKAKLYGYVK
FT                   TPILRIPFVFEKNGYDEKIKTPGDVVIFDTSLLCFQGVCFELPELPSNFIYGYFPGDYR
FT                   IKECNQTVTLVSRDGKEIILEGKRLKAVKYKNLEIIYGEKSKEGYYREISVKLGGQEIK
FT                   ILIEGII"
FT   gene            complement(539585..540865)
FT                   /gene="hisD"
FT                   /locus_tag="aq_782"
FT   CDS_pept        complement(539585..540865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="aq_782"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_782"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06931"
FT                   /db_xref="GOA:O66976"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66976"
FT                   /protein_id="AAC06931.1"
FT                   /translation="MRIEDLRKEDWKLNERLEYLAKRGEILEEEYEKSVKEILKRVREE
FT                   GDRAVIEFTKKFDGVELTPENMEVPFEELEKAYEEIEPEVREALEFAENRIRVFHEKQL
FT                   ENSFFKEEEGIILGQKVVPLEKVGVYVPGGKAAYPSTVLMNVVPASVAGVEEIIMVSPK
FT                   PNKYTLAAAYIAGVSRVFQVGGAQAIGALAYGTEKIPKVDKIVGPGNIYVALAKKLVFG
FT                   TVDIDMIAGPSEVLVIADERANPTWVAADMLSQAEHDELAASILLTPSEELANKVKEEV
FT                   ERLLSQLERKEIAQKSLEKFGTIFLVKDLYHACEVANYIAPEHLEVMVREPMALLPELK
FT                   HAGAIFLGDYTTEPLGDYVLGPNHTLPTGGSTRFFSPLGVYDFIKRSSVLYVSREGFKR
FT                   VANQAEAIAKAEGLTAHALAVKVRKND"
FT   gene            complement(541304..544306)
FT                   /gene="acrD4"
FT                   /locus_tag="aq_786"
FT   CDS_pept        complement(541304..544306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrD4"
FT                   /locus_tag="aq_786"
FT                   /product="cation efflux (AcrB/AcrD/AcrF family)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_786"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06934"
FT                   /db_xref="GOA:O66977"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:O66977"
FT                   /protein_id="AAC06934.1"
FT                   /translation="MQKFFIERPVTAFMLMLSFVFLGLYSLKLVPIDRLPDVEFPVVRI
FT                   SADYPGADPYVVDTNVTRIIEEAVSTVSGIESIISRSYPGFASVVVTFTLDKDIDVATQ
FT                   EVSNAIQRAMRRFPKGVEPPTVVKVDTSVAPIMVLLLYSDTADYQRLTYYADKVIKREL
FT                   EKLYGVGSVSLGGFRDNVLWVRLKVSELYGYELTPLDVLREIDKNHQDIPAGNVYGKRR
FT                   EYILRLYGKFKTPEELSNLYIKENLRLGDVARVYFGEDEERSLARFNGNRAVALLVFKQ
FT                   AKVNTVRVIDEIKSRMEFFRELLPPDIKLDYTFDASVYVKESIRAAFEEIIIGVFLTAF
FT                   TVYLFLGNLRLTLVPVFAIPVTILGTIFFLYQLGYSLNTITLLALAVAVGIVIDDAIVV
FT                   MESIHRRREEGLPPFEAGVKGTRVVMFALLASTSVLIVVFLPVVFLKGVLGTFLKNFAL
FT                   TLIIAIGLSYLVAITFTPSATVRLITQRPRENFFMKLYKRFEGSFDKALRFSLDHKFIV
FT                   LLLSFFFVGLSVYLFPKVKKEFVPHVDEGRFMVRMRMPVGTSFERVKEKAKEVERILLK
FT                   NPHIAKVGMVVGEGVGGAGVHSGLFFVYLKERSQRPHQMVVMSEVRRELSELKNVKVSV
FT                   EPPHGIGASAGRTTDLQYIVRGERIEVLKKIAKSMEEHFSNVEGFRDVDTSLELSAPYV
FT                   KISVKREKLSHLGVSVEDLGLTLSLLFGKYRVGTYELGSESYDFYIKAEEDFVKEIHNL
FT                   NRVYIRARNGELIPITELIDFSIEAGPFSLTRYNRQYSFVFYANLEGIDLATARSLVED
FT                   WLKKNLPFGYTYDTAGRVKEFKKAFSGFVLSLAMSLIGVYMILASLFESLKHPFTVLLM
FT                   VPLSALGVFGFMYLTDTSLNVSSYFGIILLVGIIVRDAVLFIERIIQLRKEGYAVREAI
FT                   LEARRERLRPILMTTITVVSALLPVALGLTAGSEQRKPLAIAVIGGIASGLPLSLFLLP
FT                   VLYELMEWKRK"
FT   gene            544376..545545
FT                   /locus_tag="aq_788"
FT   CDS_pept        544376..545545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_788"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_788"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06939"
FT                   /db_xref="GOA:O66978"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O66978"
FT                   /protein_id="AAC06939.1"
FT                   /translation="MAKVLVLGGGIGGTEAAIALRKEGFEVSLVSDKPYLYIYPISIWI
FT                   PTGEAKFEDVIIPLDKFARRWGVNLIIDRVEKIDAQNKKVHLKSGKVLEDFDYLVVALG
FT                   QTKRKEKGLENTLSICGSPEEALKIRDRLVELIAKGEGKIAFGFGGNPKDKTAVRGRPV
FT                   FEVLFNVDYHLSRLGIRDRFELTFFAPMPKPGERLGEKALKMLDQMFQKYGIKKITGKK
FT                   IKEFKENGVLFEDDTFLESDLIIYTPAGWGNPVFADSGFPLNEAGFIKIEETCQVVGYE
FT                   WAYAIGDSAAIEGPPWTAKQGHLAEVMGHITAHNIAVKEGKKSGELKSYKEHINILCLM
FT                   DMGWRGGGFAYRSDKRAMLIPIPVLGHIMKKAWGVYYKLYKLGKIPKII"
FT   gene            545563..546648
FT                   /locus_tag="aq_789"
FT   CDS_pept        545563..546648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_789"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06943"
FT                   /db_xref="GOA:O66979"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:O66979"
FT                   /protein_id="AAC06943.1"
FT                   /translation="MKTLSVERIKEKVINGERIYPEEALYLWENADFVTLGNLANFVRK
FT                   KFHPDDIVTFVVDRNVNYTNVCIAGCKFCAFYRRKSDEDAYVLDMDTILQKVKELVEWG
FT                   GTTLLMQGGINPDLPLEFYEDMISQIKKHFPQVQIHCFSAPEIVYLSKKEKLPIEEVIR
FT                   RLKKAGLMSIPGGGAEILSQEVRDKISPGKCTVEEWEEVHRTAHRLGMTTTATMMFGHV
FT                   ESIEHIIEHLERVRKIQDETGGFTAFIPWTFKKGNTELDFVEEATPTYYLKVLALSRIY
FT                   LDNFKNIQSSHVTQTMQIGLIGLHFGANDLGSVMIEENVISSTNFKVRIPKVEEMVRAI
FT                   KSAGFIPAQRDTYYNIIKVFQ"
FT   gene            546645..547136
FT                   /locus_tag="aq_791"
FT   CDS_pept        546645..547136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_791"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_791"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06940"
FT                   /db_xref="UniProtKB/TrEMBL:O66980"
FT                   /protein_id="AAC06940.1"
FT                   /translation="MKKTKFSSYEEYRNYFKRLIDLERRAQTELHLKEIKTLSGKEREK
FT                   RGRAILNLRAKFLGRGLGGVYLVRYSRPQGLPKTEISTGDIVLVSKGKPTVKEVQGTVA
FT                   EKTNYYLVVAFRDKPPPYALGKDVRIDLFSNEITFKRMEEALKNFKEHPLRDFILGKKV
FT                   "
FT   gene            547161..547661
FT                   /gene="cycB1"
FT                   /locus_tag="aq_792"
FT   CDS_pept        547161..547661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycB1"
FT                   /locus_tag="aq_792"
FT                   /product="cytochrome c552"
FT                   /db_xref="EnsemblGenomes-Gn:aq_792"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06933"
FT                   /db_xref="GOA:O66981"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:O66981"
FT                   /protein_id="AAC06933.1"
FT                   /translation="MKLRYVFLSALALGIFACEQPQKKEETKKEEPKKEAVAQKQEAKK
FT                   EEQKPQEQPKQEQKQEVKQEEQKQVAQAGGAGNPEKGKAIFQQKGCGFCHQPAVDTVGP
FT                   SLKKIAQAYAGKEDQLVKFLKGEAPAIVDPAKEAIMKPQLMQLKGLSEQELRDLAAFIM
FT                   SHK"
FT   gene            547720..547923
FT                   /gene="rpmI"
FT                   /locus_tag="aq_792a"
FT   CDS_pept        547720..547923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="aq_792a"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:aq_792a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06950"
FT                   /db_xref="GOA:O66982"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66982"
FT                   /protein_id="AAC06950.1"
FT                   /translation="MAKVKMKTNRSAAKRFKVTAKGKIKRWKSGGAHYNTKKSSKRKRH
FT                   LRKHTYVKDNMLKHVKALLKEF"
FT   gene            complement(547898..549907)
FT                   /gene="rep"
FT                   /locus_tag="aq_793"
FT   CDS_pept        complement(547898..549907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="aq_793"
FT                   /product="ATP-dependent DNA helicase REP"
FT                   /db_xref="EnsemblGenomes-Gn:aq_793"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06949"
FT                   /db_xref="GOA:O66983"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:O66983"
FT                   /protein_id="AAC06949.1"
FT                   /translation="MKLNTQQEEAVRHFGSPLLVVAGAGSGKTKTLTHKVEYLIKEKGL
FT                   KPYEILCITFTNKAAKEIKERIKNTFGLELEWSGTFHSVALKILKKDGEKIGIPKDFSI
FT                   ADEKDTTLIVKEILKKYGLKKEPEEVKEKISKVKENFEEPEAWLGVLLEEYQRVLRENK
FT                   LLDFSDLMRELYNLLLVDEVREKYRNTFKYIMVDEYQDTNNIQYEILKLLANKNICAIG
FT                   DPNQCIYEWRDARPDNILRFIEDFNPKIIKLELNYRSREPILRVANAVLEASTLEWKDL
FT                   IPKLRGVRGEGQKPYVRRFQDEEEEALWISRKIKELAGEYELKDIAVLVRVGYITDVFE
FT                   RTFFKAGIPYKVVGTIKFYERIEIKNLIALLRLIYNPSDEVAFKRLTEFFVKGFGDKSF
FT                   EVVKKNFKGNWFKALKESLKKLPKNAAISAYEFLKAVVPLYKNPEKYHEGLEAFVEKID
FT                   YYELLKEKFKKDYEERIENVKEFLSSLKDFYAKAYTLEDLLAEITLTSEEEEEENAVKI
FT                   LTIHSAKGLEFPVVFLPRLEEGILPHHRSQESERELEEERRLFYVAITRAKDLLFMSYT
FT                   KKENRKPSRFLSDIPKHLLDLSAFKKKKKVAYEENLRPNRLIKKGDKVIHRVFGKGVVL
FT                   RIEEERAKVRFENGEEKVIHTSFLEPLKTPSGVP"
FT   gene            549949..550347
FT                   /locus_tag="aq_796"
FT   CDS_pept        549949..550347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_796"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_796"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06953"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66984"
FT                   /protein_id="AAC06953.1"
FT                   /translation="MRKIISMLFIPLFIFAMAEPAGAPPEVKNIKILVLDRAGKKHELK
FT                   SPLCEGLSYLKVKHGGIEYSVSLTSLEEIEVLSVSGDVAKIKLKYKNGKEEIFDISANT
FT                   LCTGTSDFGNASFYLKDVQKILFRRGEK"
FT   gene            550344..551570
FT                   /gene="prc"
FT                   /locus_tag="aq_797"
FT   CDS_pept        550344..551570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prc"
FT                   /locus_tag="aq_797"
FT                   /product="carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:aq_797"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06952"
FT                   /db_xref="GOA:O66985"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:O66985"
FT                   /protein_id="AAC06952.1"
FT                   /translation="MKRISFIPLLILVFFAGFILGQSSENKKEEDKYFYLKLFTEALKI
FT                   VEREYVEPVPIKKLIYGAIDGMVSSLDPFSDFFTPEEYKEFLSETEGEFGGVGIEITME
FT                   NGRPVVVSPIEGTPAWKAGIRPGDIIIAVDGEDTFNMSLMEVVKKIRGKPGTKVKLTIL
FT                   RKGEGKPIEVTLVRARIKVPSVKYTNYKGIGYIKISQFTSGTSKSLEKAILELENQNVK
FT                   GFIIDLRNNPGGLLSEAVDVGDLFIPKGKLIVYTKGRKGELHRYFAEREPITQGLPVVL
FT                   LVNKGSASASEIVAGALQDYHIATLVGEKTFGKASVQNLIPLSDGSAMKLTIAYYYTPK
FT                   GRLIHKKGIKPDVEVKMDEETWKKLFETIRKMRFEGHMEKVILLPDIDVQLRKAIEILE
FT                   KKAKLKKAA"
FT   gene            551567..552574
FT                   /gene="gcp"
FT                   /locus_tag="aq_801"
FT   CDS_pept        551567..552574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="aq_801"
FT                   /product="sialoglycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:aq_801"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06951"
FT                   /db_xref="GOA:O66986"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66986"
FT                   /protein_id="AAC06951.1"
FT                   /translation="MRTLAVETSCDETALAIYDDQKGVLGNVILSQAVVHSPFGGVVPE
FT                   LSAREHTRNILPIFDRLLKESRINLEEIDFISFTLTPGLILSLVVGVAFAKALAYEYRK
FT                   PLVPVHHLEGHIYSVFLEKKVEYPFLALIISGGHTDLYLVRDFGRYDFLGGTLDDAVGE
FT                   AYDKVAKMLGLGYPGGPIIDRLAKEGKKLYPLPKPLMEEGNLNFSFSGLKTAILNLLKK
FT                   EKNVRKEDIAYSFQETVVEILLEKSLWAMKKTGIKRLVVVGGVSANSRLREVFKKASQE
FT                   YGFELYIPHPSLSTDNALMIAYAGMERFKRGVVAPLDVNPQPNIPLEEFGRIWT"
FT   gene            552612..552684
FT                   /locus_tag="aq_t10"
FT   tRNA            552612..552684
FT                   /locus_tag="aq_t10"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:552645..552647,aa:Pro,seq:ggg)"
FT   gene            552695..553549
FT                   /gene="mbhS3"
FT                   /locus_tag="aq_802"
FT   CDS_pept        552695..553549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhS3"
FT                   /locus_tag="aq_802"
FT                   /product="hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_802"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06946"
FT                   /db_xref="GOA:O66987"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:O66987"
FT                   /protein_id="AAC06946.1"
FT                   /translation="MKLLWLQRLSCCGNTHSLLSSEEANLLFEEFEVLFHPSFSTESEE
FT                   DVIERVLKGGKLDLLVVEGAVKRDDEVIKNLCGISDYVVAVGNCAVYGNIPALSEDSVF
FT                   GLQYRFKEKGGILGKDFESKKGYPVINLSGCPANPEWIVGTLLRIKWKGKLDLDELGRP
FT                   KEYYSSLTHWGCSRNEYFEWKVETEKLGSPKGCLFYHYGCRGPMTHSTCNVHLWNGVNS
FT                   KTRAGTPCFGCTEYDFPRVNLWETKLYAGIPAELPLGVSKRGYIMISGVAKMFAPERLK
FT                   DED"
FT   gene            553539..554789
FT                   /gene="mbhL3"
FT                   /locus_tag="aq_804"
FT   CDS_pept        553539..554789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhL3"
FT                   /locus_tag="aq_804"
FT                   /product="hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_804"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06945"
FT                   /db_xref="GOA:O66988"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:O66988"
FT                   /protein_id="AAC06945.1"
FT                   /translation="MKIEKLVLTRVEGEASLNLVWERGVIKDAKISFYSTRGIEKVLRE
FT                   RPFMDALVINPRICGICGHAHLIATVRAIENAIGIKEIPEKAKITRLVTQITEMVQNHV
FT                   KWFYLFVMPDFLKFKESLSQFEPFKGERWKRAVQFSSQIVKIIALFGGQWPHSSYAVPG
FT                   GITSNFSEREVLKALNLVKEGKTFFEKNVSEDLELFLNLCEEFNLLSIGKAYNRFLSGG
FT                   GLAYCFNPSYKKGKGKVCKFNVRYVQELEAADYSKANPVRYKGLPYETGPLARELISKN
FT                   PLVLKLYKNYGDSYAVRVAARLAEIKDLLEILEKLLKELMNHLEEPSCLWEDRSDESGE
FT                   GFGVVEAARGTLIHRVVIEKGKIKDYKVITPSQWNLGPRCKKYLGVAEKAIVGLDSELK
FT                   AQMVLRSFDLCSVCTTK"
FT   gene            complement(554790..555257)
FT                   /locus_tag="aq_805"
FT   CDS_pept        complement(554790..555257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_805"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_805"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06954"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66989"
FT                   /protein_id="AAC06954.1"
FT                   /translation="MGIFIEDLLHFGNLIDNEVEVPLKPEDFKRAYPDFEFTFEDGVVK
FT                   IRGKKRVFLFNRSFEFRGKEEPNKVYNEKKGDEVTDFGVYLKILSSEGLDVLTKNEHFS
FT                   REGDYLKMSALEPFKASEVYQKVPKQFRSKLSITKYKVKNGEFSIFLTVIK"
FT   gene            complement(555261..556529)
FT                   /gene="pyrC"
FT                   /locus_tag="aq_806"
FT   CDS_pept        complement(555261..556529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="aq_806"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_806"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06948"
FT                   /db_xref="GOA:O66990"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PDB:1XRF"
FT                   /db_xref="PDB:1XRT"
FT                   /db_xref="PDB:3D6N"
FT                   /db_xref="PDB:4BJH"
FT                   /db_xref="PDB:6GDD"
FT                   /db_xref="PDB:6GDE"
FT                   /db_xref="PDB:6GDF"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66990"
FT                   /protein_id="AAC06948.1"
FT                   /translation="MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEI
FT                   IDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTT
FT                   VVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVM
FT                   RKALELASQLGVPIMDHCEDDKLAYGVINEGEVSALLGLSSRAPEAEEIQIARDGILAQ
FT                   RTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLFTEREVLNSGANARVNPPL
FT                   RKKEDRLALIEGVKRGIIDCFATDHAPHQTFEKELVEFAMPGIIGLQTALPSALELYRK
FT                   GIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTP
FT                   LWGKVLKGKVIYTIKDGKMVYKD"
FT   gene            complement(556543..557457)
FT                   /locus_tag="aq_808"
FT   CDS_pept        complement(556543..557457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_808"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_808"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06955"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:O66991"
FT                   /protein_id="AAC06955.1"
FT                   /translation="MIWLVLVLSLFLFSCEKLNEIFLEEDLLQRPPSKRCSDCHAKIYE
FT                   DWEKSRHAKAWVSEHFKEESENYSKLKCLSCHAPHQVDPLKKPVLRVERRHEGVNCIAC
FT                   HFKEETKAMHGPYKVFSPPHPSREDKNYTKSEICAGCHQKTYREWKIARVKTTCQQCHM
FT                   KVVDYAWIMDKFPFFLFHSRKALHDHTFPAGKATPKDIKLILTEGALNIINVGIPHNLP
FT                   TADQGNPKLYLIIEFYYKDGKKKVLRRVLSPQAKTALAYLIPYTVKIPRYEKLEKVRVS
FT                   IYRRLAWEKKRELILSEELKKPF"
FT   gene            complement(557454..558272)
FT                   /locus_tag="aq_809"
FT   CDS_pept        complement(557454..558272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_809"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_809"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06956"
FT                   /db_xref="GOA:O66992"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023119"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:O66992"
FT                   /protein_id="AAC06956.1"
FT                   /translation="MRKFLLGLAVLSFSFGGEITLKKPPESLKKYYPPASEKFEFLNNM
FT                   HTMSTAFYAVQLNINDENWEKAKEWAQKLVKTYRETAEMVPEWKDYFDFSKADAYLNAV
FT                   SSKNVDAVIKTARELGQTCAKCHRDNEVAVKIYYHFPDFHSVKVEDPIEFMEMDLGDFM
FT                   KKLANSLKATNIYISQGEYEKAKEHGINFVERARAVKETCTKCHTKEAEVEAITGKEYD
FT                   QALKALENLFNAEKLDTQKVAQNMKKVTVTCYTCHNVHLIPAKIKEALAK"
FT   gene            complement(558269..558718)
FT                   /locus_tag="aq_811"
FT   CDS_pept        complement(558269..558718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_811"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_811"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06957"
FT                   /db_xref="GOA:O66993"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:O66993"
FT                   /protein_id="AAC06957.1"
FT                   /translation="MEVLHPPIVHFTIALTITGIIFEVLWFTFKRDIFNAGALLNLGFA
FT                   VIFAWLAFFTGHLDEEKAEKLIENTPAYNILEYHETLGLIVAIAITLLGILKIFNYLKP
FT                   SNLLRVFILVLGLITFVLVILQGNLGGRLVYDYGVGVKPVMEGLR"
FT   gene            558785..559891
FT                   /locus_tag="aq_812"
FT   CDS_pept        558785..559891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_812"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_812"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06958"
FT                   /db_xref="GOA:O66994"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66994"
FT                   /protein_id="AAC06958.1"
FT                   /translation="MEEILIWIKKLEKYLYALNAKVAGIPLYKIIIASAIMLFTLILRR
FT                   LIAFLIVKILTKLTIRTKTDVDELIVKAFVKPFSYFIVVFGFYLSLLVLEVPKVYADKF
FT                   LKTFSLLILGWAIIRFLNLFHNKIVEFFVKVGGKDFAEEVGDFILKILKAFVVVIVGAS
FT                   LLQEWGVNIGAILASVGLLGLAVSLAAKDTFENILSGLIILLDKPVKVGETVKVKDFMG
FT                   SVEDIGLRSTKIRTFDKSLVTIPNRDIVNNHVENFTRRNKRRVRFYIGVVYSTKREQLE
FT                   NILKEIRELLKEHPGVAKDEKFYVYFENYGDSSLNILIQYYANTNDYEEYLKIIEDINL
FT                   KIMEIVEKNGSSFAFPSRSVYIEKMPKS"
FT   gene            complement(559888..560256)
FT                   /gene="acpS"
FT                   /locus_tag="aq_813"
FT   CDS_pept        complement(559888..560256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="aq_813"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_813"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06947"
FT                   /db_xref="GOA:O66995"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66995"
FT                   /protein_id="AAC06947.1"
FT                   /translation="MIGVDIVKNERIKDALERFGDKFLDRIYTKRELEYCYAHCDFLPC
FT                   LAARWAGKEAVLKAFYTEFKIFLRFKEIEILGNRGRPPTVVINREGVEEILKNYEVIVS
FT                   LSHERDYSVAVAYIKKKS"
FT   gene            complement(560253..561119)
FT                   /locus_tag="aq_814"
FT   CDS_pept        complement(560253..561119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_814"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06959"
FT                   /db_xref="GOA:O66996"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:O66996"
FT                   /protein_id="AAC06959.1"
FT                   /translation="MPYYDPFSYLFSLLWFLLFVFILLSPWYKRMALIKAREDVIRKLE
FT                   EKRKSRVITMIHRQEQIGFLGIPIFRFMTIEDSERVLRAIRMTPDDMPIDLIIHTPGGL
FT                   ALAATQIANALVKHKAPVRVIVPHYAMSGGTLIALAADEIIMDENAVLGPVDPQIGNMP
FT                   AASILKVLEKKDPKDIDDQTLIMADVSEKAIKQMVDCLVDLLTKNGMDKEKAKKIAEEL
FT                   ATGKFTHDYPLTVEYLKSLGLPVNTNVPQEVYELMELYEQPMGSQPPSVQYIPVPYKSP
FT                   QQQQNAK"
FT   gene            complement(561119..562285)
FT                   /gene="dfp"
FT                   /locus_tag="aq_815"
FT   CDS_pept        complement(561119..562285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="aq_815"
FT                   /product="pantothenate metabolism flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_815"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06944"
FT                   /db_xref="GOA:O66997"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:O66997"
FT                   /protein_id="AAC06944.1"
FT                   /translation="MNILIGVCGGIASYKVCELVRELKRKGHSVKTILTPFAEKFMSPL
FT                   TFQTLSGNKAYTDKDWEEEPLAHINLARWADVFLIAPATANTIAKIANGISDNLLTTTI
FT                   LAYGKPLLVAPAMNTVMYKSPSTQENLKKLKEWGHVIIEPEFGVLACKEVGEGKLASID
FT                   RLIDWIYYVSEEKPLKGKKVLITCGATKEFIDPVRFISNYSSGEMGFSLARIFRWKGAE
FT                   VKVIAGTTTAKEPPEVEIIRVQTTEEMREKVLEHYDWADIVVMNAAVADFKPSKVSKEK
FT                   IKKRDKILLELVKNPDILEELGRKKGYKILVGFALESDNLLEYAREKLERKNLDLIVAN
FT                   PVKVMGKKEHEGYLITKDQIVELPKGSKLENARFIVEFIIGNVLRGGE"
FT   gene            562310..563584
FT                   /gene="gsa"
FT                   /locus_tag="aq_816"
FT   CDS_pept        562310..563584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsa"
FT                   /locus_tag="aq_816"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_816"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06964"
FT                   /db_xref="GOA:O66998"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66998"
FT                   /protein_id="AAC06964.1"
FT                   /translation="MKNEKLYREALQVMPGGVNSPVRAFKAVGGKPIFLVKGRGPRVWD
FT                   AEGNEYIDFLASWGAIILGHAPKKVVKAVQEEAEKGLSFGLTNPHEVTLAKLVVEMVPS
FT                   VEKVRFVNSGTEATMSAVRLARGVTGRKYIVKFEGCYHGHYDSLLVSAGSGVATFGIPG
FT                   TPGIPEEIAKLTIVLPYNDVQALEEAFKEYGSEIAGVIVEPIAGNMGVVPPKKEFLIRL
FT                   RELTKEYGSLLMFDEVITGFRLSKGGAQELFGIEPDITCLGKILGGGLPVGAYGGRREI
FT                   MERVAPEGEVYQAGTLAGNPLAMVSGSETLKDLRDKEPYKELEEKMEKLARGVKDILTE
FT                   KGIQHTINKVGSMMTVFFTDKKVVDFQTAKTSDTELFAKFFRALLNKGVLIPPSQFEAW
FT                   FLTTAHEEEVIDEALERIRDAVKEL"
FT   gene            563588..564562
FT                   /locus_tag="aq_818"
FT   CDS_pept        563588..564562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_818"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_818"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06968"
FT                   /db_xref="GOA:O66999"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:O66999"
FT                   /protein_id="AAC06968.1"
FT                   /translation="MLKNLIRSVIKGSVLLVFFLLLSFLFLAYRSFSPEALYLVGNLNK
FT                   FYLLLAFFCLFLVHTFDNARLFIISRALGIKYSFLYGYITSFVNTFGATVTPAHIGGEG
FT                   MAVYMLLRKGISAHKVATAVTFKTVTGMVFFILCFPFLILQTLKSPKNFINLFLILLVL
FT                   LLFTPLFFTGIKKFLKKKDSEGLGSKLRKFLVKYLGAVKFFYKRKKAEFLLASLSSIGL
FT                   YLSFLFIAFFLLLSFGKEVSPLEILSLQLGLLYAIFVSPTPGGSGVGEIGGYVIFAGLL
FT                   GQNEVGVFVLLWRLISQYFSAFLGGILFFICLLIDTKKYLKVY"
FT   gene            564520..565839
FT                   /gene="lnt"
FT                   /locus_tag="aq_819"
FT   CDS_pept        564520..565839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="aq_819"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_819"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06960"
FT                   /db_xref="GOA:O67000"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67000"
FT                   /protein_id="AAC06960.1"
FT                   /translation="MLTDRHKEVLKGLLAGILFYLSFSKLNLYFLVFPALFLGIRKNFL
FT                   RLFSFGFSAFFLSLLWIRIPLIDYGNINPFIAYPALVLLVLFLSLYQFGLTYLLWRVFK
FT                   FSFFAFPFLYTLVEILRSHLPYGGFPWLLLGVNLVDIPVLRYTLNAGTVFLGSFVVLLI
FT                   SLFPLFNKKEKIFSLAIITPLLIYGFIKETSYRVTHYGLKIALIQPFVPQDVKLNRELF
FT                   ELKYGEIIELVKKAVEKKPDLVVLPESAFPFYLGELEEKGKEILELSKKVPIITGFIEI
FT                   DEGFKPYNTVVLLKDGRVIEKYRKIKLVPFGEYTPFPFKFFSKYVPYLSFEDYNRGNKV
FT                   KCFQLNGFSIGTPVCFEVAYPFFVKSFGCEFIAVLTNDAWFRDSEGTFQHMKLARVRAI
FT                   ENEKFFLWVNNTGPSGIISPRGEVIKSIDYGSRGILLFSF"
FT   gene            complement(565822..566418)
FT                   /locus_tag="aq_820"
FT   CDS_pept        complement(565822..566418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_820"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_820"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06969"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67001"
FT                   /protein_id="AAC06969.1"
FT                   /translation="MQLKTEVFLVEKEILVYIQTKSIGIEDNSIKLKMTPLLKKFANIG
FT                   DKVYLKHSTFMLPTKIKAKKEDEVLLEFPSLTPEKPLGDRRNVRVLSDPENPVKVRFNE
FT                   ITKEVYDISEVGFSIKCGMEEIDEILKNKEISEVEIYLPNLEEWIKGSARLVNVREFEN
FT                   GDILCGYELFLDTPDEVKVRFYIYERVKEILKGEK"
FT   gene            complement(566408..567745)
FT                   /gene="murF"
FT                   /locus_tag="aq_821"
FT   CDS_pept        complement(566408..567745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="aq_821"
FT                   /product="UDP-MURNAC-pentapeptide sythetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_821"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06961"
FT                   /db_xref="GOA:O67002"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:O67002"
FT                   /protein_id="AAC06961.1"
FT                   /translation="MQITSQTLAKILKGSLVGSPNIPVKTFSIDSRTIKQGEVFIPLKG
FT                   QKFDAHNFIPDAFKKGAVGVISEREVDVPPGKFLIKVRSTLESLREIAKFKRENFKGKV
FT                   IGVAGSAGKTTTKELLSHLLSIKGKVYKSPGNLNSQVGLPLAVANASLETDFWVLEHGA
FT                   SKRGEIKNLIEITKPHVRLITTLGEEHLEGFGSLEGVIWGNAEMFCRISDNFYAVIPGK
FT                   FLDTLFFLPKKISFGERGELQAQNVEVSEKGVSFEVEGEKFFISVPSLGLVENILACFC
FT                   VLKVLGFTLKEFKEALKEFSPVEGRMKVFNLKNFILIDDTYNANPVSLRNAIKSVGAFK
FT                   RDKVFILGDMLELGEHSKELHEEVGRLLNTVKGIRLAIFYGDEMKYAYDSFNKSKKFYA
FT                   KTKEEMLQFIEENLKEFEGCAVLIKGSRGMKLEEVVDFLRGMSNAT"
FT   gene            complement(567770..567889)
FT                   /locus_tag="aq_r01"
FT   rRNA            complement(567770..567889)
FT                   /locus_tag="aq_r01"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(567929..570884)
FT                   /locus_tag="aq_r02"
FT   rRNA            complement(567929..570884)
FT                   /locus_tag="aq_r02"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(570932..571004)
FT                   /locus_tag="aq_t11"
FT   tRNA            complement(570932..571004)
FT                   /locus_tag="aq_t11"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:570969..570971,aa:Ala,seq:tgc)"
FT   gene            complement(571021..571094)
FT                   /locus_tag="aq_t12"
FT   tRNA            complement(571021..571094)
FT                   /locus_tag="aq_t12"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:571058..571060,aa:Ile,seq:gat)"
FT   gene            complement(571199..572785)
FT                   /locus_tag="aq_r03"
FT   rRNA            complement(571199..572785)
FT                   /locus_tag="aq_r03"
FT                   /product="16S ribosomal RNA"
FT   gene            573050..573706
FT                   /gene="exsB"
FT                   /locus_tag="aq_831"
FT   CDS_pept        573050..573706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exsB"
FT                   /locus_tag="aq_831"
FT                   /product="trans-regulatory protein ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:aq_831"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06966"
FT                   /db_xref="GOA:O67003"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67003"
FT                   /protein_id="AAC06966.1"
FT                   /translation="MKKHDGIIVLLSGGMDSATLLWLAKREFKKVYAISFDYGQRHKVE
FT                   LKYAKELAKLAEVEDHFIVQVPFYTSLKGSALIDESVEVPKGEYPENEPPVTTVPMRNL
FT                   IFLSIASAFADNLEVNYIGIGVHALDTPYPDCRPEFITAAEAAINAGSTFVAKKKERMH
FT                   VYAPFLGMSKRDIALLGKELGVPFEKTYSCYMGTEPPCGECPTCIQREEALRGIL"
FT   gene            complement(573689..574444)
FT                   /gene="surE"
FT                   /locus_tag="aq_832"
FT   CDS_pept        complement(573689..574444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="aq_832"
FT                   /product="stationary phase survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:aq_832"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06967"
FT                   /db_xref="GOA:O67004"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="PDB:2WQK"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67004"
FT                   /protein_id="AAC06967.1"
FT                   /translation="MPTFLLVNDDGYFSPGINALREALKSLGRVVVVAPDRNLSGVGHS
FT                   LTFTEPLKMRKIDTDFYTVIDGTPADCVHLGYRVILEEKKPDLVLSGINEGPNLGEDIT
FT                   YSGTVSGAMEGRILGIPSIAFSAFGRENIMFEEIAKVCVDIVKKVLNEGIPEDTYLNVN
FT                   IPNLRYEEIKGIKVTRQGKRAYKERVFKYIDPYGKPFYWIAAEEFGWHAEEGTDYWAVL
FT                   NGYVSVTPLHLDLTNYKVMKSIKYLEDSP"
FT   gene            complement(574448..575119)
FT                   /gene="flgA"
FT                   /locus_tag="aq_833"
FT   CDS_pept        complement(574448..575119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="aq_833"
FT                   /product="flagellar protein FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:aq_833"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06962"
FT                   /db_xref="GOA:O67005"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67005"
FT                   /protein_id="AAC06962.1"
FT                   /translation="MSSTPREYRRRMKCSLKRLIYAVNFLFFLFTFSLDLESLIKNELR
FT                   KEFGEEVRLKNYKVLTGIPDNFSKVELKVYKNSPRGFLHLKNTKVGTIALELEWKCRVL
FT                   VAKRDIYPGERLNFSNVEEREIYLERCPQNFKENFVNFVALKEIKKGTIVRRSYLKKEF
FT                   LVKRGEIVNAVYENGNVVIRFRTKALENGYYGEVIRVLSPFSRKVIRGKIIGEGTVKIL
FT                   R"
FT   gene            complement(575049..575837)
FT                   /gene="flgG2"
FT                   /locus_tag="aq_834"
FT   CDS_pept        complement(575049..575837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG2"
FT                   /locus_tag="aq_834"
FT                   /product="flagellar hook basal-body protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:aq_834"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06963"
FT                   /db_xref="GOA:O67006"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:O67006"
FT                   /protein_id="AAC06963.1"
FT                   /translation="MFRALWTSASGMTAQQTNLDVISHNMANVNTVGYKKMRATFQDLL
FT                   YQTVEEPGAPTSPTTRSPSGFQIGLGTYVSDTYGIFTQGNLTKTDNQLDIAIQGDGFFK
FT                   IVLPDGTIAYTRNGQFRLDSEGRIVNSDGYPLDPEITIPADAISVSIAADGTVSVLRQG
FT                   ATEVEEVGRIELAKFVNPAGLRRIGNNLYIQTTASGEPIIDNPGNQGLGTLLQGYLESS
FT                   NVNIVEEMVNLIIAQRAYEFNTKGIQAADEMLSQAANLRR"
FT   gene            575881..577305
FT                   /gene="nox"
FT                   /locus_tag="aq_835"
FT   CDS_pept        575881..577305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nox"
FT                   /locus_tag="aq_835"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_835"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06965"
FT                   /db_xref="GOA:O67007"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O67007"
FT                   /protein_id="AAC06965.1"
FT                   /translation="MKVVIVGNGPAAASAVEAFRKVDRDSEIIILSDEEFPTYAPNCME
FT                   NVIRDDISKEALFYKGGEKFYEKYRVDFRPKTEVVGIDNKRKVVITKKGEEISYDKCLL
FT                   AAGAYSFIPPIDGVDLERVTTAKNLYDAYKIRSWILSGKITKAVIIGAGPIGIEDAETL
FT                   RHMGIDVTVIEVFDRILPRMLDRQMGKLYQKPLEEEGIEFLLEHQVVAIHGKNGEVEAV
FT                   EVKKRGTDKTFFIKTDMVIISTGVRPRTYLVEGTDIEIHMDKKLNKPIGGILVNEYQQT
FT                   SDPDVYAAGDIASGVDMWGNHRWIALFPPAQQAGYVAGFNMAGLKVRNNGLVDYNAVKT
FT                   RSVTAGSGGLFEDADESFFLEYKEYLVKVFLKDGKVRGYQFVGVPKYPKLNPRNPLIRV
FT                   LNKINTWEEKVLLDKGLGLEASGALFHFFVKLNREFKEVHRRLVEEMFVRAMANPSREI
FT                   PLFTVQEGEVLKTVGK"
FT   gene            complement(577262..577960)
FT                   /locus_tag="aq_836"
FT   CDS_pept        complement(577262..577960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_836"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_836"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06970"
FT                   /db_xref="GOA:O67008"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67008"
FT                   /protein_id="AAC06970.1"
FT                   /translation="MIKLLGVFFVPIIPFSFVVDYVFENCKSCRNYFFPVLVLLGVLVG
FT                   ALGVGKAGTLLILLAVLTSIAYTYRLFRVQNYEEWLLTYYIAVASLSWLHPEKMLFFIS
FT                   AFAIPLTVIHFLILHMKNQGAKPEVEEFKGIATYLPVLGTLAFVALVSSLVIAPAYAFF
FT                   TLYGVFKGNLILTPILLIEWLVWLWVGFKMFSPVFFEEKAEAPKYEDLDFSEVFPLTFL
FT                   LFLGLLLPVL"
FT   gene            578040..579707
FT                   /gene="ilvD"
FT                   /locus_tag="aq_837"
FT   CDS_pept        578040..579707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="aq_837"
FT                   /product="dihydroxyacid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_837"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06971"
FT                   /db_xref="GOA:O67009"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67009"
FT                   /protein_id="AAC06971.1"
FT                   /translation="MKFRSDKVKKGIERAPHRALLRACGLSDEDFDKPLIGIANSYIDI
FT                   IPGHVHLREFVEPIKEEVRKLGGVPIEFNVIGVDDGIAMGHEGMHYSLPSRELIADSIE
FT                   TVVNAHQLDALICIPNCDKIVPGMLMGALRVNVPTVFISGGPMLAGEVNGQKVDLISVF
FT                   EGIGKVKRGEISEQELKVIEASACPTCGSCSGMFTANSMNCLTEVLGLALPGNGTILAI
FT                   DPRREILARNAVKALFELLEKDVKPRDIVTEEALDDAFTVDIAMGGSSNTILHLLAIAR
FT                   EAGIEYNLAKINEISKRTPTICKISPASHYHIEDLDRVGGIPTIMKELSKLGLLHTERK
FT                   TVSGKTIGEIISDAPDADGEVVRTIENPYSKDGGIAILFGNLAPEGAVVKTAGVDPKML
FT                   TFKGKAICFDSEEEAIEGILGGKVKPGHVVVIRYEGPKGGPGMREMLSPTSAIMGMGLG
FT                   DKVALITDGRFSGGTRGACVGHISPEAAAGGPIGIVKDGDEILIDIPNRRIELLISEEE
FT                   FNERMKNFKPKQKEIKSSWLRRYAKLVTSASKGAILEA"
FT   gene            complement(579704..580882)
FT                   /gene="trm1"
FT                   /locus_tag="aq_841"
FT   CDS_pept        complement(579704..580882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trm1"
FT                   /locus_tag="aq_841"
FT                   /product="N2,N2-dimethylguanosine tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_841"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06976"
FT                   /db_xref="GOA:O67010"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR022923"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="PDB:3AXS"
FT                   /db_xref="PDB:3AXT"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67010"
FT                   /protein_id="AAC06976.1"
FT                   /translation="MEIVQEGIAKIIVPEIPKTVSSDMPVFYNPRMRVNRDLAVLGLEY
FT                   LCKKLGRPVKVADPLSASGIRAIRFLLETSCVEKAYANDISSKAIEIMKENFKLNNIPE
FT                   DRYEIHGMEANFFLRKEWGFGFDYVDLDPFGTPVPFIESVALSMKRGGILSLTATDTAP
FT                   LSGTYPKTCMRRYMARPLRNEFKHEVGIRILIKKVIELAAQYDIAMIPIFAYSHLHYFK
FT                   LFFVKERGVEKVDKLIEQFGYIQYCFNCMNREVVTDLYKFKEKCPHCGSKFHIGGPLWI
FT                   GKLWDEEFTNFLYEEAQKREEIEKETKRILKLIKEESQLQTVGFYVLSKLAEKVKLPAQ
FT                   PPIRIAVKFFNGVRTHFVGDGFRTNLSFEEVMKKMEELKEKQKEFLEKKKQG"
FT   gene            580901..581302
FT                   /locus_tag="aq_843"
FT   CDS_pept        580901..581302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_843"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_843"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06981"
FT                   /db_xref="GOA:O67011"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67011"
FT                   /protein_id="AAC06981.1"
FT                   /translation="MELLKEVILESEEDTYKLAEEIAQLLKGSEVICLRGTLGAGKTTF
FT                   VKALAKALKVKNPSAVRSPTFTLVNEYETDKGKLIHIDLYRVPDFDYSEFIGEGILAVE
FT                   WEERDKPCDIILEIEILDENKRKVRIYRK"
FT   gene            complement(581303..583393)
FT                   /gene="spoT"
FT                   /locus_tag="aq_844"
FT   CDS_pept        complement(581303..583393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="aq_844"
FT                   /product="(p)ppGpp 3-pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_844"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06975"
FT                   /db_xref="GOA:O67012"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67012"
FT                   /protein_id="AAC06975.1"
FT                   /translation="MSKLGEVSLEEDLEKLLSHYPQHAEEIQRAYEFAKEKHGEQKRKT
FT                   GEPYIIHPLNVALKLAELGMDHETIIAALLHDTLEDTDTTYEEIKERFGERVAKLVEGV
FT                   TKIGKIKYKSEQAENYRKLILATAEDPRVILLKLSDRLDNVKTLWVFREEKRKKIAKET
FT                   MEIYAPLAHRLGVWSIKNELEDWAFKYLYPEEYEKVRNFVKESRKNLEEYLRKYVIPKV
FT                   RKELEKYGIEAEIKYRSKHYYSIWEKTRRKGIRLEDVHDILGVRIIVNTVPECYTVLGI
FT                   IHSLFRPVPGKFKDYISLPKPNLYQSLHTTVIADKGKLVEFQIRTWEMHERAEKGIASH
FT                   WAYKEGKNPSDAGVYSWLRELVESIQGSTNPSEVLENLKSNLFFEEVFVFTPKGDLVVL
FT                   PKGSTPVDLAYKIHTEVGNHCAGAKSNGRIVPLNYELKSGDVVEIITNPNKSPSYEWLS
FT                   FVKTSRARNKIKQFLKKQERERYLSEGKRILERIREKLGLSHEDLINKIRERVRFDTEE
FT                   ELLLALGKRKISSANLIKLIFPKKKEEKEERRGSSTVFLEDLSNIKHEVAKCCKPIPGD
FT                   EILGVITRTKGLVLHEKSCSNLKNVLRLNPEKVKEVQLQASGYFQTDIRVVASDRIGLL
FT                   SDITKVISESGSNIVSSMTNTREGKAVMDFTVEVKNKEHLEKIMKKIKSVEGVKICKRL
FT                   YH"
FT   gene            583431..584456
FT                   /gene="mreB"
FT                   /locus_tag="aq_845"
FT   CDS_pept        583431..584456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="aq_845"
FT                   /product="rod shape determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:aq_845"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06972"
FT                   /db_xref="GOA:O67013"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:O67013"
FT                   /protein_id="AAC06972.1"
FT                   /translation="MIFGRLLRGFSSNIGIDLGTANTAVFVEGKGIVLYEPSIVAIDTK
FT                   SKKILAVGKEAKEMVGKTPENIQAIRPLRHGVISDFEVTQAMLTYFIKKVLGRSILKPK
FT                   PITVIGVPTGITPVEKRAVVDAAKSAGAREVYLVAEPMAAAIGAGLPVEEPIGNMIVDI
FT                   GGGTTDIAVISLAGIVVSNSLRVAGDEMNEAIIQYIKRKLHLLIGEQTAERIKIELGSA
FT                   IMEEEERQMEIRGRDMTGLPRTETITNHMVTEALEETVNSIVNAVRTTLEKTPPELASD
FT                   IAERGIVLAGGGSLLRNLDKKIEQETGIKARYADEPLTSVAKGLGMVLENIDLIRRISM
FT                   E"
FT   gene            584453..585247
FT                   /locus_tag="aq_847"
FT   CDS_pept        584453..585247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_847"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_847"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06978"
FT                   /db_xref="GOA:O67014"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:O67014"
FT                   /protein_id="AAC06978.1"
FT                   /translation="MSLKKLNVYFFLLSSLSLLLLLLQNVNNPFTQFIRNGAFIALSPI
FT                   LKVQAELEEEVRKGIEFLKDLKEESRLITKYNKLKEEILIYKEKVNSYEKMLQKLEKDL
FT                   DFNFPTRADYVISKIIFYDTSGKDLFFIIRDGQNKGIKKGDLVVARGGVVGVVDEVYYS
FT                   TSKVISLFNENTYLLATVNNSDKVYVYHGGYPHGELLYVDVNDTVNEGDVVLFKDLTMK
FT                   VPAYKIGSVVYSGISENPFFKKVKVEPYVSPREVEFVVVFKE"
FT   gene            585510..585842
FT                   /locus_tag="aq_848"
FT   CDS_pept        585510..585842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_848"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_848"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06979"
FT                   /db_xref="GOA:O67015"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:O67015"
FT                   /protein_id="AAC06979.1"
FT                   /translation="MRNFILCTAGALYGVPKGINTCAIGSLGMYPFEDNKKEFFEKLSE
FT                   TISMSLGKEFYIETPFMGMHKHEVIKRYGKFIPLELSLTCINPVNGEPCGKCIKCKERE
FT                   EALSLL"
FT   gene            complement(586081..587379)
FT                   /locus_tag="aq_849"
FT   CDS_pept        complement(586081..587379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_849"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_849"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06982"
FT                   /db_xref="GOA:O67016"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67016"
FT                   /protein_id="AAC06982.1"
FT                   /translation="MKIGVVSLGCAKNLVDSEILLGKLKGAGVELTPNPEEADVIIVNT
FT                   CGFIEPAKLESIETILEFAESGKEVIVMGCLVERYKEELEKEIPEVKAYFGTESWNEIL
FT                   NYLGLKEKKEIKRILSTPRSYAYLKIAEGCNRLCSFCAIPKIRGRHRSRKIEEIVDEAK
FT                   FLADQGVKEICVVSQDTTYYGKDLYKEYKLVELLEGLEKVEGIKWIRLLYLYPTEVHED
FT                   LIDYVANSEKVLPYFDVPLQHVSDRVLKDMRRGYDGKFVRNLIENIRKKIENAVFRTTF
FT                   IVGFPTESEEDFKELKKFVEEGHFHWLGVFTYSPEEGTHAYPLGDPIPREVKEERREEL
FT                   MAIQRGITRKKNEEFLGKEIEVLIDGYEEEFSFVPKGRAYFQAPEVDGVVYVESSRDLK
FT                   SGDILKVKVTQVADYDLAGRDTEALDLIFSSEE"
FT   gene            complement(587390..587806)
FT                   /locus_tag="aq_850"
FT   CDS_pept        complement(587390..587806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_850"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_850"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06980"
FT                   /db_xref="GOA:O67017"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67017"
FT                   /protein_id="AAC06980.1"
FT                   /translation="MALKKLRFEDILLGLTLSLTFLYPLIITLIILYQDAKRKEKEMKI
FT                   FQKVENIFLSKRCRERILEIVPYLEFVSDSFIEKLIKVCEFTSGKKPKDKEYKNLEEES
FT                   LYLIELERGTLKVLGKWISDEEFKLLLITYEPKT"
FT   gene            complement(587797..588756)
FT                   /gene="corA"
FT                   /locus_tag="aq_851"
FT   CDS_pept        complement(587797..588756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="aq_851"
FT                   /product="Mg(2+) and Co(2+) transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_851"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06977"
FT                   /db_xref="GOA:O67018"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:O67018"
FT                   /protein_id="AAC06977.1"
FT                   /translation="MIKYECVIKLYVNTFKGFEEIDEEKLKEYKGKYVIWFDLFNPTEE
FT                   EIEFLRKQTGFSMPPKEILGDIEISSKYIEDKDYLEVTLSFVIPQKEEILVEPVVFYIK
FT                   EKFFVTVRYRDIPSIMIFKNRTNFQRKFFQFPESLFAEILGIEVDRIGDRLELLGNKIK
FT                   DIWRQMFVEQSEEMIRELAFYDELNITLRESINEKIRIITKALKSPLINAHTKKELRII
FT                   YEDLTTLLEYTSFYMEKIDSIQNSLLGLITIRQNEAVKVFTVLATIFLPATLIASIFGM
FT                   NFKHMPELHWKYGYPYSLFLMVFVTLVLLFWVRRKGWL"
FT   gene            complement(588743..589705)
FT                   /gene="pdxA"
FT                   /locus_tag="aq_852"
FT   CDS_pept        complement(588743..589705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="aq_852"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:aq_852"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06973"
FT                   /db_xref="GOA:O67019"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67019"
FT                   /protein_id="AAC06973.1"
FT                   /translation="MNKKIGITLGDPAGIGPELILKISKHFKEKFTYVIYGEEKTLLEA
FT                   SKLTGIKLNYKKIEKVEEAKERGVYLIDLNVLKVPVVEPSVSSGKAAVAYLARAVADAI
FT                   RGNIHGILTMPINKFWAKKAGFQYEGQTEFLAKASGTKDYAMMMYSEKLKVVLLTTHIP
FT                   LKDVPNYVKKEEILKKVRLIRKEFLEKFKFEPLIKVLGLNPHAGEMGELGREEIEEIIP
FT                   AVEEAKKEGIKVVGPLVPDVAFINPSEEDVFLCMYHDQGLIPFKMLAFDEGVNFTLGLP
FT                   FIRTSPDHGTAYDIAWKNKARESSSLHALRLIEDLLDKI"
FT   gene            complement(589698..590042)
FT                   /locus_tag="aq_853"
FT   CDS_pept        complement(589698..590042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_853"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_853"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06983"
FT                   /db_xref="GOA:O67020"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:O67020"
FT                   /protein_id="AAC06983.1"
FT                   /translation="MPWIVRVKRKFNAAHFLTDYHGKPEPLHGHTWTVEVFIKAEELDK
FT                   GGMGVDFVEIDNFLKDILPDYTLLNDVFDFSPSAENVAKGLYKKVKEKYPNLVKVVVWE
FT                   TETCGAEYYE"
FT   gene            complement(590053..591690)
FT                   /locus_tag="aq_854"
FT   CDS_pept        complement(590053..591690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_854"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_854"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06984"
FT                   /db_xref="GOA:O67021"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:O67021"
FT                   /protein_id="AAC06984.1"
FT                   /translation="MRKWIVAFSLFSISFSNPYFDALMCAYLSDKPKIAQNYCLSALEK
FT                   IPSPELYKDTIKVLLRNKEYEKAKELAKEFLETYPDEPQAYIYLYTIYKFLKEDKKAFE
FT                   VIKEAYKSFPFNENVVLFLANEYINKGKLREAEKVLLEYMETDPDNPLPYYLLGRIYLA
FT                   KGDIQKGMEYFLKALEKKKYYAPAVLSLGNLYLQEKKFKEAEELYKSVLEKYPNSPKIL
FT                   EKLAKLYTASGRIEEAIKIYEKLINLKPRNVNYKTEYALLLLSTGEFDKAKKILEELYY
FT                   VNPSNPNVAFAYALTLEATGELKKAKEIYENLLNRFPENIKVIERLIGIYLDLGNYEDA
FT                   KRLIEKAKVLAPDKKEILFLEADYYSKTKQYDKALEILKKLEKDYPNDSRVYFMEAIVY
FT                   DNLGDIKNAEKALRKAIELDPENPDYYNYLGYSLLLWYGKERVEEAEELIKKALEKDPE
FT                   NPAYIDSMGWVYYLKGDYERAMQYLLKALREAYDDPVVNEHVGDVLLKMGYKEEARNYY
FT                   ERALKLLEEGKQGERGQKERLLKKLENL"
FT   gene            complement(591687..592580)
FT                   /locus_tag="aq_855"
FT   CDS_pept        complement(591687..592580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_855"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06985"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:O67022"
FT                   /protein_id="AAC06985.1"
FT                   /translation="MLTMKFLVPVDFSEITNPLLRTVKRVGEKVDCEVHLLHVIPPVLY
FT                   LPYPETMGVSVIDIELLEKLEDEKKAEAKEKLKALEEFLKPVKARSHVDVGDPADVILD
FT                   YEEKLNPDMVFLGGHKKGLIEKLLIGSTTEKVVKHGKKSDFVIKGSEVEFRKKVVIAYD
FT                   FSKTAQKTAEFALKFLKNFKVSVEIVHVHESIEMPLIEKLKHKIEKEFSEEKKKILNEL
FT                   KGRFEEEGIKTEVKFLEGEDAVDVISSYVNETPEVELLIIGSKGLSGLKKLILGRTATK
FT                   LLGKVNKPILIYKVQE"
FT   gene            592596..593246
FT                   /gene="purN"
FT                   /locus_tag="aq_857"
FT   CDS_pept        592596..593246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="aq_857"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_857"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06974"
FT                   /db_xref="GOA:O67023"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="PDB:2YWR"
FT                   /db_xref="UniProtKB/TrEMBL:O67023"
FT                   /protein_id="AAC06974.1"
FT                   /translation="MLKIGVLVSGRGSNLQAIIDAIESGKVNASIELVISDNPKAYAIE
FT                   RCKKHNVECKVIQRKEFPSKKEFEERMALELKKKGVELVVLAGFMRILSHNFLKYFPNK
FT                   VINIHPSLIPAFQGLHAQKQAVEFGVKFSGCTVHIVDESVDAGPVIVQAVVPVLPEDDE
FT                   NTLADRILKWEHKILPQTVQWFAQDRIIIDGRKVIVKDATYGTLPVNPALEIF"
FT   gene            complement(593526..594194)
FT                   /gene="ahpC2"
FT                   /locus_tag="aq_858"
FT   CDS_pept        complement(593526..594194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC2"
FT                   /locus_tag="aq_858"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_858"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06986"
FT                   /db_xref="GOA:O67024"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:5OVQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67024"
FT                   /protein_id="AAC06986.1"
FT                   /translation="MEVVSLPRLGEPAPAFEAQTTFGPVKFPDDFKGQWVVLFSHPADF
FT                   TPVCTTEFVAFAKNYEEFKKRNVQLIGLSVDSNFSHIAWVMNIKEKFGIEIPFPIIADH
FT                   NMEVAKKYGMIHPAQSTTFTVRALFVIDDKGILRAMIYYPLTTGRNIREVIRLVDALQT
FT                   ADREGVATPADWVPEPQTWEFTEENTKVIVPPPTTYEDAVKRLQEGYECADWYICKKKV
FT                   "
FT   gene            complement(594616..594945)
FT                   /locus_tag="aq_862"
FT   CDS_pept        complement(594616..594945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_862"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_862"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06993"
FT                   /db_xref="GOA:O67025"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:O67025"
FT                   /protein_id="AAC06993.1"
FT                   /translation="MGKLNLYQMKKVEIIVRGEDLDFVLDLLEKAGVKGYTIIHNLSGK
FT                   GSHGFHEGHLLFNEEDVLDMVISVMPEEKVEAILEGLTPFFNKHSGVVFVSDVQVSRLE
FT                   KFKNG"
FT   gene            complement(594938..597961)
FT                   /locus_tag="aq_863"
FT   CDS_pept        complement(594938..597961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_863"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_863"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06994"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67026"
FT                   /protein_id="AAC06994.1"
FT                   /translation="MELGRKLYIRSLVNVAGEPLSYFWPMRNFVYHNPLHELEGEHFSK
FT                   AIKEGEEIFKGRAFLRRKDYIDFLNKGLIKEEKLLNSLKENVNLEGAPLTYEDLLRLIK
FT                   DEKLKVYENTYLIREADTDLVEKLKGFFSENPKEVMENLFSEFGKKYTIADFVDLFFGE
FT                   SVNRTVNELLIKLSLDFLDEGQSVVEMPRRKEGFFRAFRELAKYNLRFIIRGGRELGEL
FT                   MESFEEPEEAIDNILKSYGIPEELWERYITLELAKLKGIAGYIKWRSHNKHYYFQRVYP
FT                   SDLVEFLAVRLILEKGILEHRKKVYPFEPTYENFKRFFEEKIEEAFLTYEYATKRVPAE
FT                   LSSQVRENLKNAESFINTYLSRKAHINASNFALFLKDWLGERVKELSKEELKKVLEIYG
FT                   EFQEKEGFIWLEALEDSLIERLTEGVLRANQEKEKPKAQALFCIDVRSERYRRNLEKIG
FT                   NYETYGIAGFFGVPMAFVEIHKGHEEFLCPVLIKPRNVVLEIPKEMKEEYEVTHLLEHI
FT                   LHDLKQNVLTPYVTVEAIGFLFGFDFIGKTFMPYSYSKLKEKLLESKENVDYIINKPSR
FT                   EEVKELVNRVYETILKRVFEHEYGIKNPEKPLLEETLKVCLGETDYSERLELYGFKGEK
FT                   QREFIERLRKVYKVDRGYWNILFERLSKLGFTLDEQASLIGRALKMVGLTEFAPFVFII
FT                   GHGSKSDNNPYESALDCGACGGASGLYNAIVFCRMANNPEVRKRIKEKFGINIPENTYF
FT                   VPGLHNTTTDEVHFYDLEQFPQEVKEKLKEIKEDFDKASMLTASERYKELFDEEAEDEL
FT                   RKIYKVVENAYDWSQVRPEWGLSGNYAFVIGRRELTKHLNLEGKVFLHSYDYRVDRRGF
FT                   LLEVILSGPAIVGQWINMEYYFSTTDNEVYGSGSKVYHNVVGRFGVISGNFSDLRTGLP
FT                   TQTVYKEGKPLHIPARLIILLEAPYEFALSVINRVYAIRNLIQNEWVNFVIFDPESKKF
FT                   YRYKKGSWNELKTEVKDG"
FT   gene            complement(597975..600338)
FT                   /gene="nuoL2"
FT                   /locus_tag="aq_866"
FT   CDS_pept        complement(597975..600338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL2"
FT                   /locus_tag="aq_866"
FT                   /product="NADH dehydrogenase I chain L"
FT                   /db_xref="EnsemblGenomes-Gn:aq_866"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06988"
FT                   /db_xref="GOA:O67027"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:O67027"
FT                   /protein_id="AAC06988.1"
FT                   /translation="MQYMIILPILLQLVSAFLVYRLENRVLGARLSTSFTLTNFLISLI
FT                   LLLTGSFGHFSLFGVLELFPDRLGLLLSTYILLVSSVIHKYAENYMRDEPGYRRFYALL
FT                   DLMTATLILLVVAGNLLLLFFAWHLVGVLLFLLLNHNYREEKAVRFANLSFITQRLADV
FT                   PLLIAIVLLYLEFRTLSIPELEKAVLSFEGYSFTLWVVPLLVVMSAMIKSAQVPFHLWL
FT                   VYSMEGPTPVSALMHAGIVNAGAFLVNRTAFLFTHENPGLYLAFFVGSLTAILGSALML
FT                   IQNDVKKSLGYSTVGQMGYMVMEFGIGAFALAVYHMMAHGIFKATLFLYSGNVIHSARK
FT                   DPNIPEDEVYKVVTRGIKFEKNVPWLLYALLSILVPLLLVVLIHLIVEEHFLEYETQLI
FT                   IFFFAWATGAQAVISTFRTEREKPLLSALIAILSLLIFLLGYVVMGHTLSKFLYPNQEI
FT                   IERIYESSFANTVVLIAEMILIGLIILAGWVFIYYANKEKFLTFNTFVYTHLSRELYFT
FT                   DLYEFIKEFLLKVSDVLKKESVFAGISLFALFLLALELSTADFVKTLLLGLFIPLLPSV
FT                   YLILKLKGNPYTYSVLLLIGSLLGVVFFGEISLSPLVPLITFAFFSLRSLSSRNLSEFI
FT                   PDIFGASASVLWISSKFWLGIFVAFGILILVYLGEFLRKYYGSSEFGFITGLLEKAPKF
FT                   SALTFITALFLYGAPLFITFYAYYYAGIELNLYTYALFLIGWVILSTAILVSLGKFLFY
FT                   REREDLIYTDLDDRVFKPALGILVLLLVIGFFIA"
FT   gene            complement(600393..600596)
FT                   /gene="rpsU"
FT                   /locus_tag="aq_867a"
FT   CDS_pept        complement(600393..600596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="aq_867a"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:aq_867a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06990"
FT                   /db_xref="GOA:O67028"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67028"
FT                   /protein_id="AAC06990.1"
FT                   /translation="MVTVIVQEGEPIEKVLKRFKARVEQEQILTELKRREYYEPPSERK
FT                   KKRERNRRKKILKALKKQQQLI"
FT   gene            complement(600882..601706)
FT                   /gene="nadC"
FT                   /locus_tag="aq_869"
FT   CDS_pept        complement(600882..601706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="aq_869"
FT                   /product="quinolinate phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_869"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06987"
FT                   /db_xref="GOA:O67029"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:O67029"
FT                   /protein_id="AAC06987.1"
FT                   /translation="MNEILVKEKLKEFLLEDIGTGDITTEGIYRGEKAKAVIKTKEEGV
FT                   LAGAPFVEMVFEILGGVSVEFKKREGEVFEKGEILAILEGDAKSLLIGERLSLNILQRL
FT                   SGIATTARKFVEKLKGTNVKILDTRKTTPGFRYFEKYAVRIGGGTNHRFGLYDMVLIKD
FT                   NHKRVAGSIKEAVKRVRERISPVYKIEVEVENLEEVEEALSAGVDVIMLDNFTPEEVKR
FT                   AVEIIKGRALVEVSGNITLDNVLDYAVEGVDFISSGAIVHSSRWLDISLKFL"
FT   gene            complement(601711..601801)
FT                   /locus_tag="aq_t13"
FT   tRNA            complement(601711..601801)
FT                   /locus_tag="aq_t13"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:601765..601767,aa:Leu,seq:taa)"
FT   gene            601852..603198
FT                   /gene="thdF"
FT                   /locus_tag="aq_871"
FT   CDS_pept        601852..603198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="aq_871"
FT                   /product="thiophene and furan oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_871"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06992"
FT                   /db_xref="GOA:O67030"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67030"
FT                   /protein_id="AAC06992.1"
FT                   /translation="MREPIVAIATPYGESAIGIVRLSGKGVLDLVKKFFKTKREIKPRY
FT                   AHFGVLYDDKGEELDEGVLIYYKAPHSYTGEDMVELNLHGNPRILKRALELFVNAGARL
FT                   AEPGEFTKRAFLNGKLDLTQAEAVAELISAKTELARKVALKQLHGELSKHIRPLRETLL
FT                   ELLAYVEADIEFAEEDIPTLTKEQVIQMVDKVIEGINELLKTAKTGKFIREGVKLAIVG
FT                   RPNVGKSSLFNALLKEERAIVTDIAGTTRDFIEETLQIKGVPVRLVDTAGIRETKDLVE
FT                   RIGVERSKQKVKEADLILFVIDASQEITEEDLRIYEEIKEKDHIVVANKVDLGIRANLE
FT                   KFKGEKIVKVSALKGTGLEELSEEILKKVGANLEESVNIYISVRHETLLKKAKEVLERF
FT                   KEEFREKDISPEIAMLDLREASDYLGEILGEITTEDLLGKIFSTFCIGK"
FT   gene            603214..604524
FT                   /gene="rho"
FT                   /locus_tag="aq_873"
FT   CDS_pept        603214..604524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="aq_873"
FT                   /product="transcriptional terminator Rho"
FT                   /db_xref="EnsemblGenomes-Gn:aq_873"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06989"
FT                   /db_xref="GOA:O67031"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67031"
FT                   /protein_id="AAC06989.1"
FT                   /translation="MTQQTAQQEQQKSEVKIYSREELKQKTLAELQKIGKELGLTRTTG
FT                   LKKEELIEKILKAQLEKSRLVFVKGVLEILPEGYGFLRMPENNYMPSWNDVYVAPSQIK
FT                   KFGLRTGDTIEGFARLPRENEKYKALIRMESVNGLPPDPEILKRRPQFEKLTPLHPMER
FT                   FKLEYDPNELSTRVVSLIAPIGKGQRGLIVAPPKAGKTVLLQKIAQAIIRNHPEVYLII
FT                   LLIDERPEEVTEMRRIVKDKAEVVASTFDEPPERHMQVAEIVVEKAKRMVELKKDVVIL
FT                   MDSLTRFTRASNAVTPPTGRVLTGGIEITAFQRPKKFFGAARNIEEGGSLTIIATALVE
FT                   TGSKMDDVIYEEFKGTGNMEIHLDRRLMERRIFPAINIEKSGTRKEELLLEPWELQRIW
FT                   VLRKFLSTMDPVEAMEFLLEKLRRFKTNEEFLKAMNA"
FT   gene            604785..605873
FT                   /gene="prfA"
FT                   /locus_tag="aq_876"
FT   CDS_pept        604785..605873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="aq_876"
FT                   /product="peptide chain release factor RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:aq_876"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06991"
FT                   /db_xref="GOA:O67032"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67032"
FT                   /protein_id="AAC06991.1"
FT                   /translation="MLKEAYISRLDKLQEKYRKLQEELSKPEVIQDVEKYKKLSKELKE
FT                   LQEINELYERYKKAQKELKEAKELLKSSDKDLRELAEEEVNRLTEEMKKLEEELKVHLV
FT                   PKDPNDTKNVILEIRAGAGGEEAALFAADLFRMYQKYAEEKGWKVSILSSNKTGLGGYK
FT                   EVIALIEGEGAYSRLKYESGVHRVQRVPVTESSGRIHTSTATVAVLPEVDETDIKIKPE
FT                   ELKIETFRASGAGGQYVNTTETAVRITHIPTGIVVQCQDERSQFQNKQKALKILYAKLK
FT                   DYYERKKQEEIAKERKEQVGTGERSEKIRTYNFPQNRVTDHRINLTLYKLQDVLEGKLD
FT                   EIIDALRAKEIEKKLELVEKEG"
FT   gene            complement(606111..606899)
FT                   /gene="minD2"
FT                   /locus_tag="aq_877"
FT   CDS_pept        complement(606111..606899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD2"
FT                   /locus_tag="aq_877"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:aq_877"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06996"
FT                   /db_xref="GOA:O67033"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4V02"
FT                   /db_xref="PDB:4V03"
FT                   /db_xref="UniProtKB/TrEMBL:O67033"
FT                   /protein_id="AAC06996.1"
FT                   /translation="MAEVIVITSGKGGVGKTTLTANIGTALAKLGKKVLLIDADIGLRN
FT                   LDMILGLENRIVYDILDVLEGRVPYEKALVKDKRGLSLWLLPANQRANKDVIDIEKWNK
FT                   TVEEIKNSGNYDYILVDSPAGIEKGFQIAVSPADKALIVVNPEVSSIRDADRVIGLLES
FT                   MDKRNYKVIVNRIKWEMVKRGAMLSVEDIVDILKAEIIGIIPEEPKLVDFTNRGEPIVL
FT                   DEKFPASQAIIDTARRLMGESIPLKRYGEKKGLLSRLLGG"
FT   gene            complement(606878..607483)
FT                   /gene="minC"
FT                   /locus_tag="aq_878"
FT   CDS_pept        complement(606878..607483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="aq_878"
FT                   /product="septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:aq_878"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06995"
FT                   /db_xref="GOA:O67034"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="PDB:4V02"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67034"
FT                   /protein_id="AAC06995.1"
FT                   /translation="MIEIKGKTLPVIQIKIKEKGNIDKLLKELKEKLSHNIFKGSLIIL
FT                   ENPEVLKPEERKKVEEILKEFSRGFIEGKKEGKEKREESRLLIIERTLRAGQRIEHRGD
FT                   ILILGDVNKDAEVLAGGNIIVMGKLRGVAKAGLIGDHSAVIVALKMEPQLLQIGKKKAI
FT                   MSEADRNSPGYPEVAKIEGEDIVLEPIEGAERWLKLLL"
FT   gene            607507..608085
FT                   /locus_tag="aq_880"
FT   CDS_pept        607507..608085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_880"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07003"
FT                   /db_xref="InterPro:IPR014856"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67035"
FT                   /protein_id="AAC07003.1"
FT                   /translation="MDVFVLDTSVFTNPEIYRTFEEDQRGAMETFIHLALNSRAEFYMP
FT                   TSVYTEMRKIMDVGELWAEFEMVVKIRSPRRFQLTVPADFLYEFIEELRYRINKGLRIA
FT                   EEHTREASGCEDVGKLIARLREKYREALRQGILDSKEDVDVLLLAYELDGVLVSADEGL
FT                   RTWADKIGIKLIDPKNFKNILESLVRHRF"
FT   gene            complement(608082..609968)
FT                   /locus_tag="aq_881"
FT   CDS_pept        complement(608082..609968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_881"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07004"
FT                   /db_xref="GOA:O67036"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67036"
FT                   /protein_id="AAC07004.1"
FT                   /translation="MLEKYEILKDYKGPFDIKNYDYETLQKLAQEVRDYIINVTSKNGG
FT                   HVGPSLGVVELTIALLRVFNPPEDVIVWDIGHQGYPWKILTDRKEQFPTLRQYKGISGF
FT                   LRREESIYDAFGAGHSSTSISAALGFRIGKDLKGEKEDYVIAVIGDGALTAGMAYEALN
FT                   NAGHIRPDRFIVILNDNEMSISPNVGAISTYLNRIISGHFVQETRQKIKNFLQHFGETP
FT                   LRIMKLTEEFLKGLISPGVIFEELGFNYIGPIDGHDIKALEDTLNNVKDIKGPVLLHVY
FT                   TKKGKGYKPAEENPVKWHGVAPYKVESGEIIKKSSPPTWTSVFGKALVELAERDEKIVA
FT                   ITPAMREGSGLVEFAKRFPDRFFDVGIAEQHACTFAAGLAAEGLRPVAAYYSTFLQRAY
FT                   DQVIHDVALQNLPVTFAIDRAGLVGDDGPTHHGVFDLSYLRCVPNMVVCAPKDEQELRD
FT                   LLYTGIYSGKPFALRYPRGAAYGVPTEGFKKIEIGTWEELLEGEDCVILAVGYPVYQAL
FT                   RAAEKLYKEGIRVGVVNARFVKPMDEKMLRDLANRYDTFITVEDNTVVGGFGSGVLEFF
FT                   AREGIMKRVINLGVPDRFIEHGKQDILRNLVGIDAEGIEKAVRDALKGGRLI"
FT   gene            complement(610406..613846)
FT                   /gene="topG2"
FT                   /locus_tag="aq_886"
FT   CDS_pept        complement(610406..613846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topG2"
FT                   /locus_tag="aq_886"
FT                   /product="reverse gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_886"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07000"
FT                   /db_xref="GOA:O67037"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005736"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040569"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67037"
FT                   /protein_id="AAC07000.1"
FT                   /translation="MIKAIFDTLCPNCGGEISAERLLKGLPCEKCLPEEVNREEVCQKL
FT                   ENGSFKEFCELLSELKDWEDFFKEILGTSPWSLQKSWARKVFLGRSFAMLAPTGVGKTT
FT                   FGLSMASYLAKQGKKSYIILPTQLLVEQVSERIKTFGVDEDRLIVWGKLSEKKKKELKE
FT                   RIQKGDFDILITTSMFLYKNYEILPKDFSFIFVDDVDSFLKTAKNVDKVLYLLGFSEED
FT                   IHKAFELIRLKEKPNKSEEDWEEIKKRSEELREIAKKKKGVLAVSSATGNPRSNRIKLF
FT                   RELLGFEVGKPSVLLRNIVETYEETQNLKETLLKRVKEFGKGGLVFVSSDYGREAVEEV
FT                   KKFLESHGVKAVTYEEDLKLFEKGEAQVAIGISSFKNPLARGIDLPHVVRYAIFYGVPK
FT                   IRVPLKVETSVSHLLWALLSLRPIILKDEKLKSEVKKVDTWIQRLRRYSFLSDDFVEER
FT                   PDLKDRIENLRKEVQEFLLREDIVEKIKNSEELTLRLGEEGFELVVADVTGYLQASGRT
FT                   SRMYAGGLTKGLSHVLVDDRRAFKNLEKKVRWFNQDINFKKIEEVDLKEVLREIDEDRK
FT                   KVREILEGKVKAEQKEHVKPVLVVVESPNKARTIANFFGKPMGRKIGGIDVLEVMVGDL
FT                   YIMITASLGHVFDLVKDKEFHGVIAKNGEYVPIYEVIEGKENIVKGLRELAQEVDTVLI
FT                   GTDPDTEGEKIGWDLGALLSPYIPNVERIEFHEVTRKAIKHAVENPRDFNENLVKAQLV
FT                   RRIADRWVGFEVSRIVQQAFDKHWLSGGRVQIPVLGWIIEREKLYRKKKHVVQITFKEN
FT                   GRWLRLGFEFQDKKEAKEFYENLKEIDVEVLEEREELKNPPPPFTTDTMLKEASDRYRI
FT                   SVPKLMQLAQELFEYGLITYHRTDSTRVSDVGIGVAKEWISEELGKELFYPRVWGEGGA
FT                   HECIRPTKPLDVEDLRSMMLAGQLQNLTREHLLLYELIFKRFMASQMKPVKVKTKKVKV
FT                   KALGREQELILTTEILEEGFNKVYPLELQPDLKGSVYVEDKKELKSVPMAYLYTQGSLV
FT                   EEMKRRGIGRPSTYATIVSKLLERGYVIERHGFLIPTKLGKQVYEFLKSREKIMPFVSE
FT                   EFTRKLEELMDKVEEGKEDYLQVLDELYKKVNEFEKANV"
FT   gene            613977..614423
FT                   /locus_tag="aq_888"
FT   CDS_pept        613977..614423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_888"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_888"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07002"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:O67038"
FT                   /protein_id="AAC07002.1"
FT                   /translation="MGTMALFDEWYQKGHQIVHEVMKELGIEDEHKAFRLLRAVLQTLR
FT                   DRLPASEGKDFAAQLPMVLKAVWCDGWDPTRVPDKSIKHKQDFLERVMNHPGLRRPADI
FT                   ESLEDAERVVTAVFRVLKRHISYGEIKDVLSELPEDIREMLENA"
FT   gene            614467..615270
FT                   /locus_tag="aq_890"
FT   CDS_pept        614467..615270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_890"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07005"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67039"
FT                   /protein_id="AAC07005.1"
FT                   /translation="MRVREPAVAGTFYPKDKEELNKLMDLLCGFEPKEKIKPKAILVPH
FT                   AGYIYSGKTACEVYKRIEIPEKVVLLGPNHTGLGKPISVYSGDAWETPYGVVEIDGELR
FT                   EKILKYPYANPDEYAHLYEHSLEVQLPFLQRYARREFKILPIVVTFVEYEVAKDFGRFL
FT                   GEVLKEEDALIVISSDMSHYVPAEEARKKDEILISAMERLNTEELYFKAVQYNITMCGV
FT                   VPAVVGIESAKVLGATKGIVVDYSNSGDTTGDYSQVVAYLGMIFL"
FT   gene            complement(615250..616188)
FT                   /gene="ppx"
FT                   /locus_tag="aq_891"
FT   CDS_pept        complement(615250..616188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="aq_891"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_891"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06997"
FT                   /db_xref="GOA:O67040"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="PDB:1T6C"
FT                   /db_xref="PDB:1T6D"
FT                   /db_xref="PDB:2J4R"
FT                   /db_xref="UniProtKB/TrEMBL:O67040"
FT                   /protein_id="AAC06997.1"
FT                   /translation="MSLDNKPIMRVASIDIGSYSVRLTIAQIKDGKLSIILERGRITSL
FT                   GTKVKETGRLQEDRIEETIQVLKEYKKLIDEFKVERVKAVATEAIRRAKNAEEFLERVK
FT                   REVGLVVEVITPEQEGRYAYLAVAYSLKPEGEVCVVDQGGGSTEYVFGKGYKVREVISL
FT                   PIGIVNLTETFFKQDPPTEEEVKRFFEFLEKELSKVKKPVDTIVGLGGTITTLAALEYN
FT                   VYPYDPQKVHGKVLTYGQIKKWFDTFKEIPSEERSKRFRQVEDRRAKVILAGIGIFLKT
FT                   LEIFEKDCLIVSDWGLREGVLVSEVLKENHS"
FT   gene            616148..617128
FT                   /gene="fabD"
FT                   /locus_tag="aq_892"
FT   CDS_pept        616148..617128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="aq_892"
FT                   /product="malonyl-CoA:Acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_892"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06999"
FT                   /db_xref="GOA:O67041"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:O67041"
FT                   /protein_id="AAC06999.1"
FT                   /translation="MDATLIIGLLSKDMGKLAYVFPGQGSQYVGMGYEFYKQFHETADV
FT                   VHAVEHSLRMSLDDIVDVMFKGPEEKLNKTVYTQPALFAISLGIYKALESMGFPKPDFV
FT                   AGHSLGEYTALAVAGGIDVQLGARLTYYRGKYMQEAVPEGKGAMVAILKLPPEKVEEAC
FT                   ERAKDVGVVEPANYNSSTQTVISGEKPAVEKAAQIAKEMGGRAIPLKVSVPSHCSLMKP
FT                   AADAFRLKLAQAPIQNIKIPLVQNYTAKAHTMAHEIRNNLYHQIFSPVKWYQSVIWMHE
FT                   QGVDTFVEIGPKNVLSKLIQQTLPNVRVFNVEKPEDAESVLKAIT"
FT   gene            617125..617976
FT                   /locus_tag="aq_893"
FT   CDS_pept        617125..617976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_893"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_893"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07006"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:O67042"
FT                   /protein_id="AAC07006.1"
FT                   /translation="MRAHPECIPCLINQGLNAVKKLNLPKEKEMEIATRSLKFLSQFDT
FT                   FDRSPAYYAYFIQQIVKEISGEEDPFKDLKKLANEKAQELLSKVLKGTPDLKEALKLSA
FT                   IGNFIDFAIKGVFDLERELQKLLDKDFLIFDYDKFLERLENAKSVFIIGDNAGEIVFDK
FT                   VLVKTLKGMGKEVVYGVKGKPILNDATLEDAEEVSMTRLCKVIDNGSDKVGTWLEDCKR
FT                   EFVETFYSSDIVISKGQANFETLSSADRDLFFLLVAKCDPIGRETGGKRGELIFKYKPS
FT                   KD"
FT   gene            complement(617965..618969)
FT                   /gene="queA"
FT                   /locus_tag="aq_894"
FT   CDS_pept        complement(617965..618969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="aq_894"
FT                   /product="queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_894"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07001"
FT                   /db_xref="GOA:O67043"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67043"
FT                   /protein_id="AAC07001.1"
FT                   /translation="MRIEEFDYELPEELIAKYPAVPRHSARLMVLNRKDQSIKHDTFIN
FT                   LPDYLEEGDLLVFNNTKVIPARLYGRKPTGGRVEVVLTDFIKPDEWKALIGGKKIRPGL
FT                   VIEVAPDFKVEVLEHIEEGKFRVKLLGEEPLKLIDKYGHIPIPPYLKREEEPIDRVYYQ
FT                   TIFAKEKGAVASPTASLHFSEELLEKLKEKGINFAFITLHVSYGTFKPVKVERVEEHRV
FT                   DPEYVKIPKETVEKIKETKEKGKRVVAVGTTVVRALETKPFEPFEGWTDLYIYPGFKFK
FT                   VVDAMITNFHLPRSSLLILVSAFAGREFILKAYREAVEKRYRFYSYGDGMLIL"
FT   gene            complement(618982..619896)
FT                   /gene="ispB"
FT                   /locus_tag="aq_895"
FT   CDS_pept        complement(618982..619896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="aq_895"
FT                   /product="octoprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_895"
FT                   /db_xref="EnsemblGenomes-Tr:AAC06998"
FT                   /db_xref="GOA:O67044"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:O67044"
FT                   /protein_id="AAC06998.1"
FT                   /translation="MEILKAIEDRLVEELNPKVRLVLETGRYIVESGGKRLRPLFTLLV
FT                   SGMCGGDPSKALPLGVALEYIHVASLLHDDVVDRAKTRRGRESANLVFGNGVAVLTGDY
FT                   MYAKSLHLFSTYGNMEMIRLVSGVVMDMAEGQVLEISKVGDIISEEEYFQIIDGKTGVL
FT                   FGACFGVGAMSGECGDWRELYEAGLRLGRAFQLIDDALDYEGDPKVLGKPVGNDLREGK
FT                   CTYPLISVLDNLDREEVKRVLRGLEDSEKLRKKVVELGGVEKTKERAKEELKVVKEIIS
FT                   KYPENEYKREILKLIDFVVERKA"
FT   gene            complement(619914..619987)
FT                   /locus_tag="aq_t14"
FT   tRNA            complement(619914..619987)
FT                   /locus_tag="aq_t14"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:619951..619953,aa:Arg,seq:ccg)"
FT   gene            620083..620556
FT                   /gene="nifU"
FT                   /locus_tag="aq_896"
FT   CDS_pept        620083..620556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="aq_896"
FT                   /product="NifU protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_896"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07015"
FT                   /db_xref="GOA:O67045"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="PDB:2Z7E"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67045"
FT                   /protein_id="AAC07015.1"
FT                   /translation="MSFEYNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGDAMLFTIK
FT                   VNPENDVIEDVRFKTFGCGSAIAVSSMLTEMVKGKPIQYALNLTYKDIFEELGGLPPQK
FT                   IHCTNLGLETLHVAIKDYLMKQGRVEEASKIPDCYEEEEEQEESKEFEFLSGT"
FT   gene            620558..621313
FT                   /locus_tag="aq_898"
FT   CDS_pept        620558..621313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_898"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_898"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07016"
FT                   /db_xref="GOA:O67046"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:O67046"
FT                   /protein_id="AAC07016.1"
FT                   /translation="MGKRKALALLSGGLDSSLAVKLVQEQGIEVKAFHFYTGFCITEFK
FT                   RRLGQTKEDGSPYVNPAIKAAAQLGVPIEIVDISEEYYDVVINPKYGYGKNVNPCVDCR
FT                   IMMLKKAKEIMEKEGYDFIVTGEVLYQRPMSQTPERLKLIEKEAGLEGLILRPLSAKVL
FT                   PPTIPEKEGWVDRNKLLGIKGRSRKVQIELAKKYGLDYEQPAGGCCYLTDETYAARFKE
FT                   AYATEGIITRMTLFCLRWEDTSDFLLERN"
FT   gene            621274..621606
FT                   /locus_tag="aq_899"
FT   CDS_pept        621274..621606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_899"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_899"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07017"
FT                   /db_xref="UniProtKB/TrEMBL:O67047"
FT                   /protein_id="AAC07017.1"
FT                   /translation="MGRHLRLPSGTKLIVARNQGEVNFLKGFRNRYNYAYRKDGKGTFA
FT                   LIKGNPPEEELQLIADIIARYSKNEPAKVGIHLNGKEIELIGNPPSDEFLEQFKIYAKK
FT                   EVGHGR"
FT   gene            621726..622097
FT                   /locus_tag="aq_900"
FT   CDS_pept        621726..622097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_900"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_900"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07018"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67048"
FT                   /protein_id="AAC07018.1"
FT                   /translation="MTRVLLRTFPPGAKPPVRNSWVCMRKTESTTYSSKNQGAQVMVAV
FT                   MKFSEDIPLTTLLETAPECEEILMKYGLQKIKEDGVYEIVVPRLTLRGFITLMNLKEKE
FT                   RDELVSKLEEIYNKKLSGG"
FT   gene            622364..623173
FT                   /gene="aroE"
FT                   /locus_tag="aq_901"
FT   CDS_pept        622364..623173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="aq_901"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_901"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07007"
FT                   /db_xref="GOA:O67049"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="PDB:2HK7"
FT                   /db_xref="PDB:2HK8"
FT                   /db_xref="PDB:2HK9"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67049"
FT                   /protein_id="AAC07007.1"
FT                   /translation="MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINP
FT                   EELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYN
FT                   TDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLA
FT                   QKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDKDPEIFNYDLIKKDHVVVDIIYKETKLL
FT                   KKAKEKGAKLFDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLRG"
FT   gene            623166..623621
FT                   /locus_tag="aq_903"
FT   CDS_pept        623166..623621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_903"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_903"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07025"
FT                   /db_xref="GOA:O67050"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="PDB:1WWR"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67050"
FT                   /protein_id="AAC07025.1"
FT                   /translation="MGKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEE
FT                   LKDPTAHAEMLAIKEACRRLNTKYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSALDK
FT                   KHGGVVSVFNILDEPTLNHRVKWEYYPLEEASELLSEFFKKLRNNII"
FT   gene            623622..624131
FT                   /locus_tag="aq_904"
FT   CDS_pept        623622..624131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_904"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_904"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07019"
FT                   /db_xref="InterPro:IPR021857"
FT                   /db_xref="UniProtKB/TrEMBL:O67051"
FT                   /protein_id="AAC07019.1"
FT                   /translation="MTPFKELQKFIHWKERFLRDYEKIEKGELEKIREEVKEMLGEEPD
FT                   ERLLKALRSMYVGGMEHRVEDEEIRYWTNWGGVKTYETFNRFPLLSDIELAFVFWALGK
FT                   LFVPLLMHETGVKSEPFKKLSREEQEEAVLDELDTLWETQLTLILQALQFLDLKSISSE
FT                   KPSSEG"
FT   gene            complement(624284..625825)
FT                   /gene="hksP3"
FT                   /locus_tag="aq_905"
FT   CDS_pept        complement(624284..625825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hksP3"
FT                   /locus_tag="aq_905"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_905"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07011"
FT                   /db_xref="GOA:O67052"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:O67052"
FT                   /protein_id="AAC07011.1"
FT                   /translation="MNKLLLFLALIILIGVNIGFFLNLKKLPDANYPFILIAINVDLLF
FT                   LLIISAVIFRKLIKVYLGKAKHRLRRKLVNVLIFYIFVPLFILNIFSAFLIFQTTREFL
FT                   SGKIRDLIREAELTYRELQDYRIKDLYEKREILKNLPEEKIKELDFVKGVFKEACNYEI
FT                   KETKEVYYLCLGDKYVLVEKDKFPESLERFGGIALDLRSLTKVRDIVTGIYAFLMVSVG
FT                   LLTLLATVWLAMLFARYVSEPLEELTEKALEISKGNLNVDIKVEKRGDEIEELSSAFLV
FT                   MKENLRELYEKLKQEKEALQRLLDALPVGVLFKKNNGNVYTNKTFNQMFGKVENLENFL
FT                   KEVKSIKNLRIQEVDQNEGKIYIFEDITPIVLAERFKVWRESVKRIAHEIKNPLTPIKL
FT                   NLGRILRQLEKEEIDKDKLREIVKAIYEEVERINNLINQFRSIGRERELKPERISLKDL
FT                   IQEVSKLYKNAGISIKVHGDKVLLADRELLKEVFYNLINNSIEHGGKEILIEINT"
FT   gene            complement(625818..626483)
FT                   /gene="phoU"
FT                   /locus_tag="aq_906"
FT   CDS_pept        complement(625818..626483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="aq_906"
FT                   /product="transcriptional regulator (PhoU-like)"
FT                   /db_xref="EnsemblGenomes-Gn:aq_906"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07012"
FT                   /db_xref="GOA:O67053"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="PDB:1T72"
FT                   /db_xref="PDB:1T8B"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67053"
FT                   /protein_id="AAC07012.1"
FT                   /translation="MKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIK
FT                   GDDTIDLLEVDIERRCIRMIALYQPEAGDLRMIMGIYKIVSDLERMGDEAENIAERAIL
FT                   LAEEPPLKPYVNINFMSEIVKEMVNDSVISFIQQDTLLAKKVIEKDDTVDELYHQLERE
FT                   LMTYVLEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYLSEGEIVKHQHIKEKGE"
FT   gene            626498..627073
FT                   /gene="gmhA"
FT                   /locus_tag="aq_908"
FT   CDS_pept        626498..627073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="aq_908"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_908"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07009"
FT                   /db_xref="GOA:O67054"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67054"
FT                   /protein_id="AAC07009.1"
FT                   /translation="MLEKVKKIFRESAEVKLAFVELYAQQIVDVAGIIATALKDGNKVL
FT                   LFGNGGSAADAQHIAAELVGRFKKERRPLPAIALTTDTSILTALGNDYGFETIFERQVE
FT                   ALCMPGDVAIGITTSGNSENVIRGLKKAHDLGATTIAFTGRNGGKVAQIAHYTFIVPSY
FT                   ETQRIQECHITLGHVLCELVEEMVCERS"
FT   gene            627058..627882
FT                   /locus_tag="aq_909"
FT   CDS_pept        627058..627882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_909"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_909"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07026"
FT                   /db_xref="GOA:O67055"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67055"
FT                   /protein_id="AAC07026.1"
FT                   /translation="MRKVLVFLKNSKKAFETFKRVERVLKDLNLSYKKFINRKELFKVL
FT                   KPKDYELFLVIGGDGTFLSAARIASRFGVPLVGVNEGRFGFLTEIKKEEIKKVLPLVLE
FT                   GRAKLQERLMIDVYLRSRNRLRYLGNYLNDAVISKSSIARIIRTKVFINGEEVLEVFGD
FT                   GVILSTPTGSTAYALSAGGPIVYPESQNLLFVPICPHTLSNRPLVLPSKFEVKFKVVSE
FT                   NMEAFLTLDGQEGFHLKKGDEVIVKRSRYVCRMYSHPRKSFFGILKEKLRWG"
FT   gene            complement(627868..628575)
FT                   /gene="dnaC"
FT                   /locus_tag="aq_910"
FT   CDS_pept        complement(627868..628575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="aq_910"
FT                   /product="DNA replication protein DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:aq_910"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07013"
FT                   /db_xref="GOA:O67056"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:3EC2"
FT                   /db_xref="PDB:3ECC"
FT                   /db_xref="UniProtKB/TrEMBL:O67056"
FT                   /protein_id="AAC07013.1"
FT                   /translation="MQDTATCSICQGTGFVKTEDNKVRLCECRFKKRDVNRELNIPKRY
FT                   WNANLDTYHPKNVSQNRALLTIRVFVHNFNPEEGKGLTFVGSPGVGKTHLAVATLKAIY
FT                   EKKGIRGYFFDTKDLIFRLKHLMDEGKDTKFLKTVLNSPVLVLDDLGSERLSDWQRELI
FT                   SYIITYRYNNLKSTIITTNYSLQREEESSVRISADLASRLGENVVSKIYEMNELLVIKG
FT                   SDLRKSKKLSTPS"
FT   gene            complement(628608..629369)
FT                   /gene="ebs"
FT                   /locus_tag="aq_911"
FT   CDS_pept        complement(628608..629369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebs"
FT                   /locus_tag="aq_911"
FT                   /product="erythrocyte band 7-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_911"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07014"
FT                   /db_xref="GOA:O67057"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:O67057"
FT                   /protein_id="AAC07014.1"
FT                   /translation="MEFLPLPPIFIAILVLLFLASAIKVIPEYERAVVFRLGRVIGAKG
FT                   PGLIIVIPIIDRIVRVSLRTVTLDVPTQDVITKDNVTVQVDAVVYFRVVDPVKAIVEVE
FT                   DYFYATSQIAQTTLRSVCGEAELDELLSQREKINMKLQEIIDRQTDPWGVKVIAVELKK
FT                   IDLPEELRKALARQAEAERERRAKIISAEAEYQAAQKLLEAARILAQEPIAIQLRYLET
FT                   LHTIGLHNAKTVIFPFPLELVEFMKGRKSND"
FT   gene            complement(629378..630031)
FT                   /locus_tag="aq_913"
FT   CDS_pept        complement(629378..630031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_913"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_913"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07020"
FT                   /db_xref="GOA:O67058"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:O67058"
FT                   /protein_id="AAC07020.1"
FT                   /translation="MDIYKKLPPLQEPRLFMSTERTYLSQLRFSILVISFALGLTKIEW
FT                   VAKMMNKGDIAEFLRTGAGALAVIATLVAAVGLFSFYKTMSYLKCGEQVDAKEVVDPRI
FT                   YMAAERTFLAWIRTAIAITVFGFVIEKFEFFLVQLDRILHISTRVHHEKLFSIGAFIIG
FT                   IGVLTLVLGTANFYRTISQIDRGFYRTNVWLYKAYGLVIFITCLTLAFYILELI"
FT   gene            630065..630421
FT                   /locus_tag="aq_914"
FT   CDS_pept        630065..630421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_914"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_914"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07021"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67059"
FT                   /protein_id="AAC07021.1"
FT                   /translation="MKRMAGVLGVVLGVFALFGSGKSVDYGDWCPKGKSLGKDIYVEGI
FT                   VDYEGKNWCKVVVRTPYSVTEVYYTPDGSGEKVVKYKNGKKMAEIELVENQVYLRLYDK
FT                   NGKVVEEIKSREEF"
FT   gene            630432..631238
FT                   /locus_tag="aq_915"
FT   CDS_pept        630432..631238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_915"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07027"
FT                   /db_xref="GOA:O67060"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="PDB:2V2Q"
FT                   /db_xref="PDB:2V2V"
FT                   /db_xref="PDB:2V2Z"
FT                   /db_xref="PDB:2V34"
FT                   /db_xref="PDB:2V8P"
FT                   /db_xref="PDB:2VF3"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67060"
FT                   /protein_id="AAC07027.1"
FT                   /translation="MIKVLSPAKINLGLWVLGRLPSGYHEILTLYQEIPFYDEIYIREG
FT                   VLRVETNIGIPQEENLVYKGLREFERITGIEINYSIFIQKNIPPGAGLGGGSSNLAVVL
FT                   KKVNELLGSPLSEEELRELVGSISADAPFFLLGKSAIGRGKGEVLEPVETEISGKITLV
FT                   IPQVSSSTGRVYSSLREEHFVTPEYAEEKIQRIISGEVEEIENVLGDIARELYPEINEV
FT                   YRFVEYLGFKPFVSGSGSTVYFFGGASEELKKAAKMRGWKVVELEL"
FT   gene            631526..632323
FT                   /gene="dapB"
FT                   /locus_tag="aq_916"
FT   CDS_pept        631526..632323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="aq_916"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_916"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07008"
FT                   /db_xref="GOA:O67061"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67061"
FT                   /protein_id="AAC07008.1"
FT                   /translation="MSVRVVVCGALGRMGRRIIELALQDKDVEVVGGVEHPDCVPSIDL
FT                   GEALGKEELKGKPLTSRLEELLPYTDVVIEFSGNPTAAVGHAELTTLEKKAIVIGTTGF
FT                   TKQEIEQIKEFSKNAPVLLSPNMSLGVNLLFKLAEIAAKVLKDKNFDAEIMEIHHRFKK
FT                   DAPSGTAMKLAEILSETLEKKNLVFGRKGEAPRKEDEIGVMALRGGDVVGDHTVYFLGF
FT                   GERIELTHRATSRDTFAKGAVEAAKWIKGKEPGFYTMFDVLGL"
FT   gene            complement(632293..633519)
FT                   /locus_tag="aq_917"
FT   CDS_pept        complement(632293..633519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_917"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_917"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07022"
FT                   /db_xref="GOA:O67062"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67062"
FT                   /protein_id="AAC07022.1"
FT                   /translation="MSPGGLNLLYLPPFSIIARFFITALIFLNLEFLFLLYQAFNKEFY
FT                   LTPSVHVFTLGFMASTMIGALFQMLPVVAGAVIEDPLKKATFVHIGLTLGTLFLVYGLY
FT                   SFNKVALLGLFFLLISLLYISSLMLYKLLRIKNLRDAPRGFRFALGSFTAGIILATFLV
FT                   LNLFGFINLNHKYLFDLHMSFMLFGWTATLVASVSFQVIEMFFVTPPYPKFISSYLPKT
FT                   VFTLLVLKVFLPNFSLIDVFISLIFTIYAFFTIKLLLRRKRKIKDPLISLWYVSMTFLI
FT                   ISCVLFPFRENLFYLFLISFGMFVLSVIMAMMYRIIPFLVWMHLSTKGVPKAPTMFEVI
FT                   PQKKMWNNFYLHIISIFSLIFLIFKLYFLPPTFFLISSLYFLYNISKGVLVYVKHIKRA
FT                   QSPSTSNIV"
FT   gene            complement(633516..633977)
FT                   /locus_tag="aq_918"
FT   CDS_pept        complement(633516..633977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_918"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_918"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07023"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:O67063"
FT                   /protein_id="AAC07023.1"
FT                   /translation="MNTYSRRCKMSITQYLTEEHRKCDQIYAEVEKAVNEGNWEKAKEL
FT                   FKEFKEKTLLHFKKEEEVLFPEFEQRTGIVMGPTQVMRMEHDQARELLERMEKALEEKN
FT                   KDEFLSLGESLMILIQQHNMKEEQILYPMSDQNLNAEKMVSKMAELGEV"
FT   gene            633962..634441
FT                   /locus_tag="aq_919"
FT   CDS_pept        633962..634441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_919"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_919"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07024"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67064"
FT                   /protein_id="AAC07024.1"
FT                   /translation="MSKYSFINIHLKRRFKRLEYLSMEKTVTFLLNPLKNNKVWAVLMP
FT                   DGELMDDIVSVKRAQTCMEENEQIWVNPFGGAYMWDTKVSEPYEAEFVLFKKEAVQYMC
FT                   IFNLHEADLQYIDYSPISGELLFDEEELKKKLDEKTLNEFKIFMNELWGYIKEVS"
FT   gene            complement(634438..634728)
FT                   /gene="fdx1"
FT                   /locus_tag="aq_919a"
FT   CDS_pept        complement(634438..634728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx1"
FT                   /locus_tag="aq_919a"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:aq_919a"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07010"
FT                   /db_xref="GOA:O67065"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67065"
FT                   /protein_id="AAC07010.1"
FT                   /translation="MKVIINGKEFDIPKGVRFGELSHEIEKAGIEFGCTDGQCGVCVAR
FT                   VIKGMECLNEPSEEEEETLWRVGAVDEDQRLTCQLVIEKEDCDEIVIESED"
FT   gene            complement(634779..636164)
FT                   /gene="ftsY"
FT                   /locus_tag="aq_920"
FT   CDS_pept        complement(634779..636164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="aq_920"
FT                   /product="cell division protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:aq_920"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07030"
FT                   /db_xref="GOA:O67066"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67066"
FT                   /protein_id="AAC07030.1"
FT                   /translation="MVFFWRKSDVEKKAEKGDKNAILELIKQGKKEKAEKILKKYASQR
FT                   EDLAELLFELYVQEGKLVQAYPLLKKYGDKIGKAKERAKVYQAVGEYQKAIEEFLKVGD
FT                   FESLYNVAKIYHQLEKPDKALEYAQRAEKLVPYEKKEELENFITQLKKELGLIEEKKES
FT                   ILDKLRRGLQKTKEAVEFGVLFRGRKVDEEFFEELEEMLVKADVGVKTAVELTEKLRKE
FT                   AIRKNIKEGEKIKELLKKELKELLKNCQGELKIPEKVGAVLLFVGVNGSGKTTTIGKLA
FT                   HQLKQKGKKVLLVAGDTFRAAAIEQLEVWAKRAGVDIVKKEEGSDPGAVVYEGMKKAKE
FT                   EGYEVVLVDTAGRLHTKEPLINELRKIKKVIQKFDKEEPSETLLVIDATTGQNAIQQAK
FT                   VFKEAVDITGIVVTKLDGSAKGGAVVAICRELKIPIKLVGVGEGIDDLQPFDADAYVEA
FT                   LLE"
FT   gene            complement(636198..637814)
FT                   /locus_tag="aq_922"
FT   CDS_pept        complement(636198..637814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_922"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_922"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07035"
FT                   /db_xref="GOA:O67067"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:O67067"
FT                   /protein_id="AAC07035.1"
FT                   /translation="MGDFREVLFYHSETKHYPYRFARSLGYLDWENQPNPFRFWEGTER
FT                   LDLPLLKDPSHPYEALYDYGLVNTEEFNVKSLSKFLELALGLSAWKAIPGSRWSVRMNP
FT                   SSGNLHPTECYVIIPHLGGLQGVFHYNPFLHALEKRADIPYELSQKIKDFFGTEGFILI
FT                   LTSIPWRESWKYGERAYRYCLLDTGHAIGSVRFSANLKGWKVKYLNALSDKDLEILLGF
FT                   DRVQWVEGEEEFPELALFVFPKEVQDVPRTIPESIINEFKKLNFYGRPNVLSKERVIWE
FT                   IIYRAIKETEKPRTEEFRVIYGNPPILNLVPSYMSAEEVIRKRRSGMAYDGKTYILREL
FT                   FIHALDKTLPRDNYSPFDVEIGLPFVNLFIFVNRVENLPKGLYCFVRNEELLKDLKEIT
FT                   SSEFLWEKVFEDFPLYLLKTGDFREVAGFVACAQDIASDSAFSLGMISLFEPVLREEPW
FT                   FYRNLHWEAGLIGQVLYLEATAHNLNGTGIGCFFDDAMHEVLGISDKTFQDLYHFTFGK
FT                   AVEDPRIQTIEPYYHLKRERR"
FT   gene            637841..639592
FT                   /gene="argS"
FT                   /locus_tag="aq_923"
FT   CDS_pept        637841..639592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="aq_923"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_923"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07033"
FT                   /db_xref="GOA:O67068"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67068"
FT                   /protein_id="AAC07033.1"
FT                   /translation="MKELVKEKVLKALKELYNTQVENFKVEKPKEEAHGDLASNVAFLL
FT                   ARELKKPPVNIAQELADFLSKDETFKSVEAVKGFINFRFSEDFLKEEFKKFLLSGEAYF
FT                   KEDLGKGLKVQLEYVSANPTGPLHLGHGRGAVVGDTLARLFKFFNYDVTREYYINDAGR
FT                   QVYLLGISIYYRYLEKCPERDEETFKEIKEIFEKDGYRGEYVKEIAERLRKLVGESLCK
FT                   PEEANLKEVREKILKEESIELYYTKKYEPKDVVDLLSNYGLDLMMKEIREDLSLMDISF
FT                   DVWFSERSLYDSGEVERLINLLKEKGYVYEKDGALWLKTSLFGDDKDRVVKRSDGTYTY
FT                   FASDIAYHYNKFKRGFEKVINVWGADHHGYIPRVKAALKMLEIPEDWLEILLVQMVKLF
FT                   REGKEVKMSKRAGTFVTLRELLDEVGKDAVRFIFLTKRSDTPLDFDVEKAKEKSSENPV
FT                   YYVQYAHARISGIFREFKERYKKDVSVEELINYVQHLEEEAEIKLIKKVLFFKDELVDI
FT                   TLKREPHLLTYYLIDLAGDFHHYYNHHRILGMEENVMFSRLALVKGIKEVVRLGLNLMG
FT                   VSAPERM"
FT   gene            639612..640379
FT                   /gene="rnpH"
FT                   /locus_tag="aq_924"
FT   CDS_pept        639612..640379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpH"
FT                   /locus_tag="aq_924"
FT                   /product="RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:aq_924"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07032"
FT                   /db_xref="GOA:O67069"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="PDB:1UDN"
FT                   /db_xref="PDB:1UDO"
FT                   /db_xref="PDB:1UDQ"
FT                   /db_xref="PDB:1UDS"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67069"
FT                   /protein_id="AAC07032.1"
FT                   /translation="MRSDGRKEDQLRPVSIQRDFLEYPEGSCLISFGKTKVICTASVIE
FT                   NVPNWLKGKGQGWITAEYSMLPRATQQRTIRESVQGRIGGRTHEIQRMIGRAMRTAVEL
FT                   TKIGERTIWVDCDVIQADGGTRTAAITGAFVAVADAIIKLHKEGIIEETPIKDFVAAVS
FT                   VGIVNDRILLDLNFEEDSAAQVDMNVVGTGSGRLSEVHTMGEEYSFTKDELIKMLDLAQ
FT                   KGINELIELQKKLYVIQDGKWERSELKEVSSTT"
FT   gene            640337..641095
FT                   /locus_tag="aq_926"
FT   CDS_pept        640337..641095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_926"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_926"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07036"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:O67070"
FT                   /protein_id="AAC07036.1"
FT                   /translation="MGKERTEGSKLYYLGCSGYFYPGWRGKFYPKDLKPKDWLKYYSKF
FT                   FNTVEINSTFYHFPNEKNLRRLYRETPKDFKFSVKVNRNITHYRKFKDVKELIKNFYEV
FT                   CRNGLREKLGCVLFQLPPSYTYTKENLERILENLDFGFKNVLEFRHISWWNEEVFKILK
FT                   ERNVTFCSVSAPNLPESLIETSETVYIRFHGKTSWYKYNYSERELKSWAKKIKKSGAKE
FT                   IFAYFNNDYNAYAPQNCLKLKELLGLLTVN"
FT   gene            641141..641731
FT                   /locus_tag="aq_928"
FT   CDS_pept        641141..641731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_928"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_928"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07037"
FT                   /db_xref="GOA:O67071"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67071"
FT                   /protein_id="AAC07037.1"
FT                   /translation="MEFVVKETDGDTLYKLVLGLVVPRPIGWVSTISKDGILNIAPFSF
FT                   FNVVNDEPPVLMISVSNRDDNTLKDTVKNVLDTKEFVVNMVSEEVFEKMLITGEEFPPE
FT                   VNEFEKAGLTPETSKFVKAPRIKEAKVSFECKLYKYVPVYDMHVIFGEALLIKVEDTIL
FT                   DENLNVNYEKYRPIGRLGGKYYVKAFGECKLKV"
FT   gene            641743..642969
FT                   /gene="napA2"
FT                   /locus_tag="aq_929"
FT   CDS_pept        641743..642969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA2"
FT                   /locus_tag="aq_929"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:aq_929"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07034"
FT                   /db_xref="GOA:O67072"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:O67072"
FT                   /protein_id="AAC07034.1"
FT                   /translation="MAAAPVEGNGAGLDVHTLFLHLAILLFSAKLFGSIFRKLGIPPVL
FT                   GEVTAGVILGQSVLGLIPLSEAIKVLAELGVILLLFEVGLEADINMLMRVGLWSTLVAI
FT                   VGAALPFAGGFIVSYYFFGLDLVASLFMGGALTATSIGITVRVLTDLNKHKERFAQIVL
FT                   GAAVLDDIMGVIILAALYEFSKTKAVHFDTTVNLIIHILMFFLIAPFVANVLAKLLSIA
FT                   ARKTQDMDLIPASIMALILLAAYSAHKFGSPSILGSFTAGLALSRRFVIPFAAMLRLDE
FT                   KLLHKVEESITPLVWVMAPIFFVSVGLALNLKAIDFSSPEFWTFSSALIVVAIIGKVLA
FT                   GFVAPGSLKEKASIGFSMLPRGEVGLIFAEFGRSFKAINEVEYAVIVFVVAVTTLIAPI
FT                   VLKLLLKEE"
FT   gene            643202..643591
FT                   /locus_tag="aq_931"
FT   CDS_pept        643202..643591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_931"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_931"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07039"
FT                   /db_xref="GOA:O67073"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67073"
FT                   /protein_id="AAC07039.1"
FT                   /translation="MEAKEKKYGEIEIEKAQLEAWPNPNPERDYMIEITFPEFTCLCPR
FT                   SGYPDFATIKIRYIPDKYIVELKSLKLWLNKFRNRYISHEAATNEIYQALYDLLKPRFL
FT                   EVVGDFHPRGNVHTVVRVRSDENYG"
FT   gene            complement(643595..643683)
FT                   /locus_tag="aq_t15"
FT   tRNA            complement(643595..643683)
FT                   /locus_tag="aq_t15"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:643647..643649,aa:Ser,seq:gct)"
FT   gene            complement(643713..644321)
FT                   /gene="dnaQ"
FT                   /locus_tag="aq_932"
FT   CDS_pept        complement(643713..644321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="aq_932"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_932"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07031"
FT                   /db_xref="GOA:O67074"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67074"
FT                   /protein_id="AAC07031.1"
FT                   /translation="MKSSPKSLKMRDNLLDGTFVVIDLEATGFDVEKSEVIDLAAVRVE
FT                   GGIITEKFSTLVYPGYFIPERIKKLTGITNAMLVGQPTIEEVLPEFLEFVGDNIVVGHF
FT                   VEQDIKFINKYTKQYRGKKFRNPSLCTLKLARKVFPGLKKYSLKEIAENFGFETNGVHR
FT                   ALKDATLTAEIFIKILEELWFKYGIGDYYSLKRLEKGKF"
FT   gene            complement(644552..645313)
FT                   /locus_tag="aq_933"
FT   CDS_pept        complement(644552..645313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_933"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_933"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07040"
FT                   /db_xref="GOA:O67075"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:O67075"
FT                   /protein_id="AAC07040.1"
FT                   /translation="MKVRTAYITNTGKVRPKNEDALLVDGKLFRETSMNTPQVEEFEVY
FT                   EFTPFAVADGLGGHACGEKASGLVLEVLKEEKPEKPEYIKEIILKAKKRLDEYINEGNE
FT                   FCYGFGTALAGVYLSKDRAIVFNVGDCRVYRFRDGNLELLTEDHTYLFQYYKEGRISYE
FT                   ELRLHPERHILESAILGGYPDLPEVFVREEEVKKGDTFLICSDGLWEALSFREKVSCLS
FT                   KEDIKLRANCLFELAYQDGKDNISFILLECD"
FT   gene            complement(645310..645783)
FT                   /locus_tag="aq_935"
FT   CDS_pept        complement(645310..645783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_935"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_935"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07038"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67076"
FT                   /protein_id="AAC07038.1"
FT                   /translation="MQYRRAGLNILIMKSWSYLVTLAGVNEKGEVKQEEALYIVATPMD
FT                   ENLFKDVKYSCFSEHYIPEENAIKHGQAYALGVDFEIENPEEYGIEFFNEDDELYIFKE
FT                   GIPMKEGLKNVFKILMKKLEKEGFNKDFETIRDIGTPSEDLMRECLLEAIKEK"
FT   gene            645833..647737
FT                   /gene="ftsH"
FT                   /locus_tag="aq_936"
FT   CDS_pept        645833..647737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="aq_936"
FT                   /product="cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:aq_936"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07029"
FT                   /db_xref="GOA:O67077"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="PDB:2DI4"
FT                   /db_xref="PDB:4WW0"
FT                   /db_xref="PDB:4Z8X"
FT                   /db_xref="PDB:6GCN"
FT                   /db_xref="PDB:6GCO"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67077"
FT                   /protein_id="AAC07029.1"
FT                   /translation="MNALKNFFIWAIIIGAAIVAFNLFEGKREFTTKVSLNEVVKLVEE
FT                   GKVSYAEVRGNTAIIQTKDGQKLEVTLPPNTNLVDKMVEKGVRVEVANPEPPGGWLVNV
FT                   FLSWLPILFFIGIWIFLLRQMSGGGNVNRAFNFGKSRAKVYIEEKPKVTFKDVAGIEEV
FT                   KEEVKEIIEYLKDPVKFQKLGGRPPKGVLLYGEPGVGKTLLAKAIAGEAHVPFISVSGS
FT                   DFVEMFVGVGAARVRDLFETAKKHAPCIIFIDEIDAVGRARGAIPVGGGHDEREQTLNQ
FT                   LLVEMDGFDTSDGIIVIAATNRPDILDPALLRPGRFDRQIFIPKPDVRGRYEILKVHAR
FT                   NKKLAKDVDLEFVARATPGFTGADLENLLNEAALLAARKGKEEITMEEIEEALDRITMG
FT                   LERKGMTISPKEKEKIAIHEAGHALMGLVSDDDDKVHKISIIPRGMALGVTQQLPIEDK
FT                   HIYDKKDLYNKILVLLGGRAAEEVFFGKDGITTGAENDLQRATDLAYRMVSMWGMSDKV
FT                   GPIAIRRVANPFLGGMTTAVDTSPDLLREIDEEVKRIITEQYEKAKAIVEEYKEPLKAV
FT                   VKKLLEKETITCEEFVEVFKLYGIELKDKCKKEELFDKDRKSEENKELKSEEVKEEVV"
FT   gene            647737..649035
FT                   /gene="leuC"
FT                   /locus_tag="aq_940"
FT   CDS_pept        647737..649035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="aq_940"
FT                   /product="large subunit of isopropylmalate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_940"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07028"
FT                   /db_xref="GOA:O67078"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67078"
FT                   /protein_id="AAC07028.1"
FT                   /translation="MGMTITEKILAEHAGKKEVHPGELITAKIDLAMANDVTAPLAIKI
FT                   LEKYGIDKVFDPERIALVLSHFVPAKDIKSAEQAKIVREFVKKHGIKWFFEEGEGIEHA
FT                   ILPEQGLVVPGDLVVGADSHTCTYGALGAFATGVGSTDIAYAMATGEVWLRVPESMKFI
FT                   FYGKLKPWVMGKDLILYTIGQIGVDGALYRAMEFDGETIRNLSMEQRFTIANMAIEAGG
FT                   KSGIISPDEKTIEYVKQRAKRPWKVYQSDPDAEYHSVYEWDASQIEPLVAWPYLPSNVH
FT                   PVSESTHITIDQAFIGSCTNGRIEDLRVAAKVFEAALKQGKKVHPYVRCIVIPASKAIY
FT                   KQALKEGLIDIFMEAGCVVSTSTCGPCLGGHMGVLAEGERCISTSNRNFPGRMGHPKSE
FT                   SYLANPAVVAASAIMGRIAHPDEVVKAETLAGV"
FT   gene            650221..650544
FT                   /locus_tag="aq_943"
FT   CDS_pept        650221..650544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_943"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_943"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07054"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:O67079"
FT                   /protein_id="AAC07054.1"
FT                   /translation="MAKIKHLEEKFGEKPVSELVYEDENAKVIRFYLKKGQEIKPHTSP
FT                   SSVYITVLKGKVTFTAGEEKIKGEQGSTIYYEPNELHGFVAEEDSVLEAVITPKPVRKV
FT                   SLK"
FT   gene            650617..651102
FT                   /gene="gcsH3"
FT                   /locus_tag="aq_944"
FT   CDS_pept        650617..651102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsH3"
FT                   /locus_tag="aq_944"
FT                   /product="glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:aq_944"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07053"
FT                   /db_xref="GOA:O67080"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67080"
FT                   /protein_id="AAC07053.1"
FT                   /translation="MGKQEKDLGTAWEYQGCLIPKDLYYDIENQVWVRVNEDGTVTLGL
FT                   TDVGQTRAGRLLHIRVKPVGTKVKKGKPVATLESGKWAGPVPALVEGEIVEVNPKVVED
FT                   PNYINIDPYGDAWIVKIKPTSEETLKRDLSELAHGEKAHEEMKKHIDEWDIVCMRCV"
FT   gene            651393..652250
FT                   /gene="glyQ"
FT                   /locus_tag="aq_945"
FT   CDS_pept        651393..652250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="aq_945"
FT                   /product="glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_945"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07050"
FT                   /db_xref="GOA:O67081"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="PDB:5F5W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67081"
FT                   /protein_id="AAC07050.1"
FT                   /translation="MYFQDIIMTLHKFWAEKGCLIWQPYDVEVGAGTMNPATFLKVLGK
FT                   KPWNVAYVEPSRRPQDGRYGENPNRLQHYYQFQVILKPAPRNPQEIYLESLERLGINPL
FT                   EHDIRFVEDDWESPTLGAWGLGWEVWLDGMEITQFTYFQQAGGLDLDEISVEITYGLER
FT                   IAMYIQDKDSVFDIEWKEGITYGEIFKRSEWEWSKYNFELADTDMLFQVYEMFEKESKR
FT                   MVEEGLIFPAYDYLLKCSHVFNILDARGAISVQERARYIRRMNNLAREIAKLYLQVFEN
FT                   VGAT"
FT   gene            652228..652893
FT                   /gene="rnc"
FT                   /locus_tag="aq_946"
FT   CDS_pept        652228..652893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="aq_946"
FT                   /product="RNase III"
FT                   /db_xref="EnsemblGenomes-Gn:aq_946"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07049"
FT                   /db_xref="GOA:O67082"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="PDB:1I4S"
FT                   /db_xref="PDB:1JFZ"
FT                   /db_xref="PDB:1RC5"
FT                   /db_xref="PDB:1RC7"
FT                   /db_xref="PDB:1YYK"
FT                   /db_xref="PDB:1YYO"
FT                   /db_xref="PDB:1YYW"
FT                   /db_xref="PDB:1YZ9"
FT                   /db_xref="PDB:2EZ6"
FT                   /db_xref="PDB:2NUE"
FT                   /db_xref="PDB:2NUF"
FT                   /db_xref="PDB:2NUG"
FT                   /db_xref="PDB:4M2Z"
FT                   /db_xref="PDB:4M30"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67082"
FT                   /protein_id="AAC07049.1"
FT                   /translation="MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDA
FT                   LVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETI
FT                   IGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKR
FT                   WKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE"
FT   gene            652890..653819
FT                   /gene="hemH"
FT                   /locus_tag="aq_948"
FT   CDS_pept        652890..653819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="aq_948"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_948"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07043"
FT                   /db_xref="GOA:O67083"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67083"
FT                   /protein_id="AAC07043.1"
FT                   /translation="MKKGVILINLGGPDSLEAVEPFLYNLFSDPDIFSLPFQKVLAKII
FT                   AKLRAKKTRHYYELMGGKSPQYEQTLEQAKALQERLGEDYKVVVGMRYWKPYIKDALSE
FT                   LLKEGINEVILLPLYPQYSKTTTGSAFNEFERSKKALKADHIKVKKIEHFYDHPLYIKA
FT                   WAEQIKQSVEKPEEYHFLFSAHSLPKKLIEEGDPYQEQTEKTVKLIMENFPEVEYTLAY
FT                   QSKVGFGKWLEPSTDEVIRNLIKKEVKKLLVIPISFVSEHSETLYELDKQYRELAQELG
FT                   YEEFVRVPTLRTNPYFISALEDLVKNEV"
FT   gene            654176..654538
FT                   /locus_tag="aq_950"
FT   CDS_pept        654176..654538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_950"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_950"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07055"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67084"
FT                   /protein_id="AAC07055.1"
FT                   /translation="MRSLNFYHVCTGLFESCGYALIMRDCDSITFRIDECPVPLLSIKN
FT                   AYLKVNEISPEDFVDRIKHSGYLSMLRKGELIKTLECDFNLNLRKKCEKNLEKGDKAIL
FT                   IIHEEKELKFFDIEVL"
FT   gene            complement(654542..655630)
FT                   /gene="pheA"
FT                   /locus_tag="aq_951"
FT   CDS_pept        complement(654542..655630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="aq_951"
FT                   /product="chorismate mutase/prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_951"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07041"
FT                   /db_xref="GOA:O67085"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67085"
FT                   /protein_id="AAC07041.1"
FT                   /translation="MEELKELRKEIDRIDEEILRLLNERAKLAKRIGEIKSKANLPIHV
FT                   PEREREIFEKILRLNKEVYGGVFPQEALVHIYREIISACLSLEKKIKVAYLGPKATFTH
FT                   QAALEFFGFSAHYTPCSTIRDVFVEVETKRADYGVVPVENTIEGVVNYTLDMFLESDVK
FT                   IAGEIVIPITLHLLSASDSIENVEKVYSHKMALAQCRSWLEKNLPSVQVIEVESTAKAC
FT                   EIALEDERAGAVASEVAAYTYHLNILARNIQDSGDNFTRFLVIAKRDLKPTGSDKTSIL
FT                   FGVKDEPGALYKALEVFYKHGINLTKIESRPSKKKAWDYVFFVDLEGHKEEERVEKALK
FT                   ELKEKTQFLKVLGSYPKALLQE"
FT   gene            655685..656041
FT                   /gene="rplT"
FT                   /locus_tag="aq_952"
FT   CDS_pept        655685..656041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="aq_952"
FT                   /product="ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:aq_952"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07052"
FT                   /db_xref="GOA:O67086"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="PDB:1GYZ"
FT                   /db_xref="PDB:2GHJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67086"
FT                   /protein_id="AAC07052.1"
FT                   /translation="MRVKGPSSRRKKKKILKLAKGYRGQRSRSYRRAKEAVMRALYYQY
FT                   RDRKLRKREFRRLWIARINAAVRAYGLNYSTFINGLKKAGIELDRKILADMAVRDPQAF
FT                   EQVVNKVKEALQVQ"
FT   gene            656041..657057
FT                   /gene="pheS"
FT                   /locus_tag="aq_953"
FT   CDS_pept        656041..657057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="aq_953"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_953"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07051"
FT                   /db_xref="GOA:O67087"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67087"
FT                   /protein_id="AAC07051.1"
FT                   /translation="MEKLDKILEELKLLLSSVSSLKELQEVRSKFLGSKGVIKELLKKI
FT                   KEVPSEERKEYGKRVNLLKEEAEKLIKEKEEELKERELEEKLKGEWVDLSIPPARTVGS
FT                   LHPITVTLERIVTIFRGMGFEVEEGPEVEREEYNFDMLNIPKEHPARDMQDTFYVNREG
FT                   YLLRTHTSPVQIRTMLKKKPPIQIIAPGKVYRRDDDPTHSPMFHQVEGLVVNEYANFRH
FT                   MKYVIEEFLKKFFETDLPVRFRTSYFPFTEPSAEVDIGCVICHQEGCRVCKHTGWLEVM
FT                   GCGMVHPKVLENCGIDTDFYQGFAFGMGVERLAMLLFGIDNIKLFYENDLRFIKQFF"
FT   gene            657066..657836
FT                   /gene="lepB"
FT                   /locus_tag="aq_955"
FT   CDS_pept        657066..657836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="aq_955"
FT                   /product="type-I signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_955"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07042"
FT                   /db_xref="GOA:O67088"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67088"
FT                   /protein_id="AAC07042.1"
FT                   /translation="MRKQIVELFLIILAVLFIREYIAQAYTIPSASMEPTLLVGDFILV
FT                   NKLVYSLSEPMRGDMIVFKYPKNPDIDFIKRIIARGGDTVEFFPYYDEKNNVLIYKVAV
FT                   NGKLYELTYEGEKNYSYDCYQYREKLYREDGEVIQHSVCFRNTLLKVPGMVYNAISSDL
FT                   CLKYNEDGFCVKFVVPEGYYFVMGDNRDNSQDSRFWGFVPRENIEGKAFVIYYSGKVPS
FT                   LTPEEANPLTAVRQIIYALLNPRPSRIGKPLIDK"
FT   gene            657836..658306
FT                   /locus_tag="aq_957"
FT   CDS_pept        657836..658306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_957"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_957"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07056"
FT                   /db_xref="GOA:O67089"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67089"
FT                   /protein_id="AAC07056.1"
FT                   /translation="MELRIGFGFDSHEFVEGKLLILGGVEIEKDYGLKGHSDGDALLHA
FT                   ITDAILGALGERDIGEIFKDTDPRWKNAPSRIFLEKALEVMSEKGFNISNIDCVIVADR
FT                   PKIAPHKERIKESLSKLLGIPKERISLKGKRREGFCEGNGLVCMCTVLLVKM"
FT   gene            658313..659230
FT                   /gene="pgsA2"
FT                   /locus_tag="aq_958"
FT   CDS_pept        658313..659230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA2"
FT                   /locus_tag="aq_958"
FT                   /product="phosphotidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_958"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07048"
FT                   /db_xref="GOA:O67090"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:O67090"
FT                   /protein_id="AAC07048.1"
FT                   /translation="MENFLSFFRILITFPVVFLILEKEFFLAFWLYLVGALTDWFDGNL
FT                   ARKNKRVSNFGKLLDPYADKVFVLLPLIALVEVKKVKAIWVILLTFRELSISFFRSVMV
FT                   EKGIYMEASFTGKLKAFLEFSAISLILLGVELGNYLLILAVIFAYISASGTSKGSGLSF
FT                   KELVRYGHPPVLSESPARDLWSDGCLLSLVLVFPYHVYGLVHRIPRKSFPDYLFRAQVL
FT                   LYVKHEYLIQYLVRREYVLICLIWSELRRRRFFKHSFGNIGAYGVSVPCEFVNPRFVNV
FT                   FYRGKTSRHVPVYGCVAHCRFTLV"
FT   gene            complement(658796..660499)
FT                   /gene="nadE"
FT                   /locus_tag="aq_959"
FT   CDS_pept        complement(658796..660499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="aq_959"
FT                   /product="NH(3)-dependent NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_959"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07044"
FT                   /db_xref="GOA:O67091"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67091"
FT                   /protein_id="AAC07044.1"
FT                   /translation="MLNLTLAQLNFTVGDVEGNKEKILKVIDEYSEKSHIIAFPELSLS
FT                   GYPPEDLLLQPHFLKECEKAFDQIIHHTRNYDVIVAVGLPYYEFDLYNALAVIHRGEVL
FT                   GIYKKHFLPNYSVFDEYRYFRKGEEPLMIEVNGHKVSFSICEDIWYPDGVERQTALSGA
FT                   ELIVNVNASPYHVNKYSFKESFLKSRAEDNLCFVAYVNLVGGQDELVFDGRSIVISPFG
FT                   KLVARAKAFEEDILTVTLDLGEAKRKRLLDLRWREGSYGREKVNVKRSVSLPDKEFFRG
FT                   RIEENPKEEEEIYAALKLSLRDYVRKNGFEKVVLGLSGGIDSSFVACLAVDALGRENVK
FT                   GVYMPSQFSSKESYEDAKALAQNLGIEFHVIPIKEIYRAYFNEFEKEICEITFDVADEN
FT                   IQARIRANILFYFSNKFRYLVLSTSNKSETAVGYTTIYGDMAGGFAPIKDVYKTWVYKL
FT                   ARYRNSISPDIPERVFKKPPSAELRPNQTDQDVLPPYEILDQILMLYIEENLSPEEIIR
FT                   KGLPRDAVYKTINMIRKNEYKRKQAPIGPKITSRAFGKDWRMPVTNKFFK"
FT   gene            complement(660510..662204)
FT                   /gene="mbhL2"
FT                   /locus_tag="aq_960"
FT   CDS_pept        complement(660510..662204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhL2"
FT                   /locus_tag="aq_960"
FT                   /product="hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_960"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07046"
FT                   /db_xref="GOA:O67092"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:O67092"
FT                   /protein_id="AAC07046.1"
FT                   /translation="MKRVVVDPVTRIEGHLRIEAEVKDGKITKAYSSGTMVRGIEIILK
FT                   GRDPREAWAFAQRICGVCTTVHAIASVRAVEDALSINVPVNASLLRKLIIGTIFVHDHV
FT                   VHFYHLHLLDWVNPVQALKADPYETSRLAQSLSNYEKSTPGYFREVQKKIKQQVERGQL
FT                   GIFNKGYWNHPEYKLPPELNLMLIAHYLDALDWQTRIVQVHTIIGGKNPHPNFAVGGMA
FT                   APINPESDTAINMEKLGRIKTLIDEMYDFTVKVYLPDIKVLGKYYKDWFFKGEGLGNFL
FT                   VLGEPEKDSWREGKWFIPPTFIKGRNLKDFEEVNINEVKEYVTHSWYKYSVGDDKPLHP
FT                   WEGETNLNYTGPKPPYEYLNVEGKYSWLKAPRYKDYSVEVGPLSRILALYARDMYGIRE
FT                   EVEKHLKEMDVPFEGMFSTMGRTFARALETKLYSFSMKNWFSELMENVKKGNYDVFNPE
FT                   KWEPSTWPKETKGVGFMEAPRGSLSHWVHIKDGKLENYQAVVPTTWNASPRDAKGNPSA
FT                   YEASLVGHSLHNPKEPVEILRTIHSFDPCLACAVHLYGDEEMEIRVV"
FT   gene            complement(662201..663505)
FT                   /gene="hdrD"
FT                   /locus_tag="aq_961"
FT   CDS_pept        complement(662201..663505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrD"
FT                   /locus_tag="aq_961"
FT                   /product="heterodisulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_961"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07045"
FT                   /db_xref="GOA:O67093"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:O67093"
FT                   /protein_id="AAC07045.1"
FT                   /translation="MVKLFHKEKVSQEDIKKFYNFCKSSINSEVAAYLEACVRCGLCAE
FT                   ACHFYMGENISGKIDPTLTPAYKADLLREIYKENYTLWGRIKKLFGFGVKIKPEDLYEQ
FT                   VRLAYYTCTMCDRCTKICPMGIDTPMLVGIVRGALTQIGLTPEDLVEATNRAIEQGSPL
FT                   GVDTKTFLQRIDFISDEWEVEMPVDQPAEYLYIPSSIELMKYPESVAAAAKILNKSGVK
FT                   WTLSTVAHEATNFGMFVQDKKVIKELLERILKGAKELGIKTIISPECGHAYQAIRFVAP
FT                   NVFPKEWDFEVLNVVEFIKKMLDEGRIKLNKKVVDVVTLHDSCQIGRRGGVLREPREIL
FT                   THISQKFVDSVEFPEKNICCGGGGGVVVVHEADEHRRKAFLTKMELFDKAGTKNVACYC
FT                   ANCMLALEKSSKELNRDYKFLSLVELVAEALEDEE"
FT   gene            complement(663518..664198)
FT                   /locus_tag="aq_963"
FT   CDS_pept        complement(663518..664198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_963"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_963"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07057"
FT                   /db_xref="GOA:O67094"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:O67094"
FT                   /protein_id="AAC07057.1"
FT                   /translation="MELIDVKVYDFVRSYLLPVSVYVFFIGILYRFFRVIILGLPHDRS
FT                   KPKGHPFLKAVEKVTFKPTQAWRFFGEVFAHRGIQYVGGFLFHIGFLGLTFFVPQHAFL
FT                   WKKIIGFEFPYMPQIVSDILAYAALGSLVALTVHRIFNPVLKLLTGSDEYIANTLIGIV
FT                   IFTGLLANNWAGGGNYVWLVTLHMLSAALLIIYIPFSRLSHFVYYFVSVFYYGWKVGRR
FT                   GVSF"
FT   gene            complement(664198..665247)
FT                   /gene="mbhS2"
FT                   /locus_tag="aq_965"
FT   CDS_pept        complement(664198..665247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhS2"
FT                   /locus_tag="aq_965"
FT                   /product="hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:aq_965"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07047"
FT                   /db_xref="GOA:O67095"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:O67095"
FT                   /protein_id="AAC07047.1"
FT                   /translation="MESLYEIFKRKGYSRRDFLKFSLAVSAFLGLPPSLYPKVAQALEK
FT                   KEKPVVIWLEFQDCAGCSESFIRSTTLLPTEVLLDYISLEYHETLMAPSGFYAEEAREE
FT                   AIKKYKGKYVLVVEGSPTPADGGVYCTVGGKSSVDILRETAEHAAFVIAVGSCASWGGI
FT                   PKASPNPTGAVPVYEIVKDKPVVNVPGCPPIGDVMVATIVHFLALGKLPPLDELGRPKQ
FT                   FYGETIHDRCYRRAFYNSGQFAESFDDEKARKGYCLYKLGCKGPITRNACASMRWNGGL
FT                   SFPIQSGHPCFGCSEPDFWDRGFIYNPLSVMEGYSGISDTLKGVGIGAAVGIGIGVLNK
FT                   LINKKKEEK"
FT   gene            666041..666550
FT                   /locus_tag="aq_966"
FT   CDS_pept        666041..666550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_966"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_966"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07066"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:O67096"
FT                   /protein_id="AAC07066.1"
FT                   /translation="MLKDFLKEQGFEVRENHEVDAVIIGQDKEIEFKKIKNATSAVFLK
FT                   GAKIIPVNLSKIVKDSDGLYFPGSGSYAYMFKHATNYEGEIPNLGKPSKEFINLALEGL
FT                   PREKVFLISDDIYTDLMGAKELGIGTIFMTTGKYKQEELKKANFKPDYVFHSLKELMRE
FT                   IKKWLS"
FT   gene            666538..668499
FT                   /gene="ostA"
FT                   /locus_tag="aq_967"
FT   CDS_pept        666538..668499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="aq_967"
FT                   /product="organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_967"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07065"
FT                   /db_xref="GOA:O67097"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:O67097"
FT                   /protein_id="AAC07065.1"
FT                   /translation="MALLILFFLLGLSFSLEVFSEKLEIKENEIIAEGDAEAYYKNYYI
FT                   KAKKIKLLRDKDEVYAYEDVYIKNLKTGFEIRGSFAYVNMKKNKGYFLNAKGKFREFNF
FT                   EAKKIEQLDKERFKVYEATVTTCPLDDKELYLCIFRANITKERALIFHNRLKFFKVPIF
FT                   YLPVYLIPLGGRKTGFLMPTIGSSTYSSFIYIQPFFWAISRDKDMTITADYRKDQMKGL
FT                   SLEYRQAFDEESDLITQFSLYKEDKKKGDWWKGREMYRENRFRIFMKYRKKPFKIGVEE
FT                   LSDPYYYEDISFKQEEITKPYTKTYLIYEKETKNYLFYFQTVRYRDLTEEKNNAVNLLP
FT                   EASFHLKPFYYKGFNFSLDSSFTNFYRNYDGSFMRISLEPTVGKYFELFKVSNYSSLTL
FT                   INRYYPDSEEDKIVSTFRFRHSVPQYFSLSYGGFKFKNFLEGLYTFSPKDYEVQIFDYQ
FT                   DELNEENNFQFTLVGNLYKNRKLMDYFLNTGYNLLGSYTFPTDGKKIDKKLLPLYYNVS
FT                   VYPVENVRFWQDAVYDFNLGVFARNVIGTDISWKNFSVGISNSVYKNSEKKVTTDQIAL
FT                   NLKYSGDKFFSGISLNYDRLVDKETYRNVYVGVKGKCWSLVLDYKRNYYRNRDEYVDQV
FT                   FLRFNLFFKEEIEIPLRR"
FT   gene            complement(668496..669164)
FT                   /gene="cbbE2"
FT                   /locus_tag="aq_968"
FT   CDS_pept        complement(668496..669164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbE2"
FT                   /locus_tag="aq_968"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_968"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07062"
FT                   /db_xref="GOA:O67098"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67098"
FT                   /protein_id="AAC07062.1"
FT                   /translation="MKLLAPSILAGDWWCIGEQIQATIRGGADILHYDVMDGHFVPNIT
FT                   AGYEILSHIRKRASLPIDAHLMIENPDKYIPKFVEAGANWISVHIENNYHIHRTLQLIK
FT                   ELGAKAGVVVNPGTSLSAIEEALYYADYVLLMSVNPGFSGQKFIERSIERLRILKEMRD
FT                   RINPSCLIEIDGGIKENNIAEVVRAGADVVVVGSGIFGAKDIEAQTRKLKSLMLSAVSV
FT                   "
FT   gene            669174..669761
FT                   /gene="tmk"
FT                   /locus_tag="aq_969"
FT   CDS_pept        669174..669761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="aq_969"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_969"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07063"
FT                   /db_xref="GOA:O67099"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="PDB:2PBR"
FT                   /db_xref="PDB:4S2E"
FT                   /db_xref="PDB:4S35"
FT                   /db_xref="PDB:5H56"
FT                   /db_xref="PDB:5H5B"
FT                   /db_xref="PDB:5H5K"
FT                   /db_xref="PDB:5XAI"
FT                   /db_xref="PDB:5XB2"
FT                   /db_xref="PDB:5XB3"
FT                   /db_xref="PDB:5XB5"
FT                   /db_xref="PDB:5XBH"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67099"
FT                   /protein_id="AAC07063.1"
FT                   /translation="MLIAFEGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTKVGEV
FT                   LREILLTEELDERTELLLFEASRSKLIEEKIIPDLKRDKVVILDRFVLSTIAYQGYGKG
FT                   LDVEFIKNLNEFATRGVKPDITLLLDIPVDIALRRLKEKNRFENKEFLEKVRKGFLELA
FT                   KEEENVVVIDASGEEEEVFKEILRALSGVLRV"
FT   gene            complement(669738..670877)
FT                   /gene="argJ"
FT                   /locus_tag="aq_970"
FT   CDS_pept        complement(669738..670877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="aq_970"
FT                   /product="glutamate N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_970"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07058"
FT                   /db_xref="GOA:O67100"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67100"
FT                   /protein_id="AAC07058.1"
FT                   /translation="MAEILMGVGNAGLKESGNPDILVVYLPYPCTASFVFTDNYFKAGS
FT                   VIYSERIARDKERIRAFVVNSGNANCGTGEEGIKHAEMMAEKVAQILDIPKDEVFVFST
FT                   GIIGKYLPIENVLKGIEQACSNLELLDLKRASEVISTTDRFPKYDFAKAGEVETFGFAK
FT                   GAGMIHPSMATMLAFVFTNANLEYLTLKRIHESVTEKTFNSITVDGCESTNDAFGIISL
FT                   GEVEADPETVEFELLKVSESLAKQIVADGEGATKIIRVNVRSAITEIKAREIAEAIANS
FT                   LLVKTAVFGRDPNWGRIAAAAGSTEFPIDPFKLEIYVGGYLLYDGKPHDENLEKAKKHL
FT                   IEDREVDITVELNEGEYEWVCYSSDIGYDYIKLNAEYTT"
FT   gene            complement(670887..672164)
FT                   /locus_tag="aq_972"
FT   CDS_pept        complement(670887..672164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_972"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_972"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07070"
FT                   /db_xref="GOA:O67101"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:O67101"
FT                   /protein_id="AAC07070.1"
FT                   /translation="MRVRALISALFIFIVSCTQVVDPLTGKKTFTVLPPEEEIAIGNSV
FT                   FPQAITEYEGIYPDKEVQEYVKELGNSIAKHTPRKLPYEFVLVNSKILNAFALPGGKIV
FT                   ITRGLVLMLDSESELAGVLAHELGHVNARHYARYLEKMLGLSILLQIGALLINDRDTTA
FT                   RIALQLASIGASLLALKFSRDQEREADKYGVVFAVKAGYDPHGLIETFKKFKKMEKDYP
FT                   PEWLSTHPLPDTRIREVSKLISSMKLPPNLKKDSPQFQRIKEKLLATKKSYDLYYEGRK
FT                   LYKEGLKDEALKKFEEAIKLFPNNQIAMSYASAIYLEHGKYKRALEYAKRVSDLDPYLL
FT                   WGWYLQGIAYFKLKKYKESIRALNEAKKRIPSYAGIYYYLGRDYEELGDVKKAVENYKL
FT                   ALKFASGREPWYEDAKRRLQRYGVIF"
FT   gene            672190..673695
FT                   /gene="secD"
FT                   /locus_tag="aq_973"
FT   CDS_pept        672190..673695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="aq_973"
FT                   /product="protein export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:aq_973"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07060"
FT                   /db_xref="GOA:O67102"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67102"
FT                   /protein_id="AAC07060.1"
FT                   /translation="MILIMQKKNLWLHLLGLVILTLLSAYAVVKYPINLGLDLKGGVEF
FT                   LLEPDFSVAIEREYEDLARNLREKLSKFNVLEVYATKEGVIIELLDKKEVENIKKVIQD
FT                   INPNVIFEEEGDKLVVKFTQKYVEQLKEDIVRQSIEIIRDRIDKLGVTQPVVTRVGKYR
FT                   ILVDLPGFLDVERAKKIIGSTASLELKLVIDVSTDRKELEKKLTPDREILPSRDGREWF
FT                   LVEKAPVITGQDLKTAYVGVDNLGQPAVNFELKGEAAEKFGKFTEQNIGKRLAIVLDRK
FT                   VVSAPVIRSKISDRGQITGNFTAQEARDLALILRTGSLPSPLKFLQEKIVGPSLGKDAI
FT                   EQGIKAGILAIILLAVVLIARYKTAGITANISIFLNVLFLLASMAFLGATLTLPGIAGI
FT                   ILNMGIAVDSNVLIFERVKEELRLGNTVSKAIELGFKRTLSAVWDTHVTLLVASVILFQ
FT                   FGSGPVKGFATTLALGTIASFISNVYYAKVFLDLLNSLKILKI"
FT   gene            673738..674661
FT                   /gene="cphA2"
FT                   /locus_tag="aq_974"
FT   CDS_pept        673738..674661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cphA2"
FT                   /locus_tag="aq_974"
FT                   /product="beta lactamase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:aq_974"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07059"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:O67103"
FT                   /protein_id="AAC07059.1"
FT                   /translation="MGGAVMLKTLFVLLLIISTAFSMTLKKVEENLYMVRGNDGLPSKE
FT                   NKGFISNAYAVLTEEGWVVIDTLTTPELSEEFLNLLKKVSNKPVIYAIVTHYHLDHWYG
FT                   AKTFKDKGAKVIAHEKLKEFYDSGEALQVLEAQKKRFKGVLDSVELVPPDEVVKDKKVL
FT                   KVGKDVFEIYAMPPAHTNSDLVIYWKNRKVLFVGDLVYINRIPFMGDRNASSKGWLEVL
FT                   ERLKEFDARMLLGGHNYPMNKDAIDWTYNYIKFVRDTVKKLKDEGYFIDEIKEAFKGNP
FT                   YEKVKMYEVFHNTNVWKVYNELDLEL"
FT   gene            674673..675671
FT                   /gene="bioB"
FT                   /locus_tag="aq_975"
FT   CDS_pept        674673..675671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="aq_975"
FT                   /product="biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:aq_975"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07061"
FT                   /db_xref="GOA:O67104"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:O67104"
FT                   /protein_id="AAC07061.1"
FT                   /translation="MDKVERRLYELYEKAINYEPLSKEEALYILEVDDIYVPFLVHLAQ
FT                   KIKKHYFPENEVEFCSIINAKSGACSEDCKFCAQSKYYKTPINVYNLVPVDEMVEGAIR
FT                   GVEFGANRYCIVLSGKSATKEEVERITEAVKEIKNEGLPINVCVSAGTLDEESLKKLKE
FT                   AGVKRINHNLETSRNFFKNIVTTHTWEDRYETIKRIKKVGLSTCSGGIFGMGESNEDRV
FT                   DMALTYRELEVDSIPLNFLMPIEGTPMENAPGVEVMEALKIIAMFRFTNPKAELRLCGG
FT                   REQNLRDFHGMATLMTNAMMVGGYLTRAGRDIKKDYQLLKDLKAKRKVSVE"
FT   gene            675750..676754
FT                   /locus_tag="aq_977"
FT   CDS_pept        675750..676754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_977"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_977"
FT                   /db_xref="EnsemblGenomes-Tr:AAC07067"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:O67105"
FT                   /protein_id="AAC07067.1"
FT                   /translation="MPLWGRFRISFDSWKMMSLDNHVLEESSEIGEVNVETSEWKPING
FT                   CIPEDYDEENLKIAFIDGVRRTENIVYLEDPNSASVVEGAFVSIGAGAMVLSYGKVNSL
FT                   EDSLKKSVVKRYFLLRDNVDISQPTIVFLTQTGKLEFKVDRAKKELSPYVNELMANLEL
FT                   WVAQQVYKAKMADLMITDGTLHYVAKAKNLPFIGYVKKHRKIYLYPEHIKVLQELKVGQ
FT                   RTPIILIHSQPTMDSQNKSFDKYTWYVKLNENEGITSVARLEVPAELGLEEAVKLANLT
FT                   AYLMPKFASAEFNDKRAPQNLIPIKYLENYLRRRLGSQSLIRRLIAQRIMERV"
FT   gene            676751..677188
FT                   /locus_tag="aq_978"
FT   CDS_pept        676751..677188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="aq_978"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:aq_978"
FT                   /db_xref="EnsemblGenomes-Tr:AAC070