(data stored in SCRATCH zone)

EMBL: AE001363

ID   AE001363; SV 1; circular; genomic DNA; STD; PRO; 1230230 BP.
XX
AC   AE001363; AE001585-AE001687;
XX
PR   Project:PRJNA248;
XX
DT   27-JAN-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Chlamydophila pneumoniae CWL029, complete genome.
XX
KW   .
XX
OS   Chlamydia pneumoniae CWL029
OC   Bacteria; Chlamydiae; Chlamydiales; Chlamydiaceae;
OC   Chlamydia/Chlamydophila group; Chlamydia.
XX
RN   [1]
RP   1-1230230
RX   DOI; 10.1038/7716.
RX   PUBMED; 10192388.
RA   Kalman S., Mitchell W., Marathe R., Lammel C., Fan J., Hyman R.W.,
RA   Olinger L., Grimwood J., Davis R.W., Stephens R.S.;
RT   "Comparative genomes of Chlamydia pneumoniae and C. trachomatis";
RL   Nat Genet 21(4):385-389(1999).
XX
RN   [2]
RP   1-1230230
RA   Kalman S., Mitchell W., Marathe R., Lammel C., Fan J., Olinger L.,
RA   Grimwood J., Davis R.W., Stephens R.S.;
RT   ;
RL   Submitted (01-DEC-1998) to the INSDC.
RL   Program in Infectious Diseases, University of California, 235 Earl Warren
RL   Hall, Berkeley, CA 94720, USA
XX
DR   MD5; f3c3b4347c4fe1ce885796c0caf1076e.
DR   BioSample; SAMN02603115.
DR   EnsemblGenomes-Gn; CPn_r01.
DR   EnsemblGenomes-Gn; CPn_r02.
DR   EnsemblGenomes-Gn; CPn_r03.
DR   EnsemblGenomes-Gn; CPn_s01.
DR   EnsemblGenomes-Gn; CPn_t01.
DR   EnsemblGenomes-Gn; CPn_t03.
DR   EnsemblGenomes-Gn; CPn_t04.
DR   EnsemblGenomes-Gn; CPn_t05.
DR   EnsemblGenomes-Gn; CPn_t06.
DR   EnsemblGenomes-Gn; CPn_t07.
DR   EnsemblGenomes-Gn; CPn_t08.
DR   EnsemblGenomes-Gn; CPn_t09.
DR   EnsemblGenomes-Gn; CPn_t10.
DR   EnsemblGenomes-Gn; CPn_t11.
DR   EnsemblGenomes-Gn; CPn_t14.
DR   EnsemblGenomes-Gn; CPn_t15.
DR   EnsemblGenomes-Gn; CPn_t16.
DR   EnsemblGenomes-Gn; CPn_t17.
DR   EnsemblGenomes-Gn; CPn_t19.
DR   EnsemblGenomes-Gn; CPn_t20.
DR   EnsemblGenomes-Gn; CPn_t21.
DR   EnsemblGenomes-Gn; CPn_t22.
DR   EnsemblGenomes-Gn; CPn_t23.
DR   EnsemblGenomes-Gn; CPn_t24.
DR   EnsemblGenomes-Gn; CPn_t25.
DR   EnsemblGenomes-Gn; CPn_t26.
DR   EnsemblGenomes-Gn; CPn_t27.
DR   EnsemblGenomes-Gn; CPn_t29.
DR   EnsemblGenomes-Gn; CPn_t30.
DR   EnsemblGenomes-Gn; CPn_t31.
DR   EnsemblGenomes-Gn; CPn_t32.
DR   EnsemblGenomes-Gn; CPn_t33.
DR   EnsemblGenomes-Gn; CPn_t34.
DR   EnsemblGenomes-Gn; CPn_t35.
DR   EnsemblGenomes-Gn; CPn_t36.
DR   EnsemblGenomes-Gn; CPn_t37.
DR   EnsemblGenomes-Gn; CPn_t38.
DR   EnsemblGenomes-Gn; EBG00001151233.
DR   EnsemblGenomes-Gn; EBG00001151235.
DR   EnsemblGenomes-Gn; EBG00001151239.
DR   EnsemblGenomes-Gn; EBG00001151243.
DR   EnsemblGenomes-Gn; EBG00001151245.
DR   EnsemblGenomes-Gn; EBG00001151247.
DR   EnsemblGenomes-Gn; EBG00001151249.
DR   EnsemblGenomes-Gn; EBG00001151250.
DR   EnsemblGenomes-Gn; EBG00001151251.
DR   EnsemblGenomes-Gn; EBG00001151252.
DR   EnsemblGenomes-Gn; EBG00001151253.
DR   EnsemblGenomes-Gn; EBG00001151255.
DR   EnsemblGenomes-Gn; EBG00001151256.
DR   EnsemblGenomes-Gn; EBG00001151258.
DR   EnsemblGenomes-Gn; EBG00001151260.
DR   EnsemblGenomes-Gn; EBG00001151262.
DR   EnsemblGenomes-Gn; EBG00001151264.
DR   EnsemblGenomes-Gn; EBG00001151266.
DR   EnsemblGenomes-Gn; EBG00001151268.
DR   EnsemblGenomes-Gn; EBG00001151269.
DR   EnsemblGenomes-Gn; EBG00001151270.
DR   EnsemblGenomes-Gn; EBG00001151271.
DR   EnsemblGenomes-Gn; EBG00001151274.
DR   EnsemblGenomes-Gn; EBG00001151275.
DR   EnsemblGenomes-Gn; EBG00001151276.
DR   EnsemblGenomes-Gn; EBG00001151277.
DR   EnsemblGenomes-Gn; EBG00001151279.
DR   EnsemblGenomes-Gn; EBG00001151280.
DR   EnsemblGenomes-Gn; EBG00001151283.
DR   EnsemblGenomes-Gn; EBG00001151284.
DR   EnsemblGenomes-Gn; EBG00001151286.
DR   EnsemblGenomes-Gn; EBG00001151287.
DR   EnsemblGenomes-Gn; EBG00001151288.
DR   EnsemblGenomes-Gn; EBG00001151290.
DR   EnsemblGenomes-Gn; EBG00001151291.
DR   EnsemblGenomes-Gn; EBG00001151292.
DR   EnsemblGenomes-Gn; EBG00001151293.
DR   EnsemblGenomes-Gn; EBG00001151294.
DR   EnsemblGenomes-Tr; CPn_r01-1.
DR   EnsemblGenomes-Tr; CPn_r02-1.
DR   EnsemblGenomes-Tr; CPn_r03-1.
DR   EnsemblGenomes-Tr; CPn_s01-1.
DR   EnsemblGenomes-Tr; CPn_t01-1.
DR   EnsemblGenomes-Tr; CPn_t03-1.
DR   EnsemblGenomes-Tr; CPn_t04-1.
DR   EnsemblGenomes-Tr; CPn_t06-1.
DR   EnsemblGenomes-Tr; CPn_t07-1.
DR   EnsemblGenomes-Tr; CPn_t08-1.
DR   EnsemblGenomes-Tr; CPn_t09-1.
DR   EnsemblGenomes-Tr; CPn_t10-1.
DR   EnsemblGenomes-Tr; CPn_t13-1.
DR   EnsemblGenomes-Tr; CPn_t14-1.
DR   EnsemblGenomes-Tr; CPn_t15-1.
DR   EnsemblGenomes-Tr; CPn_t16-1.
DR   EnsemblGenomes-Tr; CPn_t17-1.
DR   EnsemblGenomes-Tr; CPn_t18-1.
DR   EnsemblGenomes-Tr; CPn_t19-1.
DR   EnsemblGenomes-Tr; CPn_t20-1.
DR   EnsemblGenomes-Tr; CPn_t21-1.
DR   EnsemblGenomes-Tr; CPn_t22-1.
DR   EnsemblGenomes-Tr; CPn_t23-1.
DR   EnsemblGenomes-Tr; CPn_t24-1.
DR   EnsemblGenomes-Tr; CPn_t26-1.
DR   EnsemblGenomes-Tr; CPn_t27-1.
DR   EnsemblGenomes-Tr; CPn_t29-1.
DR   EnsemblGenomes-Tr; CPn_t31-1.
DR   EnsemblGenomes-Tr; CPn_t32-1.
DR   EnsemblGenomes-Tr; CPn_t33-1.
DR   EnsemblGenomes-Tr; CPn_t34-1.
DR   EnsemblGenomes-Tr; CPn_t35-1.
DR   EnsemblGenomes-Tr; CPn_t36-1.
DR   EnsemblGenomes-Tr; CPn_t37-1.
DR   EnsemblGenomes-Tr; CPn_t38-1.
DR   EnsemblGenomes-Tr; EBT00001567118.
DR   EnsemblGenomes-Tr; EBT00001567119.
DR   EnsemblGenomes-Tr; EBT00001567120.
DR   EnsemblGenomes-Tr; EBT00001567121.
DR   EnsemblGenomes-Tr; EBT00001567122.
DR   EnsemblGenomes-Tr; EBT00001567123.
DR   EnsemblGenomes-Tr; EBT00001567124.
DR   EnsemblGenomes-Tr; EBT00001567125.
DR   EnsemblGenomes-Tr; EBT00001567126.
DR   EnsemblGenomes-Tr; EBT00001567127.
DR   EnsemblGenomes-Tr; EBT00001567128.
DR   EnsemblGenomes-Tr; EBT00001567129.
DR   EnsemblGenomes-Tr; EBT00001567130.
DR   EnsemblGenomes-Tr; EBT00001567131.
DR   EnsemblGenomes-Tr; EBT00001567132.
DR   EnsemblGenomes-Tr; EBT00001567133.
DR   EnsemblGenomes-Tr; EBT00001567135.
DR   EnsemblGenomes-Tr; EBT00001567136.
DR   EnsemblGenomes-Tr; EBT00001567138.
DR   EnsemblGenomes-Tr; EBT00001567139.
DR   EnsemblGenomes-Tr; EBT00001567140.
DR   EnsemblGenomes-Tr; EBT00001567141.
DR   EnsemblGenomes-Tr; EBT00001567142.
DR   EnsemblGenomes-Tr; EBT00001567143.
DR   EnsemblGenomes-Tr; EBT00001567144.
DR   EnsemblGenomes-Tr; EBT00001567146.
DR   EnsemblGenomes-Tr; EBT00001567148.
DR   EnsemblGenomes-Tr; EBT00001567149.
DR   EnsemblGenomes-Tr; EBT00001567150.
DR   EnsemblGenomes-Tr; EBT00001567151.
DR   EnsemblGenomes-Tr; EBT00001567152.
DR   EnsemblGenomes-Tr; EBT00001567153.
DR   EnsemblGenomes-Tr; EBT00001567154.
DR   EnsemblGenomes-Tr; EBT00001567155.
DR   EnsemblGenomes-Tr; EBT00001567156.
DR   EnsemblGenomes-Tr; EBT00001567157.
DR   EnsemblGenomes-Tr; EBT00001567158.
DR   EnsemblGenomes-Tr; EBT00001567160.
DR   EnsemblGenomes-Tr; EBT00001567161.
DR   EnsemblGenomes-Tr; EBT00001567162.
DR   EuropePMC; PMC101494; 10992442.
DR   EuropePMC; PMC1386717; 16423288.
DR   EuropePMC; PMC140015; 12453305.
DR   EuropePMC; PMC1472375; 16672536.
DR   EuropePMC; PMC149699; 12574252.
DR   EuropePMC; PMC2148040; 17880695.
DR   EuropePMC; PMC2168749; 17766419.
DR   EuropePMC; PMC2293240; 18281400.
DR   EuropePMC; PMC2566216; 18708502.
DR   EuropePMC; PMC2576674; 18790867.
DR   EuropePMC; PMC2786552; 19749045.
DR   EuropePMC; PMC2822074; 19961962.
DR   EuropePMC; PMC2830194; 20096108.
DR   EuropePMC; PMC3091639; 20646324.
DR   EuropePMC; PMC3109343; 21687413.
DR   EuropePMC; PMC3152330; 21478170.
DR   EuropePMC; PMC3260263; 22272312.
DR   EuropePMC; PMC3323650; 22506068.
DR   EuropePMC; PMC368364; 15006795.
DR   EuropePMC; PMC4659442; 26636048.
DR   EuropePMC; PMC514725; 15328134.
DR   EuropePMC; PMC5619797; 28957394.
DR   EuropePMC; PMC5884828; 29618824.
DR   EuropePMC; PMC94815; 11092850.
DR   GOA; P56906.
DR   GOA; Q9K1Y4.
DR   InterPro; IPR000352; Pep_chain_release_fac_I.
DR   InterPro; IPR003761; Exonuc_VII_S.
DR   InterPro; IPR004374; PrfB.
DR   InterPro; IPR037004; Exonuc_VII_ssu_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE001363.
DR   SILVA-SSU; AE001363.
DR   UniProtKB/Swiss-Prot; P56906; RF2_CHLPN.
DR   UniProtKB/Swiss-Prot; Q9K1Y4; EX7S_CHLPN.
XX
CC   On or before Jan 26, 2006 this sequence version replaced
CC   gi:4376255, gi:4376263, gi:4376271, gi:4376277, gi:4376288,
CC   gi:4376299, gi:4376311, gi:4376322, gi:4376334, gi:4376341,
CC   gi:4376353, gi:4376357, gi:4376367, gi:4376375, gi:4376387,
CC   gi:4376398, gi:4376409, gi:4376416, gi:4376422, gi:4376438,
CC   gi:4376455, gi:4376464, gi:4376474, gi:4376487, gi:4376502,
CC   gi:4376515, gi:4376529, gi:4376541, gi:4376550, gi:4376562,
CC   gi:4376574, gi:4376584, gi:4376599, gi:4376610, gi:4376620,
CC   gi:4376631, gi:4376641, gi:4376652, gi:4376662, gi:4376677,
CC   gi:4376695, gi:4376708, gi:4376721, gi:4376730, gi:4376734,
CC   gi:4376740, gi:4376750, gi:4376755, gi:4376762, gi:4376771,
CC   gi:4376785, gi:4376794, gi:4376807, gi:4376819, gi:4376831,
CC   gi:4376845, gi:4376855, gi:4376865, gi:4376876, gi:4376888,
CC   gi:4376896, gi:4376910, gi:4376920, gi:4376946, gi:4376963,
CC   gi:4376973, gi:4376985, gi:4376997, gi:4377017, gi:4377031,
CC   gi:4377039, gi:4377047, gi:4377057, gi:4377069, gi:4377081,
CC   gi:4377095, gi:4377104, gi:4377118, gi:4377134, gi:4377147,
CC   gi:4377155, gi:4377164, gi:4377171, gi:4377192, gi:4377199,
CC   gi:4377212, gi:4377226, gi:4377242, gi:4377252, gi:4377265,
CC   gi:4377273, gi:4377283, gi:4377291, gi:4377301, gi:4377311,
CC   gi:4377322, gi:4377330, gi:4377344, gi:4377354, gi:4377366,
CC   gi:4377378, gi:4377389, gi:4377398.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1230230
FT                   /organism="Chlamydia pneumoniae CWL029"
FT                   /strain="CWL029"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:115713"
FT   gene            complement(1..282)
FT                   /locus_tag="CPn_0001"
FT   CDS_pept        complement(1..282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0001"
FT                   /product="CT001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18159"
FT                   /db_xref="GOA:Q9Z9G9"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9G9"
FT                   /protein_id="AAD18159.1"
FT                   /translation="MLGKIIRGLSSLIVILCALNVGLIGITHNKLNIIAKLCGGVSTPA
FT                   TQITYIIIGIAGVICLLSFCPFCSKKSRHSHGDSCSSGGCHSHHSDKN"
FT   gene            573..878
FT                   /gene="gatC"
FT                   /locus_tag="CPn_0002"
FT   CDS_pept        573..878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="CPn_0002"
FT                   /product="Glu-tRNA Gln Amidotransferase (C subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18160"
FT                   /db_xref="GOA:Q9Z9G8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9G8"
FT                   /protein_id="AAD18160.1"
FT                   /translation="MEQFHLDREEILLLAKASALQLSEELIQEYQTSLSAVITSMKEAL
FT                   AIEIDDADSCESLFMHVVNVEDLREDSVTSDFNREEFLRNVPESLGGLVKVPAVIK"
FT   gene            895..2373
FT                   /gene="gatA"
FT                   /locus_tag="CPn_0003"
FT   CDS_pept        895..2373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="CPn_0003"
FT                   /product="Glu tRNA Gln Amidotransferae (A subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18161"
FT                   /db_xref="GOA:Q9Z9G7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9G7"
FT                   /protein_id="AAD18161.1"
FT                   /translation="MYRYSALELAKAVTLGELTATGVTQHFFHRIEEAEGQVGAFISLC
FT                   KEQALEQAELIDKKRSRGEPLGKLAGVPVGIKDNIHVTGLKTTCASRVLENYQPPFDAT
FT                   VVERIKKEDGIILGKLNMDEFAMGSTTLYSAFHPTHNPWDLSRVPGGSSGGSAAAVSAR
FT                   FCPVALGSDTGGSIRQPAAFCGVVGFKPSYGAVSRYGLVAFASSLDQIGPLANTVEDVA
FT                   LMMDVFSGRDPKDATSREFFRDSFMSKLSTEVPKVIGVPRTFLEGLRDDIRENFFSSLA
FT                   IFEGEGTHLVDVELDILSHAVSIYYILASAEAATNLARFDGVRYGYRSPQAHTISQLYD
FT                   LSRGEGFGKEVMRRILLGNYVLSAERQNVYYKKATAVRAKIVKAFRTAFEKCEILAMPV
FT                   CSSPAFEIGEILDPVTLYLQDIYTVAMNLAYLPAIAVPSGFSKEGLPLGLQIIGQQGQD
FT                   QQVCQVGYSFQEHAQIKQLFSKRYAKSVVLGGQS"
FT   gene            2370..3836
FT                   /gene="gatB"
FT                   /locus_tag="CPn_0004"
FT   CDS_pept        2370..3836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="CPn_0004"
FT                   /product="Glu tRNA Gln Amidotransferase B Subunit"
FT                   /note="Pet112"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18162"
FT                   /db_xref="GOA:Q9Z9G6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9G6"
FT                   /protein_id="AAD18162.1"
FT                   /translation="MSAVYADWESVIGLEVHVELNTASKLFSSALNRFGDEPNTNISTV
FT                   CTGLPGSLPVLNQSAVEKAVLFGCAVEGEISLLSRFDRKSYFYPDSPRNFQITQFEHPI
FT                   IRGGRIKAIVQGEERYFELAQTHIEDDAGMLKHFGEFAGVDYNRAGVPLIEIVSKPCMF
FT                   CPEDAVAYATSLVSLLDYIGISDCNMEEGSIRFDVNVSVRPKGSPELRNKVEIKNMNSF
FT                   AFMAQALEAEKQRQIDEYLNQPNKDPKLVIPAATYRWDPEKKKTVLMRLKESAEDYKYF
FT                   PEPDLPTLQLTESYIERIRKTLPELPYDKYHRYIQEYGLSEDIASILISDKNIATFFEV
FT                   ACKDCKNFRSLSNWVTVEFGGRCKTLGVKLPSSGIFPEGVAQLVNAIDQGVITGKIAKE
FT                   IADLMMESPGKNPEEILKEKPELLPMSDEGELQKIIAEVVLANPESIVDYKNGKTKALG
FT                   FLVGQIMKRTAGKAPPKRVNELLLLELDKG"
FT   gene            4127..6895
FT                   /gene="pmp_1"
FT                   /locus_tag="CPn_0005"
FT   CDS_pept        4127..6895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_1"
FT                   /locus_tag="CPn_0005"
FT                   /product="Polymorphic Outer Membrane Protein G Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18163"
FT                   /db_xref="GOA:Q9Z9G5"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9G5"
FT                   /protein_id="AAD18163.1"
FT                   /translation="MRFSLCGFPLVFSFTLLSVFDTSLSATTISLTPEDSFHGDSQNAE
FT                   RSYNVQAGDVYSLTGDVSISNVDNSALNKACFNVTSGSVTFAGNHHGLYFNNISSGTTK
FT                   EGAVLCCQDPQATARFSGFSTLSFIQSPGDIKEQGCLYSKNALMLLNNYVVRFEQNQSK
FT                   TKGGAISGANVTIVGNYDSVSFYQNAATFGGAIHSSGPLQIAVNQAEIRFAQNTAKNGS
FT                   GGALYSDGDIDIDQNAYVLFRENEALTTAIGKGGAVCCLPTSGSSTPVPIVTFSDNKQL
FT                   VFERNHSIMGGGAIYARKLSISSGGPTLFINNISYANSQNLGGAIAIDTGGEISLSAEK
FT                   GTITFQGNRTSLPFLNGIHLLQNAKFLKLQARNGYSIEFYDPITSEADGSTQLNINGDP
FT                   KNKEYTGTILFSGEKSLANDPRDFKSTIPQNVNLSAGYLVIKEGAEVTVSKFTQSPGSH
FT                   LVLDLGTKLIASKEDIAITGLAIDIDSLSSSSTAAVIKANTANKQISVTDSIELISPTG
FT                   NAYEDLRMRNSQTFPLLSLEPGAGGSVTVTAGDFLPVSPHYGFQGNWKLAWTGTGNKVG
FT                   EFFWDKINYKPRPEKEGNLVPNILWGNAVDVRSLMQVQETHASSLQTDRGLWIDGIGNF
FT                   FHVSASEDNIRYRHNSGGYVLSVNNEITPKHYTSMAFSQLFSRDKDYAVSNNEYRMYLG
FT                   SYLYQYTTSLGNIFRYASRNPNVNVGILSRRFLQNPLMIFHFLCAYGHATNDMKTDYAN
FT                   FPMVKNSWRNNCWAIECGGSMPLLVFENGRLFQGAIPFMKLQLVYAYQGDFKETTADGR
FT                   RFSNGSLTSISVPLGIRFEKLALSQDVLYDFSFSYIPDIFRKDPSCEAALVISGDSWLV
FT                   PAAHVSRHAFVGSGTGRYHFNDYTELLCRGSIECRPHARNYNINCGSKFRF"
FT   gene            complement(7138..7293)
FT                   /locus_tag="CPn_0006"
FT   CDS_pept        complement(7138..7293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UL07"
FT                   /protein_id="AAD18164.1"
FT                   /translation="MQEPLRSALLERLSEWLVLLGVPSPETTRSTPEKDANQLPKDSRN
FT                   RTLESL"
FT   gene            7605..10499
FT                   /locus_tag="CPn_0007"
FT   CDS_pept        7605..10499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18165"
FT                   /db_xref="GOA:Q9Z3C8"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z3C8"
FT                   /protein_id="AAD18165.1"
FT                   /translation="MRKLRILAIVLIALSIILIAGGVVLLTVAIPGLSSVISSPAGMGA
FT                   CALGCVMLALGIDVLLKKREVPIVLASVTTTPGTGSPRSGISISGADSTIRSLPTYLLD
FT                   EGHPQSMRKLRILAIVLIVFSIILIASGVVLLTVAIPGLSSVISSPAGMGACALGCVML
FT                   ALGIDVLLKKREVPIVLASVTTTPGTGSPRSGISISGADSTIRSLPTYPLDEGHPQSMR
FT                   KLRILAIVLIVFSIILIASGVVLLTVAIPGLSSIISSPAEMGACALGCVMLALGIDVLL
FT                   KKREVPIVVPAPIPEEVVIDDIDEESIRLQQEAEAALARLPEEMSAFEGYIKVVESHLE
FT                   NMKSLPYDGHGLEEKTKHQIRVVRSSLKAMVPEFLDIRRIFEEEEFFFLSARKRLIDLA
FT                   TTLVERKILTEQLERNNLRKAFSYLYQDSIFKKIIDNFEKLAWKFMILSKSICRFTIIF
FT                   ENHEHGVAKSLLHKNAVLLEKVIYRSLQKSYRDIGMSSAKMKILHGNPFFSLEDNKKTI
FT                   MKEHAEMLESLSSYRKVFLALSDENVVDTPSDPKKWDLSGIPCRDALSEISRDEQWQKK
FT                   AHLKHQESLYTQARDRLTDQSSKENQKELEKAEQEYISSWERVKKFEIERVQERIRAIQ
FT                   KLYPNILEREEETTGQETVTPTVQGTTASSDLTDILGRIEVSSREDNQNQESCVKVLRS
FT                   HEVEMSWEVKQEYGPKKKEFQDQMGSLERFFTEHIEELEVLQKDYSKHLSYFKKVNNKK
FT                   EVQYAKFRLKVLESDLEGILAQTESAESLLTQEELPILATRGALEKAVFKGSLCCALAS
FT                   KAKPYFEEDPRFQDSDTQLRALTLRLQEAKASLEEEIKRFSNLENDIAEERRLLKESKQ
FT                   TFERAGLGVLREIAVESTYDLRSLTNTWEGTPESEKVYFSMYLNYYNEEKRRAKTRLVE
FT                   MTQRYRDFKMALEAMQFNEEALLQEELSIQAPSE"
FT   gene            10975..11688
FT                   /locus_tag="CPn_0008"
FT   CDS_pept        10975..11688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UL11"
FT                   /protein_id="AAD18166.1"
FT                   /translation="MISGLLFLLVRREVPTVRSEEIPRGVSVTPSEEPALEKAQKEPET
FT                   KKILDRLPKELDQLDTYIQEVFACLERLKDPKYEDRGLLTEAKEKLRVFDVVEKDMMSE
FT                   FLDIQRVLNEEAYYVEHCQDPLENIAYEIFSSQELRDYYCAGVCGYLPSGDARADRLKR
FT                   SVKEVMDRFMRVTWKSWEASVMLDHSYGVARELFKKAVGVLEESVYKILFKSYRDAFYE
FT                   CEKAKIQRDGRFKWL"
FT   gene            11815..13122
FT                   /locus_tag="CPn_0009"
FT   CDS_pept        11815..13122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18167"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z3C0"
FT                   /protein_id="AAD18167.1"
FT                   /translation="MWLDRYADKFILREKEEKMERHELFHATMVRKASGHAYAKAKAAF
FT                   EKERSNENQRKVKDVEKWLSKGLAEFRNQESRRARERLRELQTLYPEVSVEERVLERQR
FT                   TKKVNLENLYADIEKKYHHCVREQEHYWKEVENKEAEYRENGEKVLSAEEVSECLQRLE
FT                   DCLETWSKKLTKAEESVFEMKFDATEKLGNKVLSDVTNRLEILCEDAEEMIFRIEEIEM
FT                   TLRMVELPLLFMKNTFEKASLQYNSCKEMLAKVEPQCKESPTYRSSQERLERLNQDLQT
FT                   AYTNCQERLQGFSDLESKVRTCRDHLREQMKHFEVQGLNFINEELLWVGAELFTQARLD
FT                   LVATVPYMEFYLQYHNIKREKVRSQWMAKTERYREIRQAFQGVMKEDLLAEDTILKEED
FT                   YWLLRDDWLLRDERKNRQRRLICNKIAAAQQRVKGF"
FT   gene            13435..14328
FT                   /locus_tag="CPn_0010"
FT   CDS_pept        13435..14328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18168"
FT                   /db_xref="GOA:Q9Z3B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z3B1"
FT                   /protein_id="AAD18168.1"
FT                   /translation="MLLLISGALFLTLGIPGLSAAISFGLGIGLSALGGVLMISGLLCL
FT                   LVKREIPTVRPEEIPEGVSLAPSEEPALQAAQKTLAQLPKELDQLDTDIQEVFACLRKL
FT                   KDSKYESRSFLNDAKKELRVFDFVVEDTLSEIFELRQIVAQEGWDLNFLINGGRSLMMT
FT                   AESESLDLFHVSKRLGYLPSGDVRGEGLKKSAKEIVARLMSLHCEIHKVAVAFDRNSYA
FT                   MAEKAFAKALGALEESVYRSLTQSYRDKFLESERAKIPWNGHITWLRDDAKSGCAEKKL
FT                   GMPRNVGRNLGKQSFG"
FT   gene            14379..15749
FT                   /locus_tag="CPn_0010.1"
FT   CDS_pept        14379..15749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0010.1"
FT                   /product="frame-shift with CPn0010"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0010.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18169"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UL13"
FT                   /protein_id="AAD18169.1"
FT                   /translation="MLDPYRQERMDEITFHELYEKTTFLKRLHRKCALAKTTFEKKRSK
FT                   KNLQAVEEANARRLKYVRDWYDQEFQKAGERLEKLHALYPEVSVSIRENKIQETRSNLE
FT                   KAYEAIEENYRCCVREQEDYWKEEEKREAEFRERGNKILSPEELESSLEQFDHGLKNFS
FT                   EKLMELEGHILKLQKEATAEVENKILSDAESRLEIVFEDVKEMPCRIEEIEKTLRMAEL
FT                   PLLPTKKAFEKACSQYNSCAEMLEKVKPYCKESLAYVTSKERLVSLDEDLRRAYTECQK
FT                   RFQGDSGLESEVRACREQLRERIQEFETQGLDLVEKELLCVSSRLRNTECDCVSGVKKE
FT                   APPGKKFYAQYYDEIYRVRVQSRWMTMSERLREGVQACNKMLKAGLSEEDKVLKEEEYW
FT                   LYREERKNKEKRLVGTKIVATQQRIQEFQPSDIVESSNEKVSLMDKARFLFNREDHS"
FT   gene            15892..16617
FT                   /locus_tag="CPn_0011"
FT   CDS_pept        15892..16617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18170"
FT                   /db_xref="GOA:Q9Z382"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z382"
FT                   /protein_id="AAD18170.1"
FT                   /translation="MTAAPAILHVSPTPPEETKFVIPKDSKSRALGITLLVVGILLVVC
FT                   GAIVLSGVISGLSALIVCGLGISTISLGVVLFVLGLILLLRKRELTLEQIEAKQIAETF
FT                   ADELKELEMYIQSTEKSLEKIEGSRYSDQGFLNRATQKILDLESSLSSITSEFRDLRQL
FT                   FDEEKIELLSGERLLEFIAANLFKQGRDVYLNLGNLADIRAYMGPNNYKVAMVIEKAKA
FT                   VVHEFIVLTTMARELEFFF"
FT   gene            16644..18215
FT                   /locus_tag="CPn_0012"
FT   CDS_pept        16644..18215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18171"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9G2"
FT                   /protein_id="AAD18171.1"
FT                   /translation="MYQENLRLLERLLYNSVQKSYADRLFSYEKTKMVHDTPLIPWEED
FT                   KEKCAEAEKAFLEQQKILLDYGKSIFWLNENDEINLNDPWSWGLNTVRTRKVFQEVDDS
FT                   ERWNHKVLIQKLEDDYEKLLEESSKESTEANKKLLSDLVDRLEDAKTKFFLKKQEEVET
FT                   RVKDLRARYGGTVDPKQDTEAKKKVELEASLETFLDSIESELVQCLEDQDIYWKEQDVK
FT                   DLARTQELEEQDIEAKREEAAEDLRSLNERLKKSKTMLDRAKWHIENAEDSITWWTSQI
FT                   EMKDMKARLKILKEDITSVLPEIDEIETCLSLEELPLLTTRELLTKSYLKFKICSETLL
FT                   KMTSVFENNIYVQEYEVQLQNLGFKLQGISQRFGKKQDDFANLEEQVALQKKRLRELTQ
FT                   NFEIQGFNFMKEDFKAAAKDLYIRSTAEQKMNFDVPCMELFRRYHEEVNKPLLELMYNC
FT                   ADSYRDAKKKLCSLRLDEKELLQKEIKKEEFYQKKQQRHADRSRHTTYQKLRIAEELAL
FT                   ELKKKI"
FT   gene            18584..21109
FT                   /gene="pmp_2"
FT                   /locus_tag="CPn_0013"
FT   CDS_pept        18584..21109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_2"
FT                   /locus_tag="CPn_0013"
FT                   /product="Polymorphic Outer Membrane Protein G Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18172"
FT                   /db_xref="GOA:Q9Z3A1"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z3A1"
FT                   /protein_id="AAD18172.1"
FT                   /translation="MKIPLRFLLISLVPTLSMSNLLGAATTEELSASNSFDGTTSTTSF
FT                   SSKTSSATDGTNYVFKDSVVIENVPKTGETQSTSCFKNDAAAGDLNFLGGGFSFTFSNI
FT                   DATTASGAAIGSEAANKTVTLSGFSALSFLKSPASTVTNGLGAINVKGNLSLLDNDKVL
FT                   IQDNFSTGDGGAINCAGSLKIANNKSLSFIGNSSSTRGGAIHTKNLTLSSGGETLFQGN
FT                   TAPTAAGKGGAIAIADSGTLSISGDSGDIIFEGNTIGATGTVSHSAIDLGTSAKITALR
FT                   AAQGHTIYFYDPITVTGSTSVADALNINSPDTGDNKEYTGTIVFSGEKLTEAEAKDEKN
FT                   RTSKLLQNVAFKNGTVVLKGDVVLSANGFSQDANSKLIMDLGTSLVANTESIELTNLEI
FT                   NIDSLRNGKKIKLSAATAQKDIRIDRPVVLAISDESFYQNGFLNEDHSYDGILELDAGK
FT                   DIVISADSRSIDAVQSPYGYQGKWTINWSTDDKKATVSWAKQSFNPTAEQEAPLVPNLL
FT                   WGSFIDVRSFQNFIELGTEGAPYEKRFWVAGISNVLHRSGRENQRKFRHVSGGAVVGAS
FT                   TRMPGGDTLSLGFAQLFARDKDYFMNTNFAKTYAGSLRLQHDASLYSVVSILLGEGGLR
FT                   EILLPYVSKTLPCSFYGQLSYGHTDHRMKTESLPPPPPTLSTDHTSWGGYVWAGELGTR
FT                   VAVENTSGRGFFQEYTPFVKVQAVYARQDSFVELGAISRDFSDSHLYNLAIPLGIKLEK
FT                   RFAEQYYHVVAMYSPDVCRSNPKCTTTLLSNQGSWKTKGSNLARQAGIVQASGFRSLGA
FT                   AAELFGNFGFEWRGSSRSYNVDAGSKIKF"
FT   misc_feature    21392..24177
FT                   /note="Polymorphic Outer Membrane Protein G Family;
FT                   contains frame shift"
FT   gene            21392..21925
FT                   /gene="pmp_3.1"
FT                   /locus_tag="CPn_0014"
FT   gene            21835..24177
FT                   /gene="pmp_3.2"
FT                   /locus_tag="CPn_0015"
FT   misc_feature    24416..27173
FT                   /note="Polymorphic Outer Membrane Protein G Family;
FT                   contains frame shift"
FT   gene            24416..26191
FT                   /gene="pmp_4.1"
FT                   /locus_tag="CPn_0016"
FT   gene            26094..27173
FT                   /gene="pmp_4.2"
FT                   /locus_tag="CPn_0017"
FT   misc_feature    27522..30359
FT                   /note="Polymorphic Outer Membrane Protein G Family;
FT                   contains frame shift"
FT   gene            27522..29006
FT                   /gene="pmp_5.1"
FT                   /locus_tag="CPn_0018"
FT   gene            29007..30359
FT                   /gene="pmp_5.2"
FT                   /locus_tag="CPn_0019"
FT   gene            complement(30600..32687)
FT                   /locus_tag="CPn_0020"
FT   CDS_pept        complement(30600..32687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0020"
FT                   /product="Predicted OMP"
FT                   /note="contains leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X0U0"
FT                   /protein_id="AAD18173.1"
FT                   /translation="MKRCFLFLASFVLMGSSADALTHQEAVKKKNSYLSHFKSVSGIVT
FT                   IEDGVLNIHNNLRIQANKVYVENTVGQSLKLVAHGNVMVNYRAKTLVCDYLEYYEDTDS
FT                   CLLTNGRFAMYPWFLGGSMITLTPETIVIRKGYISTSEGPKKDLCLSGDYLEYSSDSLL
FT                   SIGKTTLRVCRIPILFLPPFSIMPMEIPKPPINFRGGTGGFLGSYLGMSYSPISRKHFS
FT                   STFFLDSFFKHGVGMGFNLHCSQKQVPENVFNMKSYYAHRLAIDMAEAHDRYRLHGDFC
FT                   FTHKHVNFSGEYHLSDSWETVADIFPNNFMLKNTGPTRVDCTWNDNYFEGYLTSSVKVN
FT                   SFQNANQELPYLTLRQYPISIYNTGVYLENIVECGYLNFAFSDHIVGENFSSLRLAARP
FT                   KLHKTVPLPIGTLSSTLGSSLIYYSDVPEISSRHSQLSAKLQLDYRFLLHKSYIQRRHI
FT                   IEPFVTFITETRPLAKNEDHYIFSIQDAFHSLNLLKAGIDTSVLSKTNPRFPRIHAKLW
FT                   TTHILSNTESKPTFPKTACELSLPFGKKNTVSLDAEWIWKKHCWDHMNIRWEWIGNDNV
FT                   AMTLESLHRSKYSLIKCDRENFILDVSRPIDQLLDSPLSDHRNLILGKLFVRPHPCWNY
FT                   RLSLRYGWHRQDTPNYLEYQMILGTKIFEHWQLYGVYERREADSRFFFFLKLDKPKKPP
FT                   F"
FT   gene            complement(32704..34410)
FT                   /locus_tag="CPn_0021"
FT   CDS_pept        complement(32704..34410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0021"
FT                   /product="Predicted OMP"
FT                   /note="contains leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18174"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9G0"
FT                   /protein_id="AAD18174.1"
FT                   /translation="MGLFHLTLFGLLLCSLPISLVAKFPESVGHKILYISTQSTQQALA
FT                   TYLEALDAYGDHDFFVLRKIGEDYLKQSIHSSDPQTRKSTIIGAGLAGSSEALDVLSQA
FT                   METADPLQQLLVLSAVSGHLGKTSDDLLFKALASPYPVIRLEAAYRLANLKNTKVIDHL
FT                   HSFIHKLPEEIQCLSAAIFLRLETEESDAYIRDLLAAKKSAIRSATALQIGEYQQKRFL
FT                   PTLRNLLTSASPQDQEAILYALGKLKDGQSYYNIKKQLQKPDVDVTLAAAQALIALGKE
FT                   EDALPVIKKQALEERPRALYALRHLPSEIGIPIALPIFLKTKNSEAKLNVALALLELGC
FT                   DTPKLLEYITERLVQPHYNETLALSFSKGRTLQNWKRVNIIVPQDPQERERLLSTTRGL
FT                   EEQILTFLFRLPKEAYLPCIYKLLASQKTQLATTAISFLSHTSHQEALDLLFQAAKLPG
FT                   EPIIRAYADLAIYNLTKDPEKKRSLHDYAKKLIQETLLFVDTENQRPHPSMPYLRYQVT
FT                   PESRTKLMLDILETLATSKSSEDIRLLIQLMTEGDAKNFPVLAGLLIKIVE"
FT   gene            complement(34392..34982)
FT                   /gene="maf"
FT                   /locus_tag="CPn_0022"
FT   CDS_pept        complement(34392..34982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="CPn_0022"
FT                   /product="Maf-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18175"
FT                   /db_xref="GOA:Q9Z9F9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F9"
FT                   /protein_id="AAD18175.1"
FT                   /translation="MSLPLVLGSSSPRRKFILEKFRVPFTVIPSNFDESKVSYSGDPIA
FT                   YTQELAAQKAYAVSELHSPCDCIILTGDTIVSYDGRIFTKPQDKADAIQMLKTLRNQTH
FT                   DVVTSIAVLHKGKLLTGSETSQISLTMIPDHRIESYIDTVGTLNNCGAYDVCHGGLILK
FT                   KVHGCVYNVQGLPIQTLKYLLEELNIDLWDYSI"
FT   gene            complement(35011..36603)
FT                   /gene="yjjK"
FT                   /locus_tag="CPn_0023"
FT   CDS_pept        complement(35011..36603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjjK"
FT                   /locus_tag="CPn_0023"
FT                   /product="ABC Transporter Protein ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18176"
FT                   /db_xref="GOA:Q9Z9F8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9F8"
FT                   /protein_id="AAD18176.1"
FT                   /translation="MSIVLDKIGKSLGTRILFDDVSVVFNPGNCYGLTGPNGAGKSTLL
FT                   KIIMGMIEPTRGSISLPKKVGILRQNIDSFHDTTVLDCVIMGNTRLWEALQRRDNLYLQ
FT                   EFTDAIGMELGEIEEIIGEENGYRADSEAEELLTGIGIPNEMFDKKMAMIPIDLQFRVL
FT                   LCQALFGHPEALLLDEPTNHLDLYSINWLGNFLKDYEGTVIVVSHDRHFLNTITTHIAD
FT                   IDYDTIIIYPGNYDDMVEMKTASREQEKADIKSKEKKISQLKEFVAKFGAGSRASQVQS
FT                   RLREIKKLQPQELKKSNIQRPYIRFPLSDKSSGKVVLSLEAITKDYGDHQVIHPFSLEI
FT                   YQGDKLGIIGNNGLGKTTLMKLLAGVEAPSSGSIKLGHQAICSYFPQNHSDVLADCGQE
FT                   TLFEWLRNRKTGINDQEIRSVLGKMLFGGDDAFKQIQALSGGETARLLMAGMMLENHNV
FT                   LILDEANNHLDLESVSALSWAINDYKGTAIFVSHDRGLIQDCATKLLIFDKDKITFFDG
FT                   TMVDYTAGHKQLL"
FT   gene            complement(36658..37596)
FT                   /gene="xerC"
FT                   /locus_tag="CPn_0024"
FT   CDS_pept        complement(36658..37596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="CPn_0024"
FT                   /product="Integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18177"
FT                   /db_xref="GOA:Q9Z9F7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F7"
FT                   /protein_id="AAD18177.1"
FT                   /translation="MIASIYSFLDYLKMVKSASPHTLRNYCLDLNGLKIFLEERGNLAP
FT                   SSPLQLATEKRKVSELPFSLFTKEHVRMYIAKLIENGKAKRTIKRCLSSIKSFAHYCVI
FT                   QKILLENPAETIHGPRLPKELPSPMTYAQVEVLMATPDISKYHGLRDRCLMELFYSSGL
FT                   RISEIVAVNKQDFDLSTHLIRIRGKGKKERIIPVTSNAIQWIQIYLNHPDRKRLEKDPQ
FT                   AIFLNRFGRRISTRSIDRSFQEYLRRSGLSGHITPHTIRHTIATHWLESGMDLKTIQAL
FT                   LGHSSLETTTVYTQVSVKLKKQTHQEAHPHA"
FT   gene            complement(37681..38604)
FT                   /gene="atsA"
FT                   /locus_tag="CPn_0025"
FT   CDS_pept        complement(37681..38604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsA"
FT                   /locus_tag="CPn_0025"
FT                   /product="Sulphohydrolase/Glycosulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18178"
FT                   /db_xref="GOA:Q9Z9F6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F6"
FT                   /protein_id="AAD18178.1"
FT                   /translation="MSSRELIILGCSSQQPTRTRNQGAYLFRWNGEGLLFDPGEGTQRQ
FT                   FIFANIAPTTVNRIFVSHFHGDHCLGLGSMLMRLNLDKVSHPIHCYYPASGKKYFDRLR
FT                   YGTIYHETIQVVEHPISEEGIVEDFGSFRIEAQRLQHQVDTLGWRITEPDTIKFLPKEL
FT                   ESRGIRGLIIQDLIRDQEISIGGSTVYLSDVSYVRKGDSIAIIADTLPCQAAIDLAKNS
FT                   CMMLCESTYLEQHRHLAESHFHMTAKQAATLAKRAATQKLILTHFSARYLNLDDFYKEA
FT                   SAVFPNVSVAQEYRSYPFPKNPLLNK"
FT   gene            complement(38759..39625)
FT                   /locus_tag="CPn_0026"
FT   CDS_pept        complement(38759..39625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0026"
FT                   /product="CT345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18179"
FT                   /db_xref="GOA:A0A0F7XEB8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XEB8"
FT                   /protein_id="AAD18179.1"
FT                   /translation="MSHLIPSLRNSVTSYFHKPQPIKQAAPSKSIRDICNIAYLIIICV
FT                   LVVVVLVGAMLCMFIPSVGIPLCLSSLALLVLLSIFNPCLINWISTKKTKEIAPKDASE
FT                   SQPTKSASRKGSPQLSPHHDHEPKNFIRTQLEKGVNYVTNKFKSGEESPHISDEHHSPR
FT                   QSKRSSEIESSDESSPELHRKAKGKAPHTATTKESKTSTTESSKKKKKTKHSLHRTTSS
FT                   IHKRSAPKPMVPSKKRKPVLLKKTVPLPIEDLEHQSSGNESSDSSSPPPVQRKAILPWF
FT                   CKQPTDP"
FT   gene            complement(39775..42234)
FT                   /gene="lon"
FT                   /locus_tag="CPn_0027"
FT   CDS_pept        complement(39775..42234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="CPn_0027"
FT                   /product="Lon ATP-dependent Protease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18180"
FT                   /db_xref="GOA:Q9Z9F4"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F4"
FT                   /protein_id="AAD18180.1"
FT                   /translation="MDSTTNSDSPILDPNPEDVEKLLDESEEESEDQSTERLLPSELFI
FT                   LPLNKRPFFPGMAAPILIESGPYYEVLKVLAKSSQKYIGLVLTKKENADILKVSFNQLH
FT                   KTGVAARILRIMPIEGGSAQVLLSIEERIRIIEPIKDKYLKARVSYHADNKELTEELKA
FT                   YSISIVSVIKDLLKLNPLFKEELQIFLGHSDFTEPGKLADFSVALTTATREELQEVLET
FT                   TNMHDRIDKALILLKKELDLSRLQSSINQKIEATITKSQKEFFLKEQLKTIKKELGLEK
FT                   EDRAIDIEKFSERLRKRHVPDYAMEVIQDEIEKLQTLETSSAEYTVCRNYLDWLTIIPW
FT                   GIQSKEYHDLKKAEIVLNKDHYGLDEIKQRILELISVGKLSKGLKGSIICLVGPPGVGK
FT                   TSIGRSIAKVLHRKFFRFSVGGMRDEAEIKGHRRTYIGAMPGKMVQALKQSQAMNPVIM
FT                   IDEVDKIGASYHGDPASALLEVLDPEQNKDFLDHYLDVRVDLSNVLFILTANVLDTIPD
FT                   PLLDRMEILRLSGYILEEKLQIAKKYLVPKARKEIGLTASEVNFQPEALKYMINNYARE
FT                   AGVRTLNGNIKKVLRKVALKIVQNQEKPKSKKITFKISSKNLQTYLGKPIFSSDRFYES
FT                   TPVGVATGLAWTSLGGATLYIESVQVSSLKTDMHLTGQAGEVMKESSQIAWTYLHSALH
FT                   RYAPGYTFFPKSQVHIHIPEGATPKDGPSAGITMVTSLLSLLLETPVVNNLGMTGEITL
FT                   TGRVLGVGGIREKLIAARRSRLNILIFPEDNRRDYEELPAYLKTGLKIHFVSHYDDVLK
FT                   VAFPKLK"
FT   gene            complement(42540..43325)
FT                   /locus_tag="CPn_0028"
FT   CDS_pept        complement(42540..43325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18181"
FT                   /db_xref="GOA:Q9Z9F3"
FT                   /db_xref="InterPro:IPR006974"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9F3"
FT                   /protein_id="AAD18181.1"
FT                   /translation="MFLQFFHPIVFSDQSLSFLPYLGKSSGIIEKCSNIVEHYLHLGGD
FT                   TSVIITGVSGATFLSVDHALPISKSEKIIKILSYILILPLILALFIKIVLRIILFFKYR
FT                   GLILDVKKEDLKKTLTPDQENLSLPLPSPTTLKKIHALHILVRSGKTYNELIQEGFSFT
FT                   KITDLGQAPSPKQDIGFSYNSLLPNFYFHSLVSVPNISGEERALNYHKEQQEEMAVKLK
FT                   TMQACSFVFRSLHLPSMQTKDKKAGFGLLTFFPWKIYPL"
FT   gene            complement(43387..43755)
FT                   /locus_tag="CPn_0029"
FT   CDS_pept        complement(43387..43755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WD86"
FT                   /protein_id="AAD18182.1"
FT                   /translation="MNDGLRFCYSYILLRPMLLDSSLLRKGGQELLKKFQIKLRTTSIK
FT                   SSLISLRQQLGKREATQSDILYGTSRFQYLNSFEIEDPRIPPTMAAQLQEITWSRSVME
FT                   LKIKFYVYLNSERNKTKP"
FT   gene            43891..44532
FT                   /gene="gcp_1"
FT                   /locus_tag="CPn_0030"
FT   CDS_pept        43891..44532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp_1"
FT                   /locus_tag="CPn_0030"
FT                   /product="O-Sialoglycoprotein Endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18183"
FT                   /db_xref="GOA:Q9Z9F1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9F1"
FT                   /protein_id="AAD18183.1"
FT                   /translation="MYFYKYVIIDTSGYYPFLACVDNQQVLEHWSLPVGPDLGIVLEFL
FT                   FKSKNLSFQGVAVALGPGNFSATRIGISFAQGLAMAKNVPLLGYSSLEGYLLSKDEKKA
FT                   LMLPLGKRGGVLTLSSEIPEEGLNEKRRGVGPGALLSYEEASDYCVAHGYYHVISPNPQ
FT                   LFASSFSDKITVEEVAPSVEQIRRHVISQFMFVEYDKQLSPDYRSYSCIF"
FT   gene            44711..44887
FT                   /gene="rs21"
FT                   /locus_tag="CPn_0031"
FT   CDS_pept        44711..44887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs21"
FT                   /locus_tag="CPn_0031"
FT                   /product="S21 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18184"
FT                   /db_xref="GOA:Q9Z9F0"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F0"
FT                   /protein_id="AAD18184.1"
FT                   /translation="MPSVKVRVGEPVDRALRILKKKIDKEGILKAAKSHRFYDKPSVKK
FT                   RAKSKAAAKYRSR"
FT   gene            44923..46101
FT                   /gene="dnaJ"
FT                   /locus_tag="CPn_0032"
FT   CDS_pept        44923..46101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="CPn_0032"
FT                   /product="Heat Shock Protein J"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18185"
FT                   /db_xref="GOA:Q9Z9E9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9E9"
FT                   /protein_id="AAD18185.1"
FT                   /translation="MDYYSILGISKTASAEEIKKAYRKLAVKYHPDKNPGDAAAEKRFK
FT                   EVSEAYEVLSDPQKRDSYDRFGKDGPFAGAGGFGGAGGMGNMEDALRTFMGAFGGEFGG
FT                   GSFFDGLFGGLGEAFGMRSDPAGARQGASKKVHINLTFEEAAHGVEKELVVSGYKSCET
FT                   CSGQGAVNPQGIKSCERCKGSGQVVQSRGFFSMASTCPECGGEGRIITDPCSSCRGQGR
FT                   VKDKRSVHVHIPAGVDSGMRLKMEGYGDAGQNGAPSGDLYVFIDVESHPVFERRGDDLI
FT                   LELPIGFVDAALGMKKEIPTLLKTEGSCRLTVPEGIQSGTILKVRNQGFPNVHGKGRGD
FT                   LLVRISVETPQNLSEEQKELLRTFASTEKAENFPKKRSFLDKIKGFFSDFTV"
FT   gene            46138..48174
FT                   /gene="pdhA/pdhB"
FT                   /locus_tag="CPn_0033"
FT   CDS_pept        46138..48174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA/pdhB"
FT                   /locus_tag="CPn_0033"
FT                   /product="(pyruvate) Oxoisovalerate Dehydrogenase
FT                   Alpha/Beta Fusion"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18186"
FT                   /db_xref="GOA:Q9Z9E8"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9E8"
FT                   /protein_id="AAD18186.1"
FT                   /translation="MGVVQNQVISSIRDVLKLVWELRFAEHKMLLLSRQSGSGGTFQLS
FT                   CAGHELAGVLAGKSLIPGKDWSFPYYRDQGFPIGLGCDLSEIFASFLARTTPNHSSARM
FT                   MPYHYSHKKLRICCQSSVVGTQFLQAAGRAWAVKHSSADEVVYVSGGDGATSQGEFHEM
FT                   LNFVALHQLPLITVIQNNHWAISVPFEDQCGADLASLGRCHQGLAVYEVDGGNYTSLTE
FT                   TFSHAVDQARQHSVPALILIDVVRLSSHSNSDNQEKYRSALDLKLSMDKDPLILLEKEA
FT                   INVFGLSPFEIEEIKAEAQEEVRKSCEIAEALPFPSKGSTSHEVFSPYTETLIDYENSE
FT                   SAQNLRNSEPKVMRDAISEALVEEMTRDSGVIVFGEDVAGDKGGVFGVTRNLTEKFGPQ
FT                   RCFNSPLAEATIIGTAIGMALDGIHKPVVEIQFADYIWPGINQLFSEASSIYYRSAGEW
FT                   EVPLVIRAPSGGYIQGGPYHSQSIEGFLAHCPGIKVAYPSNAADAKALLKAAIRDPNPV
FT                   VFLEHKALYQRRIFSACPVFSHDYVLPFGKAAIVHPGKDLTIVSWGMPLVLSLEVAQEL
FT                   ASRGISIEVIDLRTMVPCDFATVLKSLEKTGRLLVIHEASEFCGFGSELVATMSEQGYA
FT                   YLDAPIRRLGGLHAPVPYSKVLENEVLPHKESILQAAKSLAEF"
FT   gene            complement(48207..49457)
FT                   /locus_tag="CPn_0034"
FT   CDS_pept        complement(48207..49457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18187"
FT                   /db_xref="GOA:A0A0F7WKN4"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WKN4"
FT                   /protein_id="AAD18187.1"
FT                   /translation="MAEISTPSLPDSSIVSQKTPPVPDPDSSPDHIPTIPTQAPFKPQR
FT                   KKETPSSIVNAIAFAILAFLSCLGGVFAICLGCSLEITMPLFILTAVFIAFTLLYFIHY
FT                   LEKPKIPEPLPTPPPSPTLRAPTLTPEIPAPAPGIPLPPTLPKVDRTKLTCNPDIHYPS
FT                   TYDPKACFSLLKQLFSLDPETRPEDRKYSNKLASILLRSKEKSGFRFHCFKGHFSHDKI
FT                   LNKKSGAVVISSHSSMDFSTTLGRAFAVTTCLQRSCWEKIKNNIPTPEKHLPIGSCVSG
FT                   PWDVEEGAQLYTSHLIVINPPTLETLIKEKMRRAITLKDFSMKEAFTNLVLAYLQCFDI
FT                   CIEHNLESVQLEVFGLNNLSADQEEFTTWESCCHLALLESVRILLASKEEYALSNVSVN
FT                   SISQVPLQTACRALFLN"
FT   gene            complement(49566..51029)
FT                   /locus_tag="CPn_0035"
FT   CDS_pept        complement(49566..51029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0035"
FT                   /product="CT339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18188"
FT                   /db_xref="GOA:A0A0F7XC16"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XC16"
FT                   /protein_id="AAD18188.1"
FT                   /translation="MWNRCQVFSSFFFRYPISSWLIRLRASCECFQQRHPIFLCGLYWL
FT                   AGITSRGHPECSALILIFLGMFLPRNPKQWLPLASAWIISLMLTPAPFLHDGPISGTFV
FT                   IHHAGGQGTYYGEALCIQTPCGKRAHHLSCQILSESRLELKKVYELEGTLHHTSQIVFK
FT                   SNACYKEIPRSRFYIMKEKCRESSCHFLNHRFPSSEVGPFASSLLLGTPLPQNLRDLFR
FT                   QKGLSHLFAISGWHFSLCATTLWMLCALLPLKIKKILSFIVLTSLACIFPMSLSVWRSW
FT                   ISVTLLCFSWCFSGSCSGLNRLGAGFILCSIFFSPFSPTFVLSFLATLGILLFFPKIFS
FT                   FLYTPWTQFLSPFWLYPIRYLAMTLAISLSAQLFIVLPIMQYFGSLPLEGLLYNLIVPF
FT                   TILPIIVFLIATIILPCCSPITEALIQGFLSHPWLHNPNILKTLSFAPVPPWMLTLASL
FT                   ILFFIGILRTNVSPYASISATSYRFIETL"
FT   gene            51002..51799
FT                   /locus_tag="CPn_0036"
FT   CDS_pept        51002..51799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0036"
FT                   /product="CT338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WHW5"
FT                   /protein_id="AAD18189.1"
FT                   /translation="MKKPDNDSTFDVRSFFPFDVLCIEQLRKEMSWEVVSAKIPRLPRG
FT                   WYELMGLSKEDRIDFCLDFWCSVLGIEHKESPSICRFFSLLETIEVYIYRLEKEPYQLK
FT                   MFYVFRDGRCGFQGEPPLLDFLGHHRLPPLGDRHYEKFFSIHNGFGKWEDEGIFPMRSL
FT                   AKVQQKLRQQLVVMNKMQAEDNCYSLGIFPFYGYEEPFAYQSFFFDPEIRRDLPSPNVL
FT                   LNEESLEHRSLETIELLHLSKSYYPSFLSWLENYLHSEEVYNE"
FT   gene            51792..52118
FT                   /gene="ptsH"
FT                   /locus_tag="CPn_0037"
FT   CDS_pept        51792..52118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="CPn_0037"
FT                   /product="PTS Phosphocarrier Protein Hpr"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18190"
FT                   /db_xref="GOA:Q9Z9E4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9E4"
FT                   /protein_id="AAD18190.1"
FT                   /translation="MNEPTRTYLESEKDTQDQIEELQATCIVKNAAGIHVRPAGVIVRL
FT                   FDGEPCDVHFTYAGKTINAKSIMSILMLGAPQGGEILVTIRSKEAHRILQKIQDAFSSG
FT                   FGEL"
FT   gene            52119..53834
FT                   /gene="ptsI"
FT                   /locus_tag="CPn_0038"
FT   CDS_pept        52119..53834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="CPn_0038"
FT                   /product="PTS PEP Phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18191"
FT                   /db_xref="GOA:Q9Z9E3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9E3"
FT                   /protein_id="AAD18191.1"
FT                   /translation="MDTQSSTGNEEWRIAGTSIVSGMALGKVFFLGTSPLHVRELTLPQ
FT                   EEVEHEIHRYYKALNRSKSDIVALEQEVTGQQGLQEVSSILQAHLEIMKDPLLTEEVVN
FT                   TIRKDRKNAEYVFSSVMGKIEESLTAVRGMPSVVDRVQDIHDISNRVIGHLCCQHKSSL
FT                   GESDQNLIIFSEELTPSEVASANSAYIRGFVSLVGAATSHTAIVSRAKSIPYLANISEE
FT                   LWNIAKRYNGKLVLIDGYRGELIFNPKPATLQSCYKKELSVVAHTSQRLVRKSLHPIVS
FT                   SHAGSDKDVEDLLENFPQTSIGLFRSEFLAVILGRLPTLREQVDLYEKLARFPGDSPSV
FT                   LRLFDFGEDKPCPGIKNKKERSIRWLLDYSVILEDQLQAIAKASLQGSIKVLIPGVSDV
FT                   SEIIEVKKKWETIRTRFPKGHKVSWGTMIEFPSAVWMIEEILPECDFLSIGTNDLVQYT
FT                   LGISRESALPKHLNVTLPPAVIRMIHHVLQAAKQNQVPVSICGEAAGQLSLTPLFIGLG
FT                   VQELSVAMPVINRLRNHIALLELNSCLEITEALLQAKTCSEVEELLNRNNKITS"
FT   gene            complement(53960..54250)
FT                   /gene="ybaB"
FT                   /locus_tag="CPn_0039"
FT   CDS_pept        complement(53960..54250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="CPn_0039"
FT                   /product="YbaB family hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18192"
FT                   /db_xref="GOA:Q9Z9E2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9E2"
FT                   /protein_id="AAD18192.1"
FT                   /translation="MGSGYAKKKKEAKIMEQQFLEMEASLLEKRYEGQAGNGLVSVVIN
FT                   GKCDLISVKVQPTCLDPEDPEVIEDLFRAAFKLAKEQMDQEMSLMRSTMPF"
FT   gene            complement(54315..55643)
FT                   /gene="dnaX_1"
FT                   /locus_tag="CPn_0040"
FT   CDS_pept        complement(54315..55643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX_1"
FT                   /locus_tag="CPn_0040"
FT                   /product="DNA Polymerase III Gamma and Tau"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18193"
FT                   /db_xref="GOA:Q9Z9E1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9E1"
FT                   /protein_id="AAD18193.1"
FT                   /translation="MTLQPYQASSRKYRPQIFREILGQSSVVAVLKNALVFNRAAHAYL
FT                   FSGIRGTGKTTLARILAKALNCVHLSEDGEPCNQCFSCKEIASGSSLDVLEIDGASHRG
FT                   IEDIRQINETVLFTPVKAKFKIYIIDEVHMLTKEAFNALLKTLEEPPQHVKFFFATTEI
FT                   HKIPGTILSRCQKMHLQRIPEKTILEKLSLMAQDDHIEASQEALAPIARAAQGSLRDAE
FT                   SLYDYVISLFPKSLSPDTVAQALGFASQDSLRTLDNAILQRDYATALGIVTDFLNSGVA
FT                   PVTFLHDLTLFYRNLLLTNSTTSKFSSQYKTEQLLEIIDFLGESAKHLQNTIFEQTFLE
FT                   TVIIHIIRIYQRPVLSELISSIKSRQFEGLRNIKEPTLTQQVSAPQPQPTYKEQSFLEK
FT                   KNQPAAEGKIISVEVKSSASIKSAAVDTLLQFAVVEFSGILRQ"
FT   gene            55996..57345
FT                   /locus_tag="CPn_0041"
FT   CDS_pept        55996..57345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18194"
FT                   /db_xref="GOA:A0A0F7XAU0"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XAU0"
FT                   /protein_id="AAD18194.1"
FT                   /translation="MLLLISGALFLTLGIPGLTAGVSFGLGIGLSALGGVLVVSGLLCL
FT                   LVKREVSKVCPEEIPAVQPEETPEGVPVTPFEKPALDEAQKEQKTQKILDQLPQELDQL
FT                   DRYIQEAFACLGPLKDLKYEDQGFLQDVKEEFQVFDFVQKDMIAEFVELQQILCQEGRL
FT                   LEFVINQTRYIGRDLFKREDSLYKLWEWLGYLPSGDVRGERLKKSAREVVDRFMRTTCN
FT                   IRKIAMTFDRHVYSVAKTAFEKAFGALETCVYESMRESYREAFCEYEKAKLLGDEEKSA
FT                   HAEQRFQDIKNRWEDVKDAFFWVKEDGKIEIDDAIGNSCKWSERYEEHRITRARWYKVA
FT                   EHQLFNATMRVKDSLREHNEARVAFEKERSKENQRQVQKKKEKRLRDLKELHDQELPRA
FT                   QERLRELQALYPEIAVSVVEARREVASDLEKAHESIDKHYQSCVREQELY"
FT   gene            57403..58185
FT                   /locus_tag="CPn_0042"
FT   CDS_pept        57403..58185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18195"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9D9"
FT                   /protein_id="AAD18195.1"
FT                   /translation="MEEVSEYLQQVENQLESCSKRLTKMETFALGVRLEAKEEIESIIL
FT                   SDVVNRFEVLCRDIEDMLSRVEEIERMLRMAELPLLPIKEALTKAFVQHNSCKEKLTKV
FT                   EPYFKESPAYLTSEERLQSLNQTLQRAYKESQKVSGLESEVRACREQLKDQVRQFETQG
FT                   VSLIKEEILFVTSTFRTKFSYHSFRLHVPCMRLYEEYYDDIDLERTRARWMAMSERYRD
FT                   AFQAFQEMLKEGLVEEAQALRETEYWLYREERKSKKKH"
FT   gene            58447..60375
FT                   /locus_tag="CPn_0043"
FT   CDS_pept        58447..60375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18196"
FT                   /db_xref="GOA:A0A0F7XKV5"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XKV5"
FT                   /protein_id="AAD18196.1"
FT                   /translation="MQVPLSPQLPPPPPDHSVGASFCLSKFRVLAITFLVLGVLLLISG
FT                   ALFLTLGISGVSLGVGLGLSALGSVLVISGFLLLLERREVSGVGLEGIPTGIPVGPSAE
FT                   PSSEEIQKKQKAKQILDQLPQELDQLDTDIQHVLSCLGKLKDLKCKDRGLLKDAKEKLQ
FT                   VFDFVWKDMMMEFVELQQVMDQESRYLEGLIHEVQSIAHKLFVDDVNIRSHLGESCGYL
FT                   PSEDVRGELLKRFAKEVVARFMKVTRDIRKIAMAFNKNAYGAAKNAFDKAFGSLETCLY
FT                   KSLTKSYRDTFCDYKRAKILPDENNSARAEQRFREVKDHWEDLKETVFWVKEDGRIDIE
FT                   VLTAVGGWPDRYPEHLILEKRKDKVMSHQLWEATMRVKEAEVTYSVARVAFEKDGSQQN
FT                   QKKFQEKTKERLRCLKDLRDQECHRAQERLEKLTALYPEVSVSVVETERERKFNLEKAY
FT                   GNLEERYQSVVQDQEDYWTEQKNREAEFRAKGTKVRSMEEVAEHLQILENLLEDCYKRL
FT                   SKAETFALGVEREATEEIEYTILSDAANRLKVLCEDIEDTLPRVEEIEMMLRMAERPLH
FT                   PIKQAFTKAFVQYNRCKERLAKVEPYYKESPAYVNSEERLQSLDQASQCIQRVPKGFKF
FT                   RNGSMYI"
FT   gene            60419..60781
FT                   /locus_tag="CPn_0044"
FT   CDS_pept        60419..60781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18197"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9D7"
FT                   /protein_id="AAD18197.1"
FT                   /translation="MSLIKEELLFLSSTLKSKLSYDPLIANIPCMKFYYQYYDDIDKAR
FT                   AQSRWLEKSERYRNAKRRFQEIVKKGLFKEAKPLKKEEYRLLQEERSNKEKRLIYNKMA
FT                   VARQRVQEFESMEIPE"
FT   gene            61069..62793
FT                   /locus_tag="CPn_0045"
FT   CDS_pept        61069..62793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18198"
FT                   /db_xref="GOA:A0A0F7WGT7"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WGT7"
FT                   /protein_id="AAD18198.1"
FT                   /translation="MLLLISGALFLTLGVPGLAAGLSFGLGIGLSALGGVLVVSGLLFF
FT                   LIRRGVSKVRPEEIPVTPSHEAQKILCQLPQELDQLDTSIQEVVSCLGKLKDLKYEDQG
FT                   LLTEVQEKLRVFDFVRKDMVTEFLELQQVVAQEGQFLDYLINQVQSISHKLFVPDVNIG
FT                   AHLAELCGYLPSGDVRVERLKRSARQVVDRFMRVTCDTRKVAMAFDENACGVAKNAFDK
FT                   AFGALEECVYKSLTESYREAFYEYEKAKILRNEDVEWLQDKNKSARAEQRFREVKDRWE
FT                   DLKETVFWVKENGCIDLEVLTAVGGWPDRGPEHLIPEKRRNKVMSHKLWEATMRMKGAE
FT                   GTYSVARVAFEKDGSRKNQKKFQEKTKEWLRCLKDLHDQECHRARERLAELEALYPEVS
FT                   VSVVETERETKFKLETAYGNLEERYQSVVRDQEDYWKEEENKEAEFREKGTKVRSPEEV
FT                   VEYLQILENLSEDCSKQLTIAEVVVLGVELEATAEFEYTILSDAANRLKVLCEDIEDIL
FT                   PRVEEIEIMLRIAELPFLPIKQAFTKAFLQYNSCKDKLAKVEPYCQESVDYKSGFRV"
FT   gene            62790..63266
FT                   /locus_tag="CPn_0046"
FT   CDS_pept        62790..63266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18199"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X7S9"
FT                   /protein_id="AAD18199.1"
FT                   /translation="MNQDLQNVYQECQKATGLESEVSAYRDHLREQITEFETQGLDVIK
FT                   EELLFVSSTLKSKLSYDPLIADIPCMKFYEEYYDGIDKARVQSRWLEKSERYRKAKKGF
FT                   QEMLKEGLFKEDQALKKAEYRLLREKRMNKEKLLICNKIEAAQQRVQEFGPSDS"
FT   gene            63455..63655
FT                   /locus_tag="CPn_0047"
FT   CDS_pept        63455..63655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18200"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9D4"
FT                   /protein_id="AAD18200.1"
FT                   /translation="MTIVGFFRFVLEGILTMYHFQKIRMTLTTQGFVLNKSLRKDYELW
FT                   FVYGSCPESKVKLQTSSHKWL"
FT   gene            63687..65804
FT                   /gene="yqfF"
FT                   /locus_tag="CPn_0048"
FT   CDS_pept        63687..65804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqfF"
FT                   /locus_tag="CPn_0048"
FT                   /product="conserved hypothetical inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18201"
FT                   /db_xref="GOA:Q9Z9D3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9D3"
FT                   /protein_id="AAD18201.1"
FT                   /translation="MKELRHESYNRALHKLSHQWVRYFLYTFVSCSFIVAIFTFAWLKV
FT                   LYVPEYKAGEISRISLTAPMDFSLSWSAHKFYKRTAHISEAFGKVYHLTLSPGSLLSKE
FT                   GNADENTDYWFKKAADFLLSTNFVDSSTQKCLKDLCIYPPLLGKEKKTLEININSNKGN
FT                   VIAQCFCHLKIFLIQENCPQPCFDAIMDILKIANFEVAVDKEMSGCVKGELLGKRCIEK
FT                   ITKGTPILEKYQRIDDRDAKILKQLRAQLLSVHTLFSCRSLWGAIFVVLLILLWGYGAL
FT                   KALCPEMLKSPQRFMLYIAILTLSLLWCRGTEIFCAYWVSYLSYPPILPFTAVLLGYFL
FT                   GLPIAGFSCTFLALLYTLGSDLWNNSWFLSINLLCSWRILVSLHRVSRLSSVFWACMKL
FT                   GGVAMGSLLMFRIFTNTISREALYADGIESFVYSLITAISVVALIPVFEASFGASTNFS
FT                   LLTYLSPENALLKRLFKEAPGTYQHSVLVGSLAEAAAQAIGADSLYCLVAAHYHDIGKL
FT                   INPGFFSENQKILQQSGHSLSPLECAKMIMRHIPEGVNLARQAGLPESFIQVIEEHHGT
FT                   SVIRSAYYSHMVENPSTGSFDEELFRYSGNKPSSKETTIIMIADSFEAASRSLKNASLP
FT                   DLQRLIDQIIQGKLQDGQFSCSPITLDELALISKSMVQTLYGALHSRMKYPEISYQISM
FT                   DSCPKPSIGGT"
FT   gene            complement(65814..66296)
FT                   /locus_tag="CPn_0049"
FT   CDS_pept        complement(65814..66296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18202"
FT                   /db_xref="GOA:Q9Z9D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9D2"
FT                   /protein_id="AAD18202.1"
FT                   /translation="MLHQPYYDKILTGNTIYIPGHTHKDSNKLFQKKSRAIWVDEKPFS
FT                   LDCFSNVFLIFVSLVPIAGLVRAYQIKKSLDRTTVQIGYSPSLSCEQKECVEAFVNGYG
FT                   LICISILGGLGILVPILILVVLSLLLLGILMLFSLSTYESIKNYISKHICWKSNAT"
FT   gene            complement(66496..66813)
FT                   /locus_tag="CPn_0050"
FT   CDS_pept        complement(66496..66813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18203"
FT                   /db_xref="GOA:A0A0F7X901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X901"
FT                   /protein_id="AAD18203.1"
FT                   /translation="MRYAKHQTNWNDENVKANLGYLPSTNCKNALCRMSSRLTSSIKTA
FT                   GILGGCGILLPIFLLLLAILLISVLFQLIMLPFRLCCFALRQSVSSDTVTNLLLLNNTL
FT                   A"
FT   gene            66833..67114
FT                   /locus_tag="CPn_0051"
FT   CDS_pept        66833..67114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XV54"
FT                   /protein_id="AAD18204.1"
FT                   /translation="MGNHETYIHPGVLPSSHAQDVSRSTVYPSRSFIMRRMLMGWNFNR
FT                   VPSKSSEQLMDGHRIPLIFFGKHHPTISILNVNRFSWLSIFYNGERGF"
FT   gene            complement(67301..68005)
FT                   /gene="hemC"
FT                   /locus_tag="CPn_0052"
FT   CDS_pept        complement(67301..68005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="CPn_0052"
FT                   /product="Porphobilinogen Deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18205"
FT                   /db_xref="GOA:Q9Z9C9"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C9"
FT                   /protein_id="AAD18205.1"
FT                   /translation="MLSVCYSDPCLSDFCQGKRPLRIASRNSNLAKAQVHECISLLRSW
FT                   YPKLWFQLSTTETTGDREKKIPLHLVENSYFFTDGVDALVHKGVCDLAIHSAKDLPETP
FT                   SLPVVAITRCLHPADLLVYADHYVHEPLPLSPRLGSSSLRRSAVLKQLFPQGQILDIRG
FT                   TIEERLDQLHRGHYDAIVLAKAASLRLHLHHAYSIELPPPYHALQGSLAITAKDHAGKW
FT                   KQLFTPIHCHSS"
FT   gene            complement(67983..69344)
FT                   /gene="sms"
FT                   /locus_tag="CPn_0053"
FT   CDS_pept        complement(67983..69344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sms"
FT                   /locus_tag="CPn_0053"
FT                   /product="Sms Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18206"
FT                   /db_xref="GOA:Q9Z9C8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C8"
FT                   /protein_id="AAD18206.1"
FT                   /translation="MATKTKTQWTCNQCGATAPKWLGQCPGCHNWNSLVEEYVPQARSG
FT                   TSSRSSTSAIALSSIELENESRIFIDHAGWDRILGGGVVRGSLTLLGGDPGIGKSTLLL
FT                   QTAERLASQKYKVLYVCGEESVTQTSLRAKRLNISSPLIYLFPETNLDNIKQQIATLEP
FT                   DILIIDSIQIIFNPTLNSAPGSVAQVREVTYELMQIAKSAQITTFIIGHVTKSGEIAGP
FT                   RVLEHLVDTVLYFEGNSHANYRMIRSVKNRFGPTNELLILSMHADGLKEVSNPSGLFLQ
FT                   EKTGPTTGSMIIPIIEGSGALLIELQALVSSSPFANPVRKTAGFDPNRFSLLLAVLEKR
FT                   AQVKLFTMDVFLSITGGLKIIEPAADLGALLAVASSLYNRLLPNNSIVIGEVGLGGEIR
FT                   HVAHLERRIKEGKLMGFEGAILPEGQISSLPKEIRENFRLQGVKTIKDAIRLLL"
FT   gene            complement(69310..70023)
FT                   /gene="rnc"
FT                   /locus_tag="CPn_0054"
FT   CDS_pept        complement(69310..70023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="CPn_0054"
FT                   /product="Ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18207"
FT                   /db_xref="GOA:Q9Z9C7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C7"
FT                   /protein_id="AAD18207.1"
FT                   /translation="MHPPIDITAIEAKLNFTFTQPKLLEIALTHPSYKNESAVQIEDSE
FT                   RLEFLGDAVLGLIVTEHLFLLFPSMDEGTLSTARASLVNAKACCRYTTMLGIGDYLLIG
FT                   KGEKIQSERGRLSAYANLFESILGAVYLDGGLSPARKLTVPLLPPREEILPLMSGNPKN
FT                   LLQQFTQKQFRVLPVYQSTAVTDAQGNVSYQIQVLVNQEVWGEGNASSKKEAEKIAAQQ
FT                   ALDTYGNKNQNTMDV"
FT   gene            70129..70593
FT                   /locus_tag="CPn_0055"
FT   CDS_pept        70129..70593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0055"
FT                   /product="CT296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18208"
FT                   /db_xref="InterPro:IPR031839"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9C6"
FT                   /protein_id="AAD18208.1"
FT                   /translation="MRSALHLQHLRHFHNHGSILFENLLTIKDCFLLETKLQNFIAKAS
FT                   KTIDTVRWRENIFRSMPEIYTVVRKRRLDFFAAELVHRPKLSLVRDLWVFPGEEILEGE
FT                   EDCMLFLLLSGDRAGSGIFFTGPYPSDLYELEKGTTGLLLAFSSVGIPVI"
FT   gene            70953..72749
FT                   /gene="mrsA"
FT                   /locus_tag="CPn_0056"
FT   CDS_pept        70953..72749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrsA"
FT                   /locus_tag="CPn_0056"
FT                   /product="Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18209"
FT                   /db_xref="GOA:A0A0F7WJX7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WJX7"
FT                   /protein_id="AAD18209.1"
FT                   /translation="MKEVEQRIRSLYDAVTAENICRWLSNDCTQQDAKTILGWLDTDPA
FT                   QLEDLFGATLTFGTGGLRSLMGIGTNRINLFTIRRTTQGLVQVLRAHLPHPGDPMRVVV
FT                   GCDTRHNSIEFAQETAKVLAGNGCEVFLFQYPEPLALVSFTVRYERAIGGVMITASHNP
FT                   PNYNGYKVYMASGGQVLPPLDQEIVAACSAVNEILSVPSIDHPNIHLIGKEYEALYRDT
FT                   LKQLQLYPEANRISGRSLSISYSPLHGTGISLVPHVLKDWGFLSVHLVEKQAIGDGDFP
FT                   TVQLPNPEDPEALTLGIEQMLANDDDLFIATDPDADRVGVVCLEDGQPYRFNGNQMASL
FT                   LADHILGAWSKTRHLGEHDKLVKSLVTTEMLSAIAKHYHVDLINVGTGFKYIGEKIESW
FT                   RNSTNKFVFGAEESYGCLYGTHVEDKDAIIASALIAEAALQQKLQGKTLCDALLSLYET
FT                   YGYFANKTESVVFSAKTDEQEIRKKLSHLEEISSANFFSGKYQVEKFENYKQGIGFNLL
FT                   SKDSYALTLPKTSMLCYYFSGGGRVIIRPSGTEPKIKFYFEMSTHYPERVTDKEIQKQR
FT                   EAESFQHLDDFIFDFKEKFSNL"
FT   gene            72934..73557
FT                   /gene="sodM"
FT                   /locus_tag="CPn_0057"
FT   CDS_pept        72934..73557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodM"
FT                   /locus_tag="CPn_0057"
FT                   /product="Superoxide Dismutase (Mn)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18210"
FT                   /db_xref="GOA:Q9Z9C4"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C4"
FT                   /protein_id="AAD18210.1"
FT                   /translation="MSFVPYSLPELPYDYDALEPVISSEIMILHHQKHHQIYINNLNAA
FT                   LKRLDAAETQQNLNELIALEPALRFNGGGHINHSLFWETLAPIDQGGGQPPKHELLSLI
FT                   ERFWGTMDNFLKKLIEVAAGVQGSGWAWLGFCPAKQELVLQATANQDPLEPLTGKLPLL
FT                   GVDVWEHAYYLQYKNVRMDYLKAFPQIINWGHIENRFSEIISSK"
FT   gene            73639..74565
FT                   /gene="accD"
FT                   /locus_tag="CPn_0058"
FT   CDS_pept        73639..74565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="CPn_0058"
FT                   /product="AcCoA Carboxylase/Transferase Beta"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18211"
FT                   /db_xref="GOA:Q9Z9C3"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9C3"
FT                   /protein_id="AAD18211.1"
FT                   /translation="MRLFSYDKPKIKVQKIKADGFSGWLKCNHCHEMIHANELGQNYNC
FT                   CPKCSYHYRITAIERVKLLADKDSWRPLYTDLKSQDPLEFIDTDTYANRLEKARKNTTE
FT                   SEGVIVGICTIGLHPVALAVMDFNFMAGSMGAVVGEKLTRLIEEAIETRLPVIIVSASG
FT                   GARMQESVFSLMQMVKTSAALAKLHEAGLPYISVLTNPTSGGVTASFAALGDIIIAEPK
FT                   ALICFAGPRVVAQVIGEDLPEGAQKSEFLLEHGMIDKIVERKELKTTLQTLLDYFLAQE
FT                   YTGGKSKAPRDLSKRLKEIFLLTDDSE"
FT   gene            74616..75053
FT                   /gene="dut"
FT                   /locus_tag="CPn_0059"
FT   CDS_pept        74616..75053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="CPn_0059"
FT                   /product="dUTP Nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18212"
FT                   /db_xref="GOA:Q9Z9C2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C2"
FT                   /protein_id="AAD18212.1"
FT                   /translation="MTVFCELDSGGELPEYTTPGAAGADLRANIEEPIALLPGQRALIP
FT                   TGIKAEIPEGYELQVRPRSGLALKHGITVLNSPGTIDSDYRGEIRVILINFGDSTFIIE
FT                   PKMRIAQVVLSPVVQATFVVKQESLAETARGSGGFGHTGAS"
FT   gene            75055..75531
FT                   /gene="ptsN_1"
FT                   /locus_tag="CPn_0060"
FT   CDS_pept        75055..75531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN_1"
FT                   /locus_tag="CPn_0060"
FT                   /product="PTS IIA Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18213"
FT                   /db_xref="GOA:Q9Z9C1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9C1"
FT                   /protein_id="AAD18213.1"
FT                   /translation="MPSYCQNQQDFSLFSLLSPRLVMFLGKHSRDEILQDLTDLVDAAG
FT                   LLEDKQAFFDALVRRENIMSTGIGMGVAIPHGKLESCSNFFIAIGIHTQGILWDAIDGA
FT                   LVRLVFLIGGPENAQAEYLKLLSTLTLSLREESRRQQLLQVNTIEEVMNVFVGM"
FT   gene            75534..76211
FT                   /gene="ptsN_2"
FT                   /locus_tag="CPn_0061"
FT   CDS_pept        75534..76211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN_2"
FT                   /locus_tag="CPn_0061"
FT                   /product="PTS IIA Protein + HTH DNA-Binding Domain"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18214"
FT                   /db_xref="GOA:A0A0F7XAU2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XAU2"
FT                   /protein_id="AAD18214.1"
FT                   /translation="MDLKLDEVASLLDVSEHTVLQWLKEGAIPSYSMNNEYRFSREEIE
FT                   NWLLHNQALMIQERGEDKEALKDLSLKYSLYKAIHRGGVLCDVVVHSKEEALQYASKYI
FT                   AQKFQLDESVLFEMLSHRENLMSTGIGEGIALPHAKDFLINAYYDIVVPMFLAEPIEYG
FT                   ALDGKPVGILFFLFACQDKSHLNLVNKIVHLGMSLNARSFFKNYPNKDQLLAYVKEWES
FT                   QTH"
FT   gene            76308..77693
FT                   /locus_tag="CPn_0062"
FT   CDS_pept        76308..77693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0062"
FT                   /product="CT289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18215"
FT                   /db_xref="GOA:Q9Z9B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9B9"
FT                   /protein_id="AAD18215.1"
FT                   /translation="MMSSKRTSKIAVLSILLTFTHSIGFANANSSVGLGTVYITSEVVK
FT                   KPQKGSERKQAKKEPRARKGYLVPSSRTLSARAQKMKNSSRKESSGGCNEISANSTPRS
FT                   VKLRRNKRAEQKAAKQGFSAFSNLTLKSLLPKLPSKQKTSIHEREKATSRFVNESQLSS
FT                   ARKRYCTPSSAAPSLFLETEIVRAPVERTKELQDNEIHIPVVQVQTNPKEQNTKTTKQL
FT                   ASQASIQQSEGTEQSLRELAQGASLPVLVRSNPEVSVQRQKEELLKELVAERRQCKRKS
FT                   VRQALEARSLTKKVARGGSVTSTLRYDPEKAAEIKSRRNCKVSPEAREQKYSSCKRDAR
FT                   ANGKQDKTTPSEDASQEEQQTGAGLVRKTPKSQVASNAQNFYRNSKNTNIDSYLTANQY
FT                   SCSSEETDWPCSSCVSKRRTHNSISVCTMVVTVIAMIVGALIIANATESQTTSDPTPPT
FT                   PTP"
FT   gene            78112..78270
FT                   /locus_tag="CPn_0063"
FT   CDS_pept        78112..78270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18216"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9B8"
FT                   /protein_id="AAD18216.1"
FT                   /translation="MYANCKHNCLCLYDFSRHRSPPGLPLTFTPPYSFTLGIFLGRCLS
FT                   TSNIVLL"
FT   gene            78346..78579
FT                   /locus_tag="CPn_0064"
FT   CDS_pept        78346..78579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18217"
FT                   /db_xref="GOA:Q9Z9B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9B7"
FT                   /protein_id="AAD18217.1"
FT                   /translation="MTKIQCSAQYYRSRPAERAQTPPQPFLARDRADFWERHPRFSACC
FT                   RVLLLVAWVVLALLFLFVMLLPLAAGSYLLAF"
FT   gene            78924..80654
FT                   /locus_tag="CPn_0065"
FT   CDS_pept        78924..80654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0065"
FT                   /product="CT288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18218"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9B6"
FT                   /protein_id="AAD18218.1"
FT                   /translation="MTDFPTHFKGPKLNPIKVNPNFFERNPKVARVLQITAVVLGIIAL
FT                   LSGIVLIIGTPLGAPISMILGGCLLASGGALFVGGTIATILQARNSYKKAVNQKKLSEP
FT                   LMERPELKALDYSLDLKEVWDLHHSVVKHLKKLDLNLSKTQREVLNQIKIDDEGPSLGE
FT                   CAAMISENYDACLKMLAYREELLKEQTQYQETRFNQNLTHRNKVLLSILSRITDNISKA
FT                   GGVFSLKFSTLSSRMSRIHTTTTVILALSAVVSVMVVAALIPGGILALPILLAVAISAG
FT                   VIVTGLSYLVRQILSNTKRNRQDFYKDFVKNVDIELLNQTVTLQRFLFEMLKGVLKEEE
FT                   EVSLEGQDWYTQYITNAPIEKRLIEEIRVTYKEIDAQTKKMKTDLEFLENEVRSGRLSV
FT                   ASPSEDPSETPIFTQGKEFAKLRRQTSQNISTIYGPDNENIDPEFSLPWMPKKEEEIDH
FT                   SLEPVTKLEPGSREELLLVEGVNPTLRELNMRIALLQQQLSSVRKWRHPRGEHYGNVIY
FT                   SDTELDRIQMLEGAFYNHLREAQEEITQSLGDLVDIQNRILGIIVEGDSDSRTEEEPQE
FT                   "
FT   gene            80925..82658
FT                   /locus_tag="CPn_0066"
FT   CDS_pept        80925..82658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18219"
FT                   /db_xref="GOA:Q9Z9B5"
FT                   /db_xref="InterPro:IPR007787"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9B5"
FT                   /protein_id="AAD18219.1"
FT                   /translation="MANPTQSRPPSPEISIEELELQELAGSSNTETISNTPPPSCAATA
FT                   EEVSLFIEGGRRNSEDEEGPLGSCEVYDVVCITNQGDPEVRDHEVRVMYINGSGRTQHE
FT                   GILDAMNICDLRGEPVRFIHNSGYGLGSCFLGIRNRIPPRDNVISQAIQARWNEFFIFA
FT                   ENANRDYIVLFSGNGGLYLQVALDNSIYSHHILCVGIGSSYYIQGNYRVHNYRVTGDWT
FT                   TLLDRRGATAVNTTTLPYADSAEGLFLPSVRCPSYQWALRCGEQCLIMDNNQQVGFRPQ
FT                   DSSSEIALVVNLNQDHSTWTRLIEWIDRGDSQAVLELNPQPSHCRDIALTALYATTRIS
FT                   SLLQECLMISVTYAPEVFVTYAIVTGYSIMTLRYFILLLTNRPGCRRHFRVLRLAALGL
FT                   QSLGFLTVLLDHINVTRRVNRRPPLISVIFCTASFATGSFIYVDLTRMFFTSLRSRLQL
FT                   FVQRRLTGRGLPLRRVFVNHLDSLRFSQNALITFHGGLFMPLIIGFFNQLVIQVPRVVI
FT                   RPNTTAVYDLNQTSQEAWDSGDVLAIGQTINFLLCMILLVINTFFFVRSVRRNLHRRPH
FT                   R"
FT   gene            82953..84056
FT                   /locus_tag="CPn_0067"
FT   CDS_pept        82953..84056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18220"
FT                   /db_xref="GOA:Q9Z9B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9B4"
FT                   /protein_id="AAD18220.1"
FT                   /translation="MAVEGRVNSSQALNQDCQEVLANKQSKGLLRCRILSIVVAVITFI
FT                   AGVVLIALTLASILTSVPYLALGVFLLIVTLGCIIFALCSEKIKKVPPTPISHKEEIIA
FT                   WFEERKNIDMEKEKEDPEHFGRTATDIPMRSALDQFNHSCHHIHESPALTETYRSHQDV
FT                   LLFKDWCPVTLPDVTSEEEVLIRSVVGSYLLMEACVPKVSMLIDELHNKLKSPSERECL
FT                   FIDKKTLQRKASFLFTQKDLATFFLAYTRVNDGHLAPFRAGAKWILIHYVRLRRQHNQN
FT                   DFFTPGHSCYYARLAFNQTQRLYHQLFNVEKLRSIYANMDKDPLCHPWAFIPIYDLLKT
FT                   EDHGDGFLEQQEDREYPSRAAQDQFWG"
FT   gene            complement(84328..84903)
FT                   /locus_tag="CPn_0068"
FT   CDS_pept        complement(84328..84903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0068"
FT                   /product="CT360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18221"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9B3"
FT                   /protein_id="AAD18221.1"
FT                   /translation="MIKKFFIYSLIFSCSFSAPLKGICNEDVSSQSRIEEDPEVLITQL
FT                   NELIETPIEEGKEIRNELQAISDGQKSSEEIEESCGTSDSEGLSEKTDKESSNEYVLDF
FT                   FDSMVQRLEGISKMCQSGQVAQIIDCFNREFDIRNRELELKNRELELREKDLEFKKSIL
FT                   DWNKEKVSRELAFQREQDIKQTLMLLKK"
FT   gene            85236..87089
FT                   /locus_tag="CPn_0069"
FT   CDS_pept        85236..87089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18222"
FT                   /db_xref="GOA:A0A0F7WNJ4"
FT                   /db_xref="InterPro:IPR007787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WNJ4"
FT                   /protein_id="AAD18222.1"
FT                   /translation="MTTPPPSRSSSPPPYDWIELQDLGNTNNNSSRATPPPPEVGGELP
FT                   PYFSASNFVVIERGAPSLPSPQQLLSLPEYSRQPPPGYFDETASITSRTSEEMFGTLVS
FT                   TLCCPANSERDWEDHEVNCIYIASTSDTQLEAVQGGMHITELRGEPVRVLYETGHLYAF
FT                   ARENTCHSRLEVSHTVRAMTYFWDRFFSRHWNVGRRFLVFYQGNGGAYVQAALDSSMHT
FT                   QDIYVLGLSPTVYIRGNYHVQHYRVRGFWPSCLDSLAACAENTSVLPYGESSDGIFYPS
FT                   LFSHTFDNAIRYGERCLLVCSEGMGMLPETQQQTSPLTSLEGGHEVALVLNPQQNPEAL
FT                   SIASRLMHEERGGRLESNYMPGRSSNPFMTSMYVLVRLNTLAQIYLMSPYYSFQSNDIV
FT                   CLIFISSAAVETVSYIFLTVTDSTCGRRYLRVPRLVCTGLRNLALPTTLLELLILSYPR
FT                   SVEGVPFNVRFILGYMCTTRVVFFAWNLILHWPFRCLRHGIQLFVHRSIIGHTLGARIT
FT                   DLTLASMRYAIVFPSIVSSCLLTALAHANTNILALDPYRLIESGDLRRPAFNDDEMQQA
FT                   DNPWDAYSIGLVINTCIYMLILFANLIFMVYSVRRYHRSRR"
FT   gene            complement(87205..87378)
FT                   /locus_tag="CPn_0070"
FT   CDS_pept        complement(87205..87378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UL51"
FT                   /protein_id="AAD18223.1"
FT                   /translation="MKNQNFFSNQSRTYEQRFPKVSPHFESILRLQSVGFSSQGTLLIS
FT                   FRDTELKRDLYI"
FT   gene            complement(87450..87522)
FT                   /locus_tag="CPn_t01"
FT   tRNA            complement(87450..87522)
FT                   /locus_tag="CPn_t01"
FT                   /product="tRNA-Met"
FT   gene            complement(87596..88045)
FT                   /locus_tag="CPn_0071"
FT   CDS_pept        complement(87596..88045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0071"
FT                   /product="CT325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18224"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WNR4"
FT                   /protein_id="AAD18224.1"
FT                   /translation="MEFICPLQHARCLKKQHKIIEELFPEPFQKDHLYLKLMENSSSRD
FT                   AFDKKRMLKENLVVGCQSDLYLYEVYQDGILFFFTYTKALMSSGIASLFTEVYSGETPS
FT                   TILTCKPIFFQRLTPYLSFGRLNGGESLYMRMKQIAVQYLKPPQT"
FT   gene            complement(88054..89061)
FT                   /locus_tag="CPn_0072"
FT   CDS_pept        complement(88054..89061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0072"
FT                   /product="CT324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18225"
FT                   /db_xref="GOA:A0A0F7XHQ7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XHQ7"
FT                   /protein_id="AAD18225.1"
FT                   /translation="MSTPLSSGGISPSDQYVPQELFCDRLSSSRSNSPDSNASGDSPIV
FT                   SPPISALVALTDLKLVPYNQNSFSWTTRLKNAVEKIGLFLQRNWKYILLYILAWALILV
FT                   CHHTVALTLTIWLGVGLGIGVVFGIFTATCLDKENKHRHVNSLWNLINHGILQLDPNGT
FT                   RQILLATMIASISALIYAVPQAVGLVIGFSIGNQLSINTVYGARLGDEATYAIDRKAHK
FT                   KRIENIEQAINQHQIIKHQMINQKQLNALIEINRNNQTDPATANLLASLKLNLNQPMPY
FT                   CFSMPECGVTSSYLDLNNNSPDDIIARADQCIMTLSQTLQQIKKEPDRIIESNH"
FT   gene            89356..89577
FT                   /gene="infA"
FT                   /locus_tag="CPn_0073"
FT   CDS_pept        89356..89577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="CPn_0073"
FT                   /product="Initiation Factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18226"
FT                   /db_xref="GOA:Q9Z9A8"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A8"
FT                   /protein_id="AAD18226.1"
FT                   /translation="MAKKEDTLVLEGKVEELLPGMHFRVILENGMPVTAHLCGKMRMSN
FT                   IRLLVGDRVTVEMSAYDLTKARVVYRHR"
FT   gene            complement(89657..89728)
FT                   /locus_tag="CPn_t02"
FT   tRNA            complement(89657..89728)
FT                   /locus_tag="CPn_t02"
FT                   /product="tRNA-Thr"
FT   gene            89774..90958
FT                   /gene="tufA"
FT                   /locus_tag="CPn_0074"
FT   CDS_pept        89774..90958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="CPn_0074"
FT                   /product="Elongation Factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18227"
FT                   /db_xref="GOA:Q9Z9A7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A7"
FT                   /protein_id="AAD18227.1"
FT                   /translation="MSKETFQRNKPHINIGTIGHVDHGKTTLTAAITRALSGDGLASFR
FT                   DYSSIDNTPEEKARGITINASHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSATDGAMPQTKEHILLARQVGVPYIVVFLNKVDMISQEDAELIDLVEMELSELLEEK
FT                   GYKGCPIIRGSALKALEGDANYIEKVRELMQAVDDNIPTPEREIDKPFLMPIEDVFSIS
FT                   GRGTVVTGRIERGIVKVSDKVQLVGLGETKETIVTGVEMFRKELPEGRAGENVGLLLRG
FT                   IGKNDVERGMVVCQPNSVKPHTKFKSAVYVLQKEEGGRHKPFFSGYRPQFFFRTTDVTG
FT                   VVTLPEGTEMVMPGDNVELDVELIGTVALEEGMRFAIREGGRTIGAGTISKINA"
FT   gene            complement(90999..91070)
FT                   /locus_tag="CPn_t03"
FT   tRNA            complement(90999..91070)
FT                   /locus_tag="CPn_t03"
FT                   /product="tRNA-Trp"
FT   gene            91102..91353
FT                   /gene="secE"
FT                   /locus_tag="CPn_0075"
FT   CDS_pept        91102..91353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="CPn_0075"
FT                   /product="preprotein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18228"
FT                   /db_xref="GOA:Q9Z9A6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z9A6"
FT                   /protein_id="AAD18228.1"
FT                   /translation="MKQQHNRKALSRKIGTVKKQAKFAGSFLDEIKKIEWVSKHDLKKY
FT                   IKVVLISIFGFGFAIYFVDLVLRKSITCLDGITTFLFG"
FT   gene            91358..91906
FT                   /gene="nusG"
FT                   /locus_tag="CPn_0076"
FT   CDS_pept        91358..91906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CPn_0076"
FT                   /product="Transcriptional Antitermination"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18229"
FT                   /db_xref="GOA:Q9Z9A5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A5"
FT                   /protein_id="AAD18229.1"
FT                   /translation="MYKWYVVQVFTAQEKKVKKALEDFKESSGMTDFIQEIILPIENVM
FT                   EVKKGEHKVVEKYIWPGYLLVKMHLTDESWLYVKSTAGIVEFLGGGVPVALSEDEVRSI
FT                   LTDIEEKKSGVVQKHQFEVGSRVKINDGVFVNFIGMVSEVFHDKGRLSVMVSIFGRETR
FT                   VDDLEFWQVEEVAPGQESE"
FT   gene            92013..92438
FT                   /gene="rl11"
FT                   /locus_tag="CPn_0077"
FT   CDS_pept        92013..92438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl11"
FT                   /locus_tag="CPn_0077"
FT                   /product="L11 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18230"
FT                   /db_xref="GOA:Q9Z9A4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A4"
FT                   /protein_id="AAD18230.1"
FT                   /translation="MSVKKVIKIIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNA
FT                   ATQDKPGDLLPVVITVYADKTFTFITKQPPVSSLIKKTLNLESGSKIPNRNKVGKLTQA
FT                   QVEAIAEQKMKDMDIVLLESAKRMVEGTARSMGIDVE"
FT   gene            92465..93163
FT                   /gene="rl1"
FT                   /locus_tag="CPn_0078"
FT   CDS_pept        92465..93163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl1"
FT                   /locus_tag="CPn_0078"
FT                   /product="L1 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18231"
FT                   /db_xref="GOA:Q9Z9A3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A3"
FT                   /protein_id="AAD18231.1"
FT                   /translation="MTKHGKRIRGILKNYDFSKSYSLREAIDILKQCPPVRFDQTVDVS
FT                   IKLGIDPKKSDQQIRGAVFLPNGTGKTLRILVFASGNKVKEAVEAGADFMGSDDLVEKI
FT                   KSGWLEFDVAVATPDMMREVGKLGKVLGPRNLMPTPKTGTVTTDVAKAISELRKGKIEF
FT                   KADRAGVCNVGVGKLSFESSQIKENIEALSSALIKAKPPAAKGQYLVSFTISSTMGPGI
FT                   SIDTRELMAS"
FT   gene            93179..93691
FT                   /gene="rl10"
FT                   /locus_tag="CPn_0079"
FT   CDS_pept        93179..93691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl10"
FT                   /locus_tag="CPn_0079"
FT                   /product="L10 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18232"
FT                   /db_xref="GOA:Q9Z9A2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A2"
FT                   /protein_id="AAD18232.1"
FT                   /translation="MKQEKTLLLQEVEDKISAAQGFILLRYLRFTAAYSREFRNSLSGV
FT                   SAEFEVLKKRIFFKAIEAAGLEVDCSDTDGHLGVVFSCGDPVSAAKQVLDFNKQHKDSL
FT                   VFLAGRMDNASLSGAEVEAVAKLPSLKELRQQVVGLFAAPMSQVVGIMNSVLSGVISCV
FT                   DQKAGKN"
FT   gene            93735..94124
FT                   /gene="rl7"
FT                   /locus_tag="CPn_0080"
FT   CDS_pept        93735..94124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl7"
FT                   /locus_tag="CPn_0080"
FT                   /product="L7/L12 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18233"
FT                   /db_xref="GOA:Q9Z9A1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A1"
FT                   /protein_id="AAD18233.1"
FT                   /translation="MTTESLETLVEKLSNLTVLELSQLKKLLEEKWDVTASAPVVAVAA
FT                   GGGGEAPVAAEPTEFAVTLEDVPADKKIGVLKVVREVTGLALKEAKEMTEGLPKTVKEK
FT                   TSKSDAEDTVKKLQDAGAKASFKGL"
FT   gene            94261..98019
FT                   /gene="rpoB"
FT                   /locus_tag="CPn_0081"
FT   CDS_pept        94261..98019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="CPn_0081"
FT                   /product="RNA Polymerase Beta"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18234"
FT                   /db_xref="GOA:Q9Z9A0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A0"
FT                   /protein_id="AAD18234.1"
FT                   /translation="MLKCPERVSVKKKEDIPDLPNLIEIQIKSYKQFLQIGKLAEEREN
FT                   IGLEEVFREIFPIKSYNEATVLEYLSYNLGVPKYSPEECIRRGITYSVTLKVRFRLTDE
FT                   TGIKEEEVYMGTIPLMTDKGTFIINGAERVVVSQVHRSPGINFEQEKHSKGNILFSFRI
FT                   IPYRGSWLEAIFDINDLIYIHIDRKKRRRKILAITFIRALGYSSDADIIEEFFTIGESS
FT                   LRSEKDFALLVGRILADNIIDEASSLVYGKAGEKLSTAMLKRMLDAGIASVKIAVDADE
FT                   NHPIIKMLAKDPTDSYEAALKDFYRRLRPGEPATLANARSTIMRLFFDPKRYNLGRVGR
FT                   YKLNRKLGFSIDDEALSQVTLRKEDVIGALKYLIRLKMGDEKACVDDIDHLANRRVRSV
FT                   GELIQNQCRSGLARMEKIVRERMNLFDFSSDTLTPGKVVSAKGLASVLKDFFGRSQLSQ
FT                   FMDQTNPVAELTHKRRLSALGPGGLNRERAGFEVRDVHASHYGRICPIETPEGPNIGLI
FT                   TSLSSFAKINEFGFIETPYRIVRDGIVTDEIEYMTADVEEECVIAQASASLDEYNMFTE
FT                   PVCWVRYAGEAFEADTSTVTHMDVSPKQLVSIVTGLIPFLEHDDANRALMGSNMQRQAV
FT                   PLLKTEAPVVGTGLECRAAKDSGAIVVAEEDGVVDFVDGYKVVVAAKHNPTIKRTYHLK
FT                   KFLRSNSGTCINQQPLCAVGDVITKGDVIADGPATDRGELALGKNVLVAFMPWYGYNFE
FT                   DAIIISEKLIREDAYTSIYIEEFELTARDTKLGKEEITRDIPNVSDEVLANLGEDGIIR
FT                   IGAEVKPGDILVGKITPKSETELAPEERLLRAIFGEKAADVKDASLTVPPGTEGVVMDV
FT                   KVFSRKDRLSKSDDELVEEAVHLKDLQKGYKNQVATLKTEYREKLGALLLNEKAPAAII
FT                   HRRTAEIVVHEGLLFDQETIERIEQEDLVDLLMPNCEMYEVLKGLLSDYETALQRLEIN
FT                   YKTEVEHIREGDADLDHGVIRQVKVYVASKRKLQVGDKMAGRHGNKGVVSKIVPEADMP
FT                   YLSNGETVQMILNPLGVPSRMNLGQVLETHLGYAAKTAGIYVKTPVFEGFPEQRIWDMM
FT                   IEQGLPEDGKSFLYDGKTGERFDNKVVIGYIYMLKLSHLIADKIHARSIGPYSLVTQQP
FT                   LGGKAQMGGQRFGEMEVWALEAYGVAHMLQEILTVKSDDVSGRTRIYESIVKGENLLRS
FT                   GTPESFNVLIKEMQGLGLDVRPMVVDA"
FT   gene            98043..102224
FT                   /gene="rpoC"
FT                   /locus_tag="CPn_0082"
FT   CDS_pept        98043..102224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="CPn_0082"
FT                   /product="RNA Polymerase Beta'"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18235"
FT                   /db_xref="GOA:Q9Z999"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z999"
FT                   /protein_id="AAD18235.1"
FT                   /translation="MFGENSRDIGVLSKEGLFDKLEIGIASDITIRDKWSCGEIKKPET
FT                   INYRTFKPEKGGLFCEKIFGPTKDWECCCGKYKKIKHKGIVCDRCGVEVTLSKVRRERM
FT                   AHIELAVPIVHIWFFKTTPSRIGNVLGMTASDLERVIYYEEYVVIDPGKTDLTKKQLLN
FT                   DAQYREVVEKWGKDAFVAKMGGEAIYDLLKSEDLQSLLKDLKERLRKTKSQQARMKLAK
FT                   RLKIIEGFVSSSNHPEWMVLKNIPVVPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKAILRLKTPEVIVRNEKRMLQEAVDALFDNGRHGHPVMGAGNRPLKSLSEMLKGKNGR
FT                   FRQNLLGKRVDYSGRSVIIVGPELKFNQCGLPKEMALELFEPFIIKRLKDQGSVYTIRS
FT                   AKKMIQRGAPEVWDVLEEIIKGHPVLLNRAPTLHRLGIQAFEPVLIEGKAIRIHPLVCA
FT                   AFNADFDGDQMAVHVPLSVEAQLEAKVLMMAPDNIFLPSSGKPVAIPSKDMTLGLYYLM
FT                   ADPTYFPEEHGGKTKIFKDEIEVLRALNNGGFIDDVFGDRRDETGRGIHIHEKIKVRID
FT                   GQIIETTPGRVLFNRIVPKELGFQNYSMPSKRISELILQCYKKVGLEATVRFLDDLKDL
FT                   GFIQATKAAISMGLKDVRIPDIKSHILKDAYDKVAIVKKQYDDGIITEGERHSKTISIW
FT                   TEVSEQLSDALYVEISKQTRSKHNPLFLMIDSGARGNKSQLKQLGALRGLMAKPNGAII
FT                   ESPITSNFREGLTVLEYSISSHGARKGLADTALKTADSGYLTRRLVDVAQDVIITEKDC
FT                   GTLNHIEISAIGQGSEELLPLKDRIYGRTVAEDVYQPGDKSRLLAQSGDVLNSVQAEAI
FT                   DDAGIETIKIRSTLTCESPRGVCAKCYGLNLANGRLIGMGEAVGIIAAQSIGEPGTQLT
FT                   MRTFHLGGIAATSSTPEIITNSDGILVYMDLRVVLGQEGHNLVLNKKGALHVVGDEGRT
FT                   LNEYKKLLSTKSIESLEVFPVELGVKILVADGTPVSQGQRIGEVELHNIPIICDKPGFI
FT                   KYEDLVEGISTEKVVNKNTGLVELIVKQHRGELHPQIAIYDDADLSELVGTYAIPSGAI
FT                   ISVEEGQRVDPGMLLARLPRGAIKTKDITGGLPRVAELVEARKPEDAADIAKIDGVVDF
FT                   KGIQKNKRILVVCDEMTGMEEEHLIPLTKHLIVQRGDSVIKGQQLTDGLVVPHEILEIC
FT                   GVRELQKYLVNEVQEVYRLQGVDINDKHIEIIVRQMLQKVRITDPGDTTLLFGEDVNKK
FT                   EFYEENRRTEEDGGKPAQAVPVLLGITKASLGTESFISAASFQDTTRVLTDAACCSKTD
FT                   YLLGFKENVIMGHMIPGGTGFETHKRIKQYLEKEQEDLVFDFVSETECVC"
FT   gene            102332..103315
FT                   /gene="tal"
FT                   /locus_tag="CPn_0083"
FT   CDS_pept        102332..103315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="CPn_0083"
FT                   /product="Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18236"
FT                   /db_xref="GOA:Q9Z998"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z998"
FT                   /protein_id="AAD18236.1"
FT                   /translation="MSNQFDQLKKLSTIVCDSGDPELVKASGSQDATTNPSLILKVAQE
FT                   PKFQELLNEAVVWGIRQNGDDLQTLSFILDKIQVNFALEIIKNIPGRISLEIDARLSFN
FT                   VEAMVQRAVFLSQLFEAMGGDKKRLLVKIPGTWEGIRAVEFLEAKGIACNVTLIFNLVQ
FT                   AIAAAKAKATLISPFVGRIYDWWIAAYGDEGYSIDADPGVASVSNIYAYYKKFGIPTQI
FT                   MAASFRTKEQVLALAGCDLLTISPKLLDELKKSQHPVKKELDPAEAKKLDVQPIELTES
FT                   FFRFLMNEDAMATEKLAEGIRIFAGDTQILETAITEFIKQIAAEGA"
FT   gene            103362..103754
FT                   /locus_tag="CPn_0084"
FT   CDS_pept        103362..103754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0084"
FT                   /product="predicted ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18237"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z997"
FT                   /protein_id="AAD18237.1"
FT                   /translation="MKNKMDYKSQLVFSCPCCCKGNVCFSVFNLDVILTCNVCSSTYTF
FT                   DSVIRNEIRQFVALCKRIHDANSILGNATVSVSVEDNQMDIPFQLLFSRFPVVLNLSLD
FT                   GKKIAIRFLFDALNTSILHQESDLIS"
FT   gene            complement(103763..104506)
FT                   /locus_tag="CPn_0085"
FT   CDS_pept        complement(103763..104506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0085"
FT                   /product="CT311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18238"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z996"
FT                   /protein_id="AAD18238.1"
FT                   /translation="MKFFILFILIVAQFPAFSAQPRTQVSASHSKQAKARRTSRIRSSA
FT                   ATNASVSRYKTRAAARKKIGKFEKKPSLSPVQWVRYSGKNYSIQTPSLWQCIDDKTQLP
FT                   EKLDVLLIGKGKGNLTPTINIAQEITSKSSKEYIEEILAYHKANEMTLESGIFTQIQSP
FT                   SGEFTIIKTEKNSSWGRVFCLQATTVIDHTAYIFTSTATLDDYAELSFTFLKVVSSFQI
FT                   RGGKEATSGDAILEKALEALQNENK"
FT   gene            104904..105530
FT                   /gene="atpE"
FT                   /locus_tag="CPn_0086"
FT   CDS_pept        104904..105530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="CPn_0086"
FT                   /product="ATP Synthase Subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18239"
FT                   /db_xref="GOA:Q9Z995"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR009335"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z995"
FT                   /protein_id="AAD18239.1"
FT                   /translation="MANLNADGKLKQICDALRLDTLKPAEDEAAALLHNAKEQAKRIIQ
FT                   EAQEEARKILETAEERAHQKIKQGEVALSQAGKRALEALKQAVENKIFRESLVEWLEHV
FT                   TTDPEVSTKLIQALVQALEAQGVSGNLTAYIGKHVSPRAVNELLGKAVTTKLRKKSVVV
FT                   GSFVGGVQLKVEEKNWVLDLSSSALLEIFTRYLQKDFREMIFQGS"
FT   gene            105579..106379
FT                   /locus_tag="CPn_0087"
FT   CDS_pept        105579..106379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0087"
FT                   /product="CT309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18240"
FT                   /db_xref="InterPro:IPR024492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z994"
FT                   /protein_id="AAD18240.1"
FT                   /translation="MTQYYFLSSFLPTQLPESVPLFSISDLDDLLYLNLSENDLCNYGL
FT                   LKRFFDFENFAFFWAGKPIPFSFGEVTQENVERMLSSQQWSDDNDFEDFFKDFLMNHKS
FT                   SQDRLNHFSDLFREFLSYHQTNSSKFLQDYFRFQQQLRVVLAGFRARVLNMDVSYVLRD
FT                   EDSSDPVVLEVLMQKDSPNYELPEEFSDLQGVLDDYGLLPHTLNRALALYQFHKLEGFC
FT                   SDSYFDGNVILARCATYMFAIRNSLASVEKGREIINHIEKAIKW"
FT   gene            106373..108148
FT                   /gene="atpA"
FT                   /locus_tag="CPn_0088"
FT   CDS_pept        106373..108148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="CPn_0088"
FT                   /product="ATP Synthase Subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18241"
FT                   /db_xref="GOA:Q9Z993"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z993"
FT                   /protein_id="AAD18241.1"
FT                   /translation="MVTVSEQTAQGHVIEAYGNLLRVRFDGYVRQGEVAYVNVDNTWLK
FT                   AEVIEVADQEVKVQVFEDTQGACRGALVTFSGHLLEAELGPGLLQGIFDGLQNRLEVLA
FT                   EDSSFLQRGKHVNAISDHNLWNYTPVASVGDTLRRGDLLGTVPEGRFTHKIMVPFSCFQ
FT                   EVTLTWVISEGTYNAHTVVAKARDAQGKECAFTMVQRWPIKQAFIEGEKIPAHKIMDVG
FT                   LRILDTQIPVLKGGTFCTPGPFGAGKTVLQHHLSKYAAVDIVILCACGERAGEVVEVLQ
FT                   EFPHLIDPHTGKSLMHRTCIICNTSSMPVAARESSIYLGVTIAEYYRQMGLDILLLADS
FT                   TSRWAQALREISGRLEEIPGEEAFPAYLSSRIAAFYERGGAITTKDGSEGSLTICGAVS
FT                   PAGGNFEEPVTQSTLAVVGAFCGLSKARADARRYPSIDPLISWSKYLNQVGQILEEKVS
FT                   GWGGAVKKAAQFLEKGSEIGKRMEVVGEEGVSMEDMEIYLKAELYDFCYLQQNAFDPVD
FT                   CYCPFERQIELFSLISRIFDAKFVFDSPDDARSFFLELQSKIKTLNGLKFLSEEYHESK
FT                   EVIVRLLEKTMVQMA"
FT   gene            108153..109469
FT                   /gene="atpB"
FT                   /locus_tag="CPn_0089"
FT   CDS_pept        108153..109469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="CPn_0089"
FT                   /product="ATP Synthase Subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18242"
FT                   /db_xref="GOA:Q9Z992"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z992"
FT                   /protein_id="AAD18242.1"
FT                   /translation="MQTIYTKITDIKGNLITVEAEGARLGELATITRSDGRSSYASVLR
FT                   FDLKKVTLQVFGGTSGLSTGDHVTFLGRPMEVTFGSSLLGRRLNGIGKPIDNEGECFGE
FT                   PIEIATPTFNPVCRIVPRSMVRTNIPMIDVFNCLVKSQKIPIFSSSGEHHNALLMRIAA
FT                   QTDADIVVIGGMGLTFVDYSFFVEESKKLGFADKCVMFIHKAVDAPVECVLVPDMALAC
FT                   AEKFAVEEKKNVLVLLTDMTAFADALKEISITMDQIPANRGYPGSLYSDLALRYEKAVE
FT                   IADGGSITLITVTTMPSDDITHPVPDNTGYITEGQFYLRNNRIDPFGSLSRLKQLVIGK
FT                   VTREDHGDLANALIRLYADSRKATERMAMGFKLSNWDKKLLAFSELFETRLMSLEVNIP
FT                   LEEALDIGWKILAQSFTSEEVGIKAQLINKYWPKACLSK"
FT   gene            109454..110083
FT                   /gene="atpD"
FT                   /locus_tag="CPn_0090"
FT   CDS_pept        109454..110083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="CPn_0090"
FT                   /product="ATP Synthase Subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18243"
FT                   /db_xref="GOA:Q9Z991"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z991"
FT                   /protein_id="AAD18243.1"
FT                   /translation="MSVQVKLTKNSFRLEKQKLARLQTYLPTLKLKKALLQAEVQNAVK
FT                   DAAECDKDYVQAYERIYAFAELFSIPLCTDCVEKSFEIQSIDNDFENIAGVEVPIVREV
FT                   TLFPASYSLLGTPIWLDTMLSASKELVVKKVMAEVSKERLKILEEELRAVSIRVNLFEK
FT                   KLIPETTKILKKIAVFLSDRSITDVGQVKMAKKKIELRKARGDECV"
FT   gene            110074..112056
FT                   /gene="atpI"
FT                   /locus_tag="CPn_0091"
FT   CDS_pept        110074..112056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="CPn_0091"
FT                   /product="ATP Synthase Subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18244"
FT                   /db_xref="GOA:Q9Z990"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z990"
FT                   /protein_id="AAD18244.1"
FT                   /translation="MRLNIHKYLFIGRNKADFFSASRELGVVEFISKKCFITTEQGHRF
FT                   VECLKVFDHLEAEYSLEALEFVKDESVSVEDIVSEVLTLNKEIKGLLETVKALRKEIVR
FT                   VKPLGAFSSSEIAELSRKTGISLRFFYRTHKDNEDLEEDSPNVFYLSTAYNFDYYLVLG
FT                   VVDLPRDRYTEIEAPRSVNELQVDLANLQREIRNRSDRLCDLYAYRREVLRGLCNYDNE
FT                   QRLHQAKECCEDLFDGKVFAVAGWVIVDRIKELQSLCNRYQIYMERVPVDPDETIPTYL
FT                   ENKGVGMMGEDLVQIYDTPAYSDKDPSTWVFFAFVLFFSMIVNDAGYGLLFLMSSLLFS
FT                   WKFRRKMKFSKHLSRMLKMTAILGLGCICWGTTTTSFFGMSFSKTSVFREYSMTHVLAL
FT                   KKAEYYLQMRPKAYKELTNEYPSLKAIRDPKAFLLATEIGSAGIESRYVVYDKFIDNIL
FT                   MELALFIGVVHLSLGMLRYLRYRYSGIGWILFMVSAYLYVPIYLGTVSLIHYLFHVPYE
FT                   LGGQIGYYGMFGGIGLAVVLAMIQRSWRGVEEIISVIQVFSDVLSYLRIYALGLAGAMM
FT                   GATFNQMGARLPMLLGSIVILLGHSVNIILSIMGGVIHGLRLNFIEWYHYSFDGGGRPL
FT                   RPLRKIVCSEDAEASGIHLDNNSIV"
FT   gene            112151..112576
FT                   /gene="atpK"
FT                   /locus_tag="CPn_0092"
FT   CDS_pept        112151..112576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK"
FT                   /locus_tag="CPn_0092"
FT                   /product="ATP Synthase Subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18245"
FT                   /db_xref="GOA:Q9Z989"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z989"
FT                   /protein_id="AAD18245.1"
FT                   /translation="MIDMSVVGPALVLGLAMIGSAIGCGMAGVASHAVMSRIDEGHGKL
FT                   IGMSAMPSSQSIYGFILMLLMQAAIKNGTLSPVGGIAIGLSVGAALLVSSVMQGKCCVS
FT                   GIQAYARSSSIYGKCYAAIGIVESFSLFAVVFALLLL"
FT   gene            112509..113018
FT                   /locus_tag="CPn_0093"
FT   CDS_pept        112509..113018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0093"
FT                   /product="CT303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18246"
FT                   /db_xref="GOA:A0A0H2UL58"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UL58"
FT                   /protein_id="AAD18246.1"
FT                   /translation="MQRLGLSNLFHCLLLFLRYYYSKLVFGLTVLLAAISVICLLGCSE
FT                   PSLSSFTEYVGPEYSAAAQLSIEQSCHDEVYGQQVVVTWSLPSRMRKCLPVTLYLWVYY
FT                   GNGKVEKLTYEVNQSAGYRVYCLKGLEYKELQGIISYRVALCSGNQEIVSRRHHLWMEV
FT                   ISLDSP"
FT   gene            113152..115974
FT                   /gene="valS"
FT                   /locus_tag="CPn_0094"
FT   CDS_pept        113152..115974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="CPn_0094"
FT                   /product="Valyl tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18247"
FT                   /db_xref="GOA:Q9Z987"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z987"
FT                   /protein_id="AAD18247.1"
FT                   /translation="MTTEDFPKAYNFQDTEPELYVFWEKNGMFKAEASSDKPPYSVIMP
FT                   PPNVTGVLHMGHALVNTLQDVLVRYKRMSGFEVCWIPGTDHAGIATQAVVERHLQASEG
FT                   KRRTDYSREDFLKHIWAWKEKSEKVVLSQLRQLGCSCDWDRKRFTMEPLANRAVKKAFK
FT                   TLFENGYIYRGYYLVNWDPVLQTALADDEVEYEEKDGWLYYIRYRMVGSQESIVVATTR
FT                   PETSLGDTGIAVSPNDERYASWIGASVEVPFVNRQIPIIGDASVDPTFGTGAVKVTPAH
FT                   DKDDYLMGTNHHLPMINILTPSGGINENGGPFAGMAKEKAREEILIALEEQGLFVRKEP
FT                   YKLRVGVSYRSGAVIEPYLSKQWFVSVSEFRGALREFVESQDIKIFPKDFVKNYLSWVN
FT                   HLRDWCISRQLWWGHRIPVWYHKNDDERVLCYDGEGIPEEVAQDPDSWYQDPDVLDTWF
FT                   SSGLWPLTCLGWPDENSPDLKKFYPTALLVTGHDILFFWVTRMVLLCSSMSGEKPFSEV
FT                   FLHGLIFGKSYKRYNDFGEWSYISGKEKLAYDMGEALPDGVVAKWEKLSKSKGNVIDPL
FT                   EMIATYGTDAVRLTLCSCANRGEQIDLDYRLFEEYKHFANKVWNGARFIFGHISDLQGK
FT                   DLLAGIDEDSLGLEDFYILDGFNQLIHQLEEAYATYAFDKVATLAYEFFRNDLCSTYIE
FT                   IIKPTLFGKQGNEASQSTKRTLLAVLLINVLGVLHPVAPFITESLFLRIQDTLGALPEG
FT                   DGDAFTGHALRMLRSRACMEAPYPKAFDVKIPQDLRESFTLAQRLVYTIRNIRGEMQLD
FT                   PRLHLKAFVVCSDTTEIQSCIPILQALGGLESIQLLDKEPEKGLYSFGVVDTIRLGIFV
FT                   PEEHLLKEKGRLEKERVRLERAVENLERLLGDESFCQKANPNLVVAKQEALKNNRIELQ
FT                   GILDKLASFA"
FT   gene            116037..118793
FT                   /locus_tag="CPn_0095"
FT   CDS_pept        116037..118793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0095"
FT                   /product="S/T Protein Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18248"
FT                   /db_xref="GOA:Q9Z986"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR023507"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z986"
FT                   /protein_id="AAD18248.1"
FT                   /translation="MGEVYLAYDPVCSRKVALKKIREDLAENPLLKRRFLREARIAADL
FT                   IHPGVVPVYTIYSEKDPVYYTMPYIEGYTLKTLLKSVWQKESLSKELAEKTSVGAFLSI
FT                   FHKICCTIEYVHSRGILHRDLKPDNILLGLFSEAVILDWGAAVACGEEEDLLDIDVSKE
FT                   EVLSSRMTIPGRIVGTPDYMAPERLLGHPASKSTDIYALGVVLYQMLTLSFPYRRKKGK
FT                   KIVLDGQRIPSPQEVAPYREIPPFLSAVVMRMLAVDPQERYSSVTELKEDIESHLKGSP
FT                   KWTLTTALPPKKSSSWKLNEPILLSKYFPMLEVSPASWYSLAISNIESFSEMRLEYTLS
FT                   KKGLNEGFGILLPTSENALGGDFYQGYGFWLHIKERTLSVSLVKNSLEIQRCSQDLESD
FT                   KETFLIALEQHNHSLSLFVDGTTWLIHMNYLPSRSGRVAIIVRDMEDILEDIGIFESSG
FT                   SLRVSCLAVPDAFLAEKLYDRALVLYRRIAESFPGRKEGYEARFRAGITVLEKASTDNN
FT                   EQEFALAIEEFSKLHDGVAAPLEYLGKALVYQRLQEYNEEIKSLLLALKRYSQHPEIFR
FT                   LKDHVVYRLHESFYKRDRLALVFMILVLEIAPQAITPGQEEKILVWLKDKSRATLFCLL
FT                   DPTVLELRSSKMELFLSYWSGFIPHLNSLFHRAWDQSDVRALIEIFYVACDLHKWQFLS
FT                   SCIDIFKESLEDQKATEEIVEFSFEDLGAFLFAIQSIFNKEDAEKIFVSNDQLSPILLV
FT                   YIFDLFANRALLESQGEAIFQALDLIRSKVPENFYHDYLRNHEIRAHLWCRNEKALSTI
FT                   FENYTEKQLKDEQHELFVLYGCYLALIQGAEAAKQHFDVCREDRIFPASLLARNYNRLG
FT                   LPKDALSYQERRLLLRQKFLYFHCLGNHDERDLCQTMYHLLTEEFQL"
FT   gene            complement(118834..124314)
FT                   /gene="uvrA"
FT                   /locus_tag="CPn_0096"
FT   CDS_pept        complement(118834..124314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="CPn_0096"
FT                   /product="Excinuclease ABC Subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18249"
FT                   /db_xref="GOA:Q9Z985"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z985"
FT                   /protein_id="AAD18249.1"
FT                   /translation="MKSLPVYVSGIKVRNLKNVSIHFNSEEIVLLTGVSGSGKSSIAFD
FT                   TLYAAGRKRYISTLPTFFATTITTLPNPKVEEIHGLSPTIAIKQNHFSHYSHATVGSTT
FT                   ELFSHLALLFTLEGQARDPKTKEVLDLYSKEKVLSTIMELSEGVQISILAPLLRKDIAA
FT                   IHEYAQQGFTKVRCNGTIHPIYSFLTSGIPEDCSVDIVIDTLIKSENNIARLKVSLFTA
FT                   LEFGEGHCSVLSDEELMTFSTKQQIDDVTYTPLTQQLFSPHALESRCSLCQGSGIFISI
FT                   DNPLLIDENLSIKENCCSFAGNCSSYLYHTIYQALADALNFNLETPWKDLSPEIQNIFL
FT                   RGKNNLVLPVRLFDQTLGKKNLTYKVWRGVLNDIGDKVRYTTKPSRYLSKGMSAHSCSL
FT                   CKGTGLGDYASVATWEGKTFTEFQQMSLNNWHVFFSKVKSPSLSIQEILQGLKQRLSFL
FT                   IDLGLGYLTPNRALATLSGGEQERTAIAKHLGGELFGITYILDEPSIGLHPQDTEKLIG
FT                   VIKKLRDQGNTVILVEHEERMISLADRIIDIGPGAGIFGGEVLFNGKPEDFLMNSSSLT
FT                   AKYLRQELTIPIPESREAPTSWLLLTEATIHNLKNLSIRLPLARLIGVTGVSGSGKSSL
FT                   INNTLVPAIESFLKQENPKNLHFEWGCIGRLIHITRDLPGRSQRSIPLTYIKAFDDIRE
FT                   LFASQPRSLRQGLTKAHFSFNQPQGACIQCQGLGTMTISDDDTPIPCSECQGKRYHSEV
FT                   LEILYEGKNIADILDMTAYEAEKFFISHPKIHEKIHALCSLRLDYLPLGRPLSTLSGGE
FT                   IQRLKLAHELLFASPKQTLYVLDEPTTGLHTHDIQALIEVLLSLTYLGHTVLVIEHNMH
FT                   VVKVCDYVLELGPEGGDLGGYLLASCTPKDLIQLNTPTAKALAPYIEGSLDIPVVKSEP
FT                   PSSPKSCDILIKDAYQNNLKHIDLALPRNSLIAIAGPGASGKHSLVFDILYASGNIAYA
FT                   ELFPPYIRQGLLKETPLPSVGEVKGLSPVISVRKCSSSNRSYHTIASALGLSNGLEKLF
FT                   AILGEPFSPLTEEKLSKTTPQTIIDSLLKSYKDDYVTITSPIPLGSDLEIFLQEKQKEG
FT                   FIKLYSEGNLYDLDERLPLNLIEPAIVIQHTKVSPKNSSSLLSAISVAFSLSSEIWIYI
FT                   SQKKQRKLSYSLGWKDKKGRLYPEITHQLLSSDHPEGRCLTCGGRGEILKISLEEHKEK
FT                   IAHYTPLEFFSLFFPKSYMKPVQKLLKDENASQPLKLLTTKEFLNFCRGSSEFPGMNAL
FT                   LMEQLDTESDSPLIKPLLALTSCPACKGSGLNDYANYVRINNTSLLDIYQEDATFLESF
FT                   LNTIGTDDTRSIIQDLMNRLTFISKVGLSYITLGQRQDTLSDGENYRLHLAKKISINLT
FT                   NIVYLFEEPLSGLHPQDLPTIVQLLKELVANNNTVIATDRSCSLIPHADHAIFLGPGSG
FT                   PQGGFLMDSDTEVCPSVDLHANVPQTEVCPKAPLSISKANHTRGSDRTLKVNLSIHHIQ
FT                   NLKVSAPLHALVAIGGVSGSGKTSLLLEGFKKQAELLIAKGTTTFSDLVVIDSHPIASS
FT                   QRSDISTYFDIAPSLRAFYASLTQAKALNISSTMFSTNTKQGQCSDCQGLGYQWIDRAF
FT                   YALEKRPCPTCSGFRIQPLAQEVLYEGKHFGELLHTPIETVALRFPFIKKIQKPLKALL
FT                   DIGLGYLPIGQKLSSLSVSEKTALKTAYFLYQTPETPTLFLIDELFSSLDPIKKQHLPE
FT                   KLRSLINSGHSVIYIDHDVKLLKSADYLIEIGPGSGKQGGKLLFSGSPKDIYASKDSLL
FT                   KKYICNEELDS"
FT   gene            124555..126009
FT                   /gene="pyk"
FT                   /locus_tag="CPn_0097"
FT   CDS_pept        124555..126009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="CPn_0097"
FT                   /product="Pyruvate Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18250"
FT                   /db_xref="GOA:Q9Z984"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z984"
FT                   /protein_id="AAD18250.1"
FT                   /translation="MITRTKIICTIGPATNSPEMLAKLLDAGMNVARLNFSHGSHETHG
FT                   QAIGFLKELREQKRVPLAIMLDTKGPEIRLGNIPQPISVSQGQKLRLVSSDIDGSAEGG
FT                   VSLYPKGIFPFVPEGADVLIDDGYIHAVVVSSEADSLELEFMNSGLLKSHKSLSIRGVD
FT                   VALPFMTEKDIADLKFGVEQNMDVVAASFVRYGEDIETMRKCLADLGNPKMPIIAKIEN
FT                   RLGVENFSKIAKLADGIMIARGDLGIELSVVEVPNLQKMMAKVSRETGHFCVTATQMLE
FT                   SMIRNVLPTRAEVSDIANAIYDGSSAVMLSGETASGAHPVAAVKIMRSVILETEKNLSH
FT                   DSFLKLDDSNSALQVSPYLSAIGLAGIQIAERADAKALIVYTESGSSPMFLSKYRPKFP
FT                   IIAVTPSTSVYYRLALEWGVYPMLTQESDRAVWRHQACIYGIEQGILSNYDRILVLSRG
FT                   ACMEETNNLTLTIVNDILTGSEFPET"
FT   gene            complement(126088..127491)
FT                   /gene="htrB"
FT                   /locus_tag="CPn_0098"
FT   CDS_pept        complement(126088..127491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="CPn_0098"
FT                   /product="Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18251"
FT                   /db_xref="GOA:A0A0F7XB08"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XB08"
FT                   /protein_id="AAD18251.1"
FT                   /translation="MGKKFHQIKRTILEAPLYYLVSGIIALCRHTPRSFLTGLGKGFGF
FT                   LAFYIISDYRKTALTNLALAFPEKTFDERYKIARQSLQHLIITLLELLAIEQLVGNIDK
FT                   LITIVTSSRNPKGFSSEEVISNEDLEETFKNLQEKQGLILFCGHQANWELPFLYITKNY
FT                   PGIAFAKAIKNQRLSKKIFALREVFKGKIVPPKNGIQQGIEALNQGKLVGIVGDQALLM
FT                   SSYTYPLFGSPAFTTTSPALLAYKTGFPVIAVNVSRQAKGFEVIPSAKLYANKSLPMKE
FT                   SVAILMDQMMGFLEKGIASQPEQWMWIHKRWKRKISNVIKKKYRYSHILVFVDQVSSHF
FT                   SFLKALAECFSGTTLHLALGNADHLEELQEQFPEYSLIQLRNDQDILALPNCYPAIFDL
FT                   TNNLQHLYKHFRKTGSCAVYSKRFLEKSLDHPQAPLKNSLRIFYSKNLKDKERKNFKVK
FT                   SKGPRLTVE"
FT   gene            127593..127868
FT                   /locus_tag="CPn_0099"
FT   CDS_pept        127593..127868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18252"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UL44"
FT                   /protein_id="AAD18252.1"
FT                   /translation="MLNSIVTTRTRTAATLLIPKVIPEAPSTPVQIKMISIKETIAVRA
FT                   KSPADTVATFALDSELSEQQQTVLIAASKPRPKQSIKHIKFPLTKF"
FT   gene            complement(127879..129141)
FT                   /locus_tag="CPn_0100"
FT   CDS_pept        complement(127879..129141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0100"
FT                   /product="CT011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18253"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X947"
FT                   /protein_id="AAD18253.1"
FT                   /translation="MIKFLSQLFIRHWPRKVVSLGFAIIIWILVGQSVTITRTLTNVPV
FT                   RIVDLHPDQTVLGLQKSGFLNKKVSLTITGNKNTVQDLRPSNLEVVISAANHTESWIAT
FT                   IDKHNLVSVDHEINIRKDIHSVDANDIFVRLTQYVTEDILLTITKPIGSPPKGYEYLDV
FT                   WPKYLNQKVSGPKEYINALKEQGLELTFNLNKISFEELERNRIAQGSHDEIIFPIPKEW
FT                   KKILIPFENTFMDLNDPQADFLRLLFLKRECIPLNLNLPVFLFFPVTFIQTMNPLEYSL
FT                   DPVPPIILNHGIHQINIPLYVKDVSRQFLDVVKNNMVLTIVMPSPQDPSSINWAIEFLD
FT                   EKTLENTFLQTIIAQEHGILHDIALIDEAGIRHRFREYLRKLALFTADGEPLNLIAEIK
FT                   NNKVVIQTKTKETTKLYKKEW"
FT   gene            complement(129138..129932)
FT                   /gene="ybbP"
FT                   /locus_tag="CPn_0101"
FT   CDS_pept        complement(129138..129932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="CPn_0101"
FT                   /product="YbbP family hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18254"
FT                   /db_xref="GOA:Q9Z980"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z980"
FT                   /protein_id="AAD18254.1"
FT                   /translation="MPFDITYYTTPLLEIILIWVMLNYLLKFFWGTRAMDVVFGLLAFL
FT                   FLFVLADKLHLPIIRRLMLHVVNIAAIVVFIIFQPEIRLALSRIRFHGKKFFIDTQEQF
FT                   VEQLAASIYQLSERQIGALVVLENKDSFDEYLSFSSVKINATFSEELLETIFEPSSPLH
FT                   DGAVILRGDILAYARVVLPLAHDTTQLSRSMGTRHRAALGASQRSDALIITVSEENGSV
FT                   SLSRDGLLTRGVKIDRFKAVLRSILSPKEHKRKPLFSWIWKR"
FT   gene            130123..131469
FT                   /gene="cydA"
FT                   /locus_tag="CPn_0102"
FT   CDS_pept        130123..131469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="CPn_0102"
FT                   /product="Cytochrome Oxidase Subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18255"
FT                   /db_xref="GOA:Q9Z979"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z979"
FT                   /protein_id="AAD18255.1"
FT                   /translation="MDALILSRIQFGLFITFHYLFVPLSMGLSMMLVIMEGLYLVTKKQ
FT                   IYKQMTWFWVGIFALTFVLGVVTGIMQIFSFGSNWANFSEYTGNIFGTLLGSEGVFAFF
FT                   LESGFLGILLFGRHKVSKKMHFFSTCMVALGAHMSAFWIICANSWMQTPSGYEMVMHKG
FT                   KLIPALTSFWGVVFSPTTIDRFIHAVLGTWLSGVFLVISVSAYYLWKKRHHEFAKQGMK
FT                   IGTICAVIVLVLQLWSADVTARGVAKNQPAKLAAFEGIFKTEEYTPIWAFGYVDMEKER
FT                   VIGLPIPGALSFLVHRNIKTPVTGLDQIPRDEWPNVQAVFQLYHLMIMLWGVMVALTLI
FT                   SWSAYKGWRWALKPFFLVILTFSVLLPEICNECGWCAAEMGRQPWVVQGLLKTKDAVSP
FT                   IVQANQIVQSLVIFSLVFIALLTLFITVLCKKIKHGPEEENDLTEFEVK"
FT   gene            131480..132514
FT                   /gene="cydB"
FT                   /locus_tag="CPn_0103"
FT   CDS_pept        131480..132514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="CPn_0103"
FT                   /product="Cytochrome Oxidase Subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18256"
FT                   /db_xref="GOA:Q9Z978"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z978"
FT                   /protein_id="AAD18256.1"
FT                   /translation="MELSLTSLLPLAWYVILGVAVFAYSFGDGFDLGLGAVYLKAKEDK
FT                   ERRILLNSIGPVWDGNEVWLVIIVGGLFAGFPACYATLLSIFYMPIWTLVLLYIFRGCS
FT                   LEFRSKSESVSWKIFWDIIFICSGTAISFFLGTIVGNLILGLPLSPDTSYASLSWILFF
FT                   RPYAALCGAVVASAFAIHGSCFALMKTSDSLNARIAQQFPYILSSFLVFYVLFLGASLI
FT                   SIPKRFDAFPTYPLLILLIALTSCCCVAAKTSVSKKRYGYAFIYSTLNLLSLILSAATL
FT                   TFPNILLSTVDPQYSYTIYNSAVETKTLKSLLIIVLIGLPFIITYTCYIYRVFRGKTNF
FT                   PSIY"
FT   gene            complement(132673..133875)
FT                   /locus_tag="CPn_0104"
FT   CDS_pept        complement(132673..133875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0104"
FT                   /product="CT017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18257"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z977"
FT                   /protein_id="AAD18257.1"
FT                   /translation="MRMLQISMLLLALGTAINSPAIYAADSQSVSFPEQLPSSFTGEIK
FT                   GNHVRMRLAPHTDGTIIREFSKGDLVAVIGESKDYYVISAPPGITGYVFRSFVLDNVVE
FT                   GEQVNVRLEPSTSAPVLVRLSRGTQIQPASQEPHGKWLEVVLPSQCVFYVAKNFVANKG
FT                   PIELYTQREGQKKIAMDLINSALNFAHIELEKSLNEIDLEAIYKKINLVQSEEFKDVPG
FT                   IQGLIQKALEEIQDAYLSKSLESQNTSIASSQCSTPKVSSSEVTTSLLSRHIRKQTALK
FT                   TAPLTQGRENLEYSLFRIWASMQQGNDHSEALTQEAFYRAEQKKKQVLAGVLEVYPHVV
FT                   KNNPGDYLLKAQENTIAFLYGTSINLEQWLGKRVTVECLPRPNNHFAFPAYYVVGIKEA
FT                   S"
FT   gene            complement(134026..134847)
FT                   /locus_tag="CPn_0105"
FT   CDS_pept        complement(134026..134847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0105"
FT                   /product="CT016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18258"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z976"
FT                   /protein_id="AAD18258.1"
FT                   /translation="MLLIYCKKKEIHLQWPQTAKIRFTPKIAMKVKINDQLICIPPFIS
FT                   ARWSQIAFIESQEGENKDQGTLRLHLIDGKIISIPNLDQSIIDIAFQEHLLYLETSQSG
FT                   KEDSRDDDKLGVGVLMNVLQQITKGNDIQVLPKNLISPLFSGTNPIEAILQHTPEHKDH
FT                   PDAPTDVLEKMADVIRVLSGNNATLLPRPEPHCNCMHCQIGRVMNEEDTLAVSDKDLTF
FT                   RTWDIMQSGDKLYIVTNPLNPSDQFSVYLGPPIGCTCGEPNCEHIKAVLYT"
FT   gene            135091..136377
FT                   /gene="phoH"
FT                   /locus_tag="CPn_0106"
FT   CDS_pept        135091..136377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="CPn_0106"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18259"
FT                   /db_xref="GOA:A0A0F7WKY3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WKY3"
FT                   /protein_id="AAD18259.1"
FT                   /translation="MKKTMVIDTSVFIYDPEALFSFENTRIIIPFPVIEELEAFGKFRD
FT                   ESAKNASRALSNIRLLLENAKTKVTDGVLLPSGSELRIEVAPLSNDDRRGKLLTLELLK
FT                   IIAKREPMVFVTKSLGRRVRAEALQIESRDYESKRFSFRSLYRGFRELQVSQEDIENFY
FT                   KNGYLDLPLDVVSSPNEYFFMSAGENHFALGRYYVSEGKIIALKAMDKSVWGIKPLNTE
FT                   QRCALDLLLRDDVKLVTLIGQAGSGKTILALAAAMHKVFDKETYNKVLVSRPIVPMGRD
FT                   IGFLPGLKEDKLMHWMQPIYDNMEVLFSINQMGNSSEALQALMDAKKLEMEALTYIRGR
FT                   SLPKAFIIIDEAQNLTPHEIKTIISRAGKGTKIVLTGDPTQIDSLYFDENSNGLTYLVG
FT                   KFHHLALYGHMFMTRTERSELAAAAATIL"
FT   gene            complement(136389..137162)
FT                   /locus_tag="CPn_0107"
FT   CDS_pept        complement(136389..137162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0107"
FT                   /product="CT058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18260"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z974"
FT                   /protein_id="AAD18260.1"
FT                   /translation="MVSPLSLFHKMLLENWTPVEEPFPWPPAEKNQKIFAWALNQSKLI
FT                   FVSTSGNIAQPRLVTDSMSMMIVNAANRTMSRDGAGTNQVLSAAVSVDSWGLSQRPLNP
FT                   ERQGTPLNEGECRAGMWRNADGSNHTGKQGKPHYLAQLLGPKAVDHHNKSQAAFDRCKN
FT                   AYLNCFSLAQTLGVTFLQIPLISSGIYAPPENRKKPNSEENKVRMRWIHAVKCALVAAM
FT                   QEFGNEPGNTDRRMLIVLTDLKTPAITDPKKKSHL"
FT   gene            complement(137300..137857)
FT                   /locus_tag="CPn_0108"
FT   CDS_pept        complement(137300..137857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0108"
FT                   /product="similarity to CT018"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18261"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z973"
FT                   /protein_id="AAD18261.1"
FT                   /translation="MSIFNEEVFIISHRHTPLGQTSTALRNTPLVNPLHRTNLQRIASY
FT                   IPIFSTFIGIKTLKGISSLQYSMVLMTGNFSSVCKTLPCPEIYEELPKVRKEAWLEIFG
FT                   IKALYYLVLGVIKIIKLIVRYLCPCCRPPEPREPQNPLTPTPLDMGQQIDAIFSTPTSP
FT                   TGFKDPFLDDLLQEDKKKAPHL"
FT   gene            complement(138074..138493)
FT                   /locus_tag="CPn_s01"
FT   tmRNA           complement(138074..138493)
FT                   /locus_tag="CPn_s01"
FT   gene            138655..141786
FT                   /gene="ileS"
FT                   /locus_tag="CPn_0109"
FT   CDS_pept        138655..141786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="CPn_0109"
FT                   /product="Isoleucyl-tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18262"
FT                   /db_xref="GOA:Q9Z972"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z972"
FT                   /protein_id="AAD18262.1"
FT                   /translation="MTADEVGKNSFAKKEEQVLKFWKDNQIFEKSLQNRQGKTLYSFYD
FT                   GPPFATGLPHYGHLLASTIKDVVGRYATMDGYYVPRRFGWDCHGVPVEYEVEKSLSLTA
FT                   PGAIEDFGIASFNEECRKIVFRYVHEWEYYINRIGRWVDFSSTWKTMDASFMESVWWVF
FT                   QSLYNQGLVYEGTKVVPFSTALGTPLSNFEASQNYKEVDDPSLVVRMPLQNDSASLLVW
FT                   TTTPWTLPSNMAIAVGETLVYVRIQDKKSGEQWILSQGCVSRWFSNPEEFVILESFSGK
FT                   DLVGRTYEPPFTFFQSKREEGAFRVIAASFVEESEGTGVVHMAPAFGEGDFLVCKENHV
FT                   PLVCPVDAHGSFTEEIPQYQGQYIKHADKEIIKFLKKEGRIFYHGTVKHRYPFCWRTDT
FT                   PLIYKAVNSWFVAVEKIKDKMLRANSSIHWVPEHIQEGRFGKWLEGARDWAISRNRYWG
FT                   TPIPIWKSADGEILVVGSIRELEELTGTQITDIHRHFIDDLNIVKDGKPFHRIPYVFDC
FT                   WFDSGAMPYAQNHYPFENQKETEEAFPADFIAEGLDQTRGWFYTLTVISAILFDRPAFR
FT                   NAIVNGIILAEDGNKMSKRLNNYPSPKYVLDTYGADALRLYLLHSVVVKAEDLRFSDKG
FT                   IEGVLKQILLPLTNVLSFFNTYAELYGFDPKSQDIEPAYTEIDQWILSNLYSVVGKVRE
FT                   SMSQYHLNFAVEPFVTFIDDLTNWYIRRCRRRFWEAEDTPDRRAAFSTLYEVLTVFCKV
FT                   IAPFVPFLAEDIYQKLKLEKEPESVHLCDFPQVEMDKILPDLEKRMHDIREIVGLGHSL
FT                   RKEHKLKVRQPLANFYVVGSKDRLSLLKTFEGLIAEELNVKNVIFYEEAPSFIYTTVKP
FT                   NFRMLGKKVGSKMKEVQKALSELPNNAIDKLIQEETWVLTIDDREIALDGDDVVICRHT
FT                   DPGYIARSSALFSVILDCQLREPLIVEGIARELVNKINTMRRNQQLHVSDRIALRIKTT
FT                   EAVHRAFLDYENYICEETLIIAYDFTQDSDFQGENWDINGHATQIEITVSSIDS"
FT   gene            complement(141824..143734)
FT                   /gene="lepB"
FT                   /locus_tag="CPn_0110"
FT   CDS_pept        complement(141824..143734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="CPn_0110"
FT                   /product="Signal Peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18263"
FT                   /db_xref="GOA:Q9Z971"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z971"
FT                   /protein_id="AAD18263.1"
FT                   /translation="MKQHYSLNKSRHILRSTYKLLKSKKLAHSPADKKQLQELLEQLEE
FT                   AIFEHDQETASDLAQQALAFSNRYPNSFGRKTYELIKALLFAGVVAFLVRQFWFELYEV
FT                   PTGSMRPTILEQDRILVSKTTFGLHCPFAKKPLAFNPESVTRGGLVVFTVGDLPIPDAD
FT                   TKYFGLIPGKKRYIKRCMGRPGDFLYFYGGKIYGLDDAGKRIEFPSVHGLENLYHVPYI
FT                   SFDGTTSSHTEGQKTIIDFKQFNQSYGRLIFPQTSMYGQFFDHKEWHQDEPNKLKDPHL
FT                   SPVSYADLFGMGNYAMVRILTEHQARTSHLLPNPGSPTKVYLEICHTANLSYPKPLLRH
FT                   YEHQLSPAIQPMKTLLPLRKEHLHLIRNNLTTSRFIVAQGCAYKYHQFKINTSGIAKAY
FT                   AILLPKVPDGCYEYSKGEAYQIGFGEIRYKLKSSHPLTQLNDKQVIELFNCGINFSSIY
FT                   NPVNPLQAPLPNRYAFFNQGNLYIMDSPVFIKNDPTLQKFVTSETEKQEGSSETQPYIA
FT                   FVDKGLPPEDFKEFVEFIHNFGIQVPKGHVLVLGDNYPMSADSREFGFVPMENLLGSPL
FT                   CTFWPIGRMGRLTGVSAPTTLSGYLVSGIALATGLSLIGYVYYQKRRRLFPKKEEKNHK
FT                   K"
FT   gene            complement(143931..144686)
FT                   /locus_tag="CPn_0111"
FT   CDS_pept        complement(143931..144686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0111"
FT                   /product="CT021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z970"
FT                   /protein_id="AAD18264.1"
FT                   /translation="MKKQGKTLFLFLFLSFLFSTAFSGLFASQTSSLRTIQENIFLAKT
FT                   GDYTVLSRGSQRTFVLVKSTTPKTVWIEIIHFPCIAHKERPSLEQASWKTVIHQLESPS
FT                   QVFVVSLSSEGSQFFSLNTRTKSLEPVGKSTTVPAFLQIFDLPLSPAPANVIKTKGKEN
FT                   KPWSPKVSFEGAPLTSISVNAWQGLWPKDRGPLSETGILMYFTQPDISVFPLWVSIETP
FT                   KGTSIVRAVDIGHGATSPYVYSLPDSKTQ"
FT   gene            144767..145096
FT                   /gene="rl31"
FT                   /locus_tag="CPn_0112"
FT   CDS_pept        144767..145096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl31"
FT                   /locus_tag="CPn_0112"
FT                   /product="L31 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18265"
FT                   /db_xref="GOA:Q9Z969"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z969"
FT                   /protein_id="AAD18265.1"
FT                   /translation="MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQSEKTEVFEGKEYPVC
FT                   YVSVSSSSHPFFTGSKKFVDAEGRVDKFLKRYSNVRQPAQQPQPEEDALPAAKGKKKVV
FT                   TKKKK"
FT   gene            145335..146408
FT                   /gene="pfrA"
FT                   /locus_tag="CPn_0113"
FT   CDS_pept        145335..146408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfrA"
FT                   /locus_tag="CPn_0113"
FT                   /product="Peptide Chain Releasing Factor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18266"
FT                   /db_xref="GOA:Q9Z968"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z968"
FT                   /protein_id="AAD18266.1"
FT                   /translation="MKKKVAEYLNRLAEVEIKISNPEIFSNSKEYSALSKEHSYLLELK
FT                   NAYDKILNLEKVLADDKQALAIEKDPEMVVMLEEGINENKVELEKLNKILESLLVPPDP
FT                   DDDLNVIMELRAGTGGEEAALFVGDCVRMYHLYASSKGWKYEVLSASESDLKGYKEYVM
FT                   GISGTGVKRLLQYEAGTHRVQRVPETETQGRVHTSAITIAVLPEPSEEDTELLINEKDL
FT                   KIDTFRASGAGGQHVNVTDSAVRITHLPTGVVVTCQDERSQHKNKDKAMRILKARIRDA
FT                   EMQKRHNEASAMRSAQVGSGDRSERIRTYNFSQNRVTDHRIGLTLYNLDKVMEGDLDPI
FT                   TTAMVSHAYHQLLEHGN"
FT   gene            146398..147264
FT                   /gene="hemK"
FT                   /locus_tag="CPn_0114"
FT   CDS_pept        146398..147264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="CPn_0114"
FT                   /product="A/G specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18267"
FT                   /db_xref="GOA:Q9Z967"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z967"
FT                   /protein_id="AAD18267.1"
FT                   /translation="MEIKKAIQEGTAYLDYYGVPLSDCEALYILMDLLEVSSRAKLFDL
FT                   VGISETMLMEYRKRLALRGQRCPTAYLNGAVSFLGLRLRVDSRVLIPRTETELLAEYII
FT                   NYLLSHSEIQTFYDICCGSGCLGLAIKKSCPHVEVVLSDVCPQAVAVANENAKSNGLDV
FT                   KILLGDLSAPYTRPADAFVCNPPYLSFNEIIHIDPEVRCYEPWKALVGGSTGLEFYQRI
FT                   AQELPKIVTSTGVGWLEIGSSQGESIKNIFSKHGIYGRLHQDLSGRDRIFFLEMDGRDP
FT                   VSSGAYS"
FT   gene            147279..148625
FT                   /gene="ffh"
FT                   /locus_tag="CPn_0115"
FT   CDS_pept        147279..148625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="CPn_0115"
FT                   /product="Signal Recognition Particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18268"
FT                   /db_xref="GOA:A0A0F7X2R8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X2R8"
FT                   /protein_id="AAD18268.1"
FT                   /translation="MINSLSQKLSSIFSFLVSSRRINEENISESIREVRLALLDADVNY
FT                   HVVKDFISKVKEKILGEEIWKHVSPGQQFIRCLHEELVAFLSDGREEFTIQKTPSIILL
FT                   CGLQGAGKTTTAAKLADYVIKNKKAKKVLVVPCDLKRFAAVDQLKILVAQTKAEFYQSQ
FT                   ENKPINVVVKALAYAKENGHDFVILDTAGRLNIDNELMEELTAIQKVSQANERLFVMNV
FT                   AMGQDVLATVQAFDQSLDLTGVILSMTDGDARAGAVFSIKHVLGKPIKFEGCGERIQDL
FT                   RSFDPQSMAERILGMGDTINFVKEMREYISEEEDAELGKKLVTAAFTYEDYYKQMKAFR
FT                   RMGPLRKLLGMMPGFNNAKPSQKEIEDSEQQMKRTEAIILSMTPEERKELVELDMSRMK
FT                   RIASGCGLTLGDVNQFRKQMSQSKKFFKGMSKGKMEQVRKKMSGGNQWR"
FT   gene            148616..148975
FT                   /gene="rs16"
FT                   /locus_tag="CPn_0116"
FT   CDS_pept        148616..148975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs16"
FT                   /locus_tag="CPn_0116"
FT                   /product="S16 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18269"
FT                   /db_xref="GOA:Q9Z965"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z965"
FT                   /protein_id="AAD18269.1"
FT                   /translation="MALKIRLRQQGRRNHVVYRLVLADVESPRDGKYIELLGWYDPHSS
FT                   INYQLKSERIFYWLERGAQLSSKAEALVKQGAPGVYSALLSKQEARKLVVRKKRRAYRQ
FT                   RRSTQREEAAKDATK"
FT   gene            148989..150074
FT                   /gene="trmD"
FT                   /locus_tag="CPn_0117"
FT   CDS_pept        148989..150074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="CPn_0117"
FT                   /product="tRNA (guanine N-1)-Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18270"
FT                   /db_xref="GOA:Q9Z964"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z964"
FT                   /protein_id="AAD18270.1"
FT                   /translation="MKIDILSLFPGYFDGPLQTSILGRAIKQRLLDVQLTNLRDFGLGK
FT                   WKQVDDTPFSGGGMLLMAEPVTSAIRSVRKENSKVIYLSPQGALLTAEKSRELAAASHL
FT                   ILLCGHYEGIDERAIESEVDEEISIGDYVLTNGGIAALVLIDAVSRFIPGVLGNQESAE
FT                   RDSLENGLLEGPQYTRPREFEGKEVPEVLLQGDHKAISQWRLEQSERRTYERRPDLYLN
FT                   YLYKRSIDHKFDEETTTNRDHFKCDKISVVLEVNKLKRAKNFYCKVFGLDAMSCENKFC
FT                   LPHEGKTIFWLREVQAEKKNIVTLSLSLDCACEEDFCYLLRRWELFGGKLLEKQADEHA
FT                   VWALAQDLDGHAWIFSWHRMK"
FT   gene            150102..150467
FT                   /gene="rl19"
FT                   /locus_tag="CPn_0118"
FT   CDS_pept        150102..150467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl19"
FT                   /locus_tag="CPn_0118"
FT                   /product="L19 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18271"
FT                   /db_xref="GOA:Q9Z963"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z963"
FT                   /protein_id="AAD18271.1"
FT                   /translation="MVNLLKELEQEQCRNDLPEFHVGDTIRLATKISEGGKERVQVFQG
FT                   TVMARRGGGSGETVSLHRVAYGEGMEKSFLLNSPRIVSIEIVKRGKVARARLYYLRGKT
FT                   GKAAKVKEFVGPRSSKK"
FT   gene            150523..151167
FT                   /gene="rnhB_1"
FT                   /locus_tag="CPn_0119"
FT   CDS_pept        150523..151167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB_1"
FT                   /locus_tag="CPn_0119"
FT                   /product="Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18272"
FT                   /db_xref="GOA:Q9Z962"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z962"
FT                   /protein_id="AAD18272.1"
FT                   /translation="MNTSISEIQRFLSMIAFEKELVSEDFSVVAGIDEAGRGPLAGPVV
FT                   ASACILPKGKVFPGVNDSKKLSPKQRAQVRDALMQDPEVCFGIGVISVERIDQVNILEA
FT                   TKEAMLQAISSLPISPDILLVDGLYLPHDIPCKKIIQGDAKSASIAAASILAKEHRDDL
FT                   MLQLHRLYPEYGFDRHKGYGTSLHVEAIRRYGPSPCHRKSFSPIKQMCAIV"
FT   gene            151164..151781
FT                   /gene="gmk"
FT                   /locus_tag="CPn_0120"
FT   CDS_pept        151164..151781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="CPn_0120"
FT                   /product="GMP Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18273"
FT                   /db_xref="GOA:Q9Z961"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z961"
FT                   /protein_id="AAD18273.1"
FT                   /translation="MNKILVDSPFSPDHQKCCPKLFTISAPAGVGKTTLVRMLEQEFSS
FT                   AFAETISVTTRKPREGEVPGKDYHFVSHEEFQRLLDRQALLEWVFLFGECYGTSMLEIE
FT                   RIWSLGKHAVAVIDIQGALFIRSRMPSVSIFIAPPSQEELERRLASRGSEEGSQRKERL
FT                   EHSLIELAAANQFDYVIINDDLNQAYRVLKSIFIAEEHRNIL"
FT   gene            151778..152071
FT                   /locus_tag="CPn_0121"
FT   CDS_pept        151778..152071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0121"
FT                   /product="CT031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18274"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z960"
FT                   /protein_id="AAD18274.1"
FT                   /translation="MIKKDRFTNEKLNKLFDSPFSLVNYAIKQAKIKIAKGDVRSSNVA
FT                   IETLVLLDREGIQPEFTEEIVVTASPTVERKRSEHTNSRKKDPSAYTWSDVK"
FT   gene            152071..153726
FT                   /gene="metG"
FT                   /locus_tag="CPn_0122"
FT   CDS_pept        152071..153726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="CPn_0122"
FT                   /product="Methionyl-tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18275"
FT                   /db_xref="GOA:Q9Z959"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z959"
FT                   /protein_id="AAD18275.1"
FT                   /translation="MPQKVLITSALPYANGPLHFGHIAGVYLPADVYARFRRLLGDDVL
FT                   YICGSDEFGIAITLNADREGLGYQEYVDMYHKLHKDTFEKLGFALDFFSRTTNPFHAEL
FT                   VQDFYSQLKASGLIENRISEQLYSEQEQRFLADRYVEGTCPRCGFDHARGDECQSCGAD
FT                   YEAIDLIGPKSKISGVELVKKETEHSYFLLDRMKDALLSFIQGCYLPDHVRKFVVDYIE
FT                   HVRSRAITRDLSWGIPVPDFPGKVFYVWFDAPIGYISGTMEWAASQGNPDEWKRFWLED
FT                   GVEYVQFIGKDNLPFHSVVFPAMELGQKLDYKKVDALVVSEFYLLEGRQFSKSEGNYVD
FT                   MDKFLSSYSLDKLRYVLAATAPETSDSEFTFLDFKTRCNSELVGKFGNFINRVLAFAEK
FT                   NHYDKLSYHSVVLEDSDRAFLEEARQLVRDAEKCYREYSLRKATSVIMSLAALGNVYFN
FT                   QQAPWKLLKEGTRERVEAILFCACYCQKLLALISYPIIPESAVAIWEMISPKSLENCNL
FT                   DTMYARDLWKEEILDVINEEFHLKSPRLLFTTVE"
FT   gene            complement(153771..155969)
FT                   /gene="recD_1"
FT                   /locus_tag="CPn_0123"
FT   CDS_pept        complement(153771..155969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD_1"
FT                   /locus_tag="CPn_0123"
FT                   /product="Exodeoxyribonuclease V (Alpha Subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18276"
FT                   /db_xref="GOA:Q9Z958"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z958"
FT                   /protein_id="AAD18276.1"
FT                   /translation="MEKICGYLEQILVENKDSGDITAYIKIPNKTTPILIKGKLPQPLE
FT                   LGSPIQIYGVWSHSPSNTKYFQIHSYDSPLLYEYRGVFHYLTSKLIKGIGPKIAEKIIE
FT                   KFQEKTCYVLDITPERLSEVSGISETRCVSICKQLCEQKILRKTLLFLQEYNIPIHYGV
FT                   RIFKKYQEKSIEKICEDPFLLAREMEGIGFKTADFIAMKLGVPRNSESRLCAGIQHSLE
FT                   ELQEEGHTCYPIELLIDVVAKLLNQDVFDTPITLEEIDTQILNMQKRKLLHIQDISGTL
FT                   HVWTRYLHLAEKTIVSDLKRILFSSRRIRSIDGEKAIAWVEENLSIDLAEQQREAIKAC
FT                   FSEKLLIITGGPGTGKSTITQAILKIFEQVTHKIILAAPTGKAAKRMTEITQKHSVTIH
FT                   ALLQYDFKTKSFRKNHDNPIDCDLIIVDESGMMDTHLLHHFLKALPDYTTLVFIGDIHQ
FT                   LPSVGPGNILKDLITSNKMTVIRLNKIFRQVHDSGIVTNAHRVNEGELPILYSETGRRD
FT                   FLFFQKDDQEEALNHIIHLVTKFVPQKYHIYPQDIQVLAPMKKGTLGIYNLNKALKHAL
FT                   NPKKANLHGRFQSYAVGDKVMQIRNNYNKEVFNGDIGYVSTINFEDKAVVVRMEGKHVG
FT                   YSFSELDDLVLAYATSVHKYQGSESPCIIIPIHTSHFMMLYRNLLYTAITRGKKLVILV
FT                   GTKKAIAIATRNNRVQHRCTGLAEVLKELDTKKNYADL"
FT   gene            156614..158071
FT                   /locus_tag="CPn_0124"
FT   CDS_pept        156614..158071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18277"
FT                   /db_xref="GOA:A0A0F7X5N8"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X5N8"
FT                   /protein_id="AAD18277.1"
FT                   /translation="MLGILLIASGIIFLAVAIPGLSSAVALGLGCGMTALGTVLLITGL
FT                   VLLIRSEKLALEQVEIKQARTRVNNELDQLSQYVFYTENVLDNLKRWSYRDLGFVRQAQ
FT                   EEVTNLEQDIEEIFLTLRDIRNALDNEEFFMTHAKQCLAQVGESLFQDASIDEFINLAH
FT                   LSEIRQHLDINDPRWSMITKKVKGTVVRFIYVSTMYKQIKSNFEKSDFGQLRKMLLNNY
FT                   KTIEEVLYQSFQKGYNRAALLSEKTRIIHTSSLLHWEKDEDKHLNIKNECASRLENFKK
FT                   FRTLFLGLSEEDVIDFTGASGWDCSKLPRKEVPLDGGKKKLRFKRTFADEQVGDWDRTT
FT                   SLEHMTPQEEDPLDRLMDQVEQEATSVLKDQDRYWKEIETSEAKFRSLPREDDFEKQSQ
FT                   IDSYIRDLDDHLSVWANQLSAAEDALIEVTDVQEHGNREMLKNIQQGLELIEDAVKATL
FT                   PRVDFIQELLEKEELPLVAARMSLENS"
FT   gene            158096..158608
FT                   /locus_tag="CPn_0125"
FT   CDS_pept        158096..158608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18278"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z956"
FT                   /protein_id="AAD18278.1"
FT                   /translation="MSEVKPLFLKNDSFDLATQRFQNLINMLQEQAEIYNEYEEKNARV
FT                   QNEIKEQKDFVKRCIEDFEARGLGVLKEELASLTRDFHDKAKAETSMLIECPCIGFYYS
FT                   IHQEEQRQRQERLQKMAERYRDCKQVLEAVQVEQKDMISSRVVVDDSYFEEEKEEQKVD
FT                   NRKKEQD"
FT   gene            158809..161088
FT                   /locus_tag="CPn_0126"
FT   CDS_pept        158809..161088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18279"
FT                   /db_xref="GOA:Q9Z955"
FT                   /db_xref="InterPro:IPR015400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z955"
FT                   /protein_id="AAD18279.1"
FT                   /translation="MVFSYYCMGLFFFSGAISSCGLLVSLGVGLGLSVLGVLLLLLAGL
FT                   LLFKIQSMLREVPKAPDLLDLEDASERLRVKASRSLASLPKEISQLESYIRSAANDLNT
FT                   IKTWPHKDQRLVETVSRKLERLAAAQNYMISELCEISEILEEEEHHLILAQESLEWIGK
FT                   SLFSTFLDMESFLNLSHLSEVRPYLAVNDPRLLEITEESWEVVSHFINVTSAFKKAQIL
FT                   FKNNEHSRMKKKLESVQELLETFIYKSLKRSYRELGCLSEKMRIIHDNPLFPWVQDQQK
FT                   YAHAKNEFGEIARCLEEFEKTFFWLDEECAISYMDCWDFLNESIQNKKSRVDRDYISTK
FT                   KIALKDRARTYAKVLLEENPTTEGKIDLQDAQRAFERQSQEFYTLEHTETKVRLEALQQ
FT                   CFSDLREATNVRQVRFTNSENANDLKESFEKIDKERVRYQKEQRLYWETIDRNEQELRE
FT                   EIGESLRLQNRRKGYRAGYDAGRLKGLLRQWKKNLRDVEAHLEDATMDFEHEVSKSELC
FT                   SVRARLEVLEEELMDMSPKVADIEELLSYEERCILPIRENLERAYLQYNKCSEILSKAK
FT                   FFFPEDEQLLVSEANLREVGAQLKQVQGKCQERAQKFAIFEKHIQEQKSLIKEQVRSFD
FT                   LAGVGFLKSELLSIACNLYIKAVVKESIPVDVPCMQLYYSYYEDNEAVVRNRLLNMTER
FT                   YQNFKRSLNSIQFNGDVLLRDPVYQPEGHETRLKERELQETTLSCKKLKVAQDRLSELE
FT                   SRLSRR"
FT   gene            complement(161127..162143)
FT                   /gene="ytfF"
FT                   /locus_tag="CPn_0127"
FT   CDS_pept        complement(161127..162143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfF"
FT                   /locus_tag="CPn_0127"
FT                   /product="Cationic Amino Acid Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18280"
FT                   /db_xref="GOA:Q9Z954"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z954"
FT                   /protein_id="AAD18280.1"
FT                   /translation="MFPSANQESRTRNVPLGIFHGLVACLYWGIVFVIPNFLGSFGDLD
FT                   IVLTRYTIFGIFSLIACAIKNPSVIKKTPLYIWRKSLLWTLLINPVYYFGITLGIRYVG
FT                   SAITVVIASLAPTAVLYHSNTKQKELPYSLLFAISSVIITGVILTHLSALNLPTAASPL
FT                   YSILGVIAVILSTSLWVIYVIRNQSLLEKHPNLTPDTWSYLIGISALIICLPMIIILDL
FT                   CGITHVTHNLISHTPGSERLLFLLLCSAMGIFSSAKALIAWNKASLNLSPALLGAILIF
FT                   EPIFGLVLTYLYSQSLPSLQEGIGIFLMLGGSLLCLVLFGRKVQKSLENSQVSSSNE"
FT   gene            162277..163056
FT                   /locus_tag="CPn_0128"
FT   CDS_pept        162277..163056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0128"
FT                   /product="Biotin Protein Ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18281"
FT                   /db_xref="InterPro:IPR015834"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z953"
FT                   /protein_id="AAD18281.1"
FT                   /translation="MLRNQVLVYCSEGVSPYYLRHTIRFLKYYSTQEGAFDILRVDGNF
FT                   LIKNPFWEETTRLLVFPGGADRPYHRVLHGLGTARIFQYVSEGGNFLGICAGAYFGSKM
FT                   IYFYEPEGAPLQGARDLGFFPGTAKGPAYRGNFSYVSPSGVRVSPQLFSDFGLGYAMFN
FT                   GGCFFEGSEGYPGVNIESRYDDLPGKPASIVSRIVSKGLAVLSGPHIEYLPHYCRMVKE
FT                   NVQKTREFLQRERTTLDRYCQNLVQRLRQPAFSKADC"
FT   gene            complement(163061..163717)
FT                   /locus_tag="CPn_0129"
FT   CDS_pept        complement(163061..163717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0129"
FT                   /product="similarity to CT036"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18282"
FT                   /db_xref="GOA:Q9JRX2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JRX2"
FT                   /protein_id="AAD18282.1"
FT                   /translation="MDPRIFVTSEPLQKTYQKLQEKHVNNLGIASQVSLTDLQNKTQYE
FT                   NNLIETTTNEITYYFPVVHNPDILRSEWDPISNQLYLIFKKFFIHYHNLFSTALERNQI
FT                   LLIDSLNTGSSNPIARQMELLAFLCVFEQLDYNEDEYTIEPRDYFNRFVYKNSQTAPQI
FT                   QSFGLLHGYEEMSYASNNIRNVLTHSIVLCSPILYQLITEFDTTKIHADDFDCLI"
FT   gene            complement(163748..164245)
FT                   /locus_tag="CPn_0130"
FT   CDS_pept        complement(163748..164245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18283"
FT                   /db_xref="GOA:Q9JRX2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JRX2"
FT                   /protein_id="AAD18283.1"
FT                   /translation="MVKCSSIIHENKKPAQLLPESKFAAITKLSLAILSLFLGIAACIL
FT                   IALSGLLPNTLLIIALSLISIIVLSTGISLLIGTQCSKSVQKDEQKPKSIFPKETPSLD
FT                   PWLLNPLKNKIQSSETLLLDPTSINLKNELFFPSFEEWKKIFLKDPDFLIKSALANWKI
FT                   LE"
FT   gene            164318..164389
FT                   /locus_tag="CPn_t04"
FT   tRNA            164318..164389
FT                   /locus_tag="CPn_t04"
FT                   /product="tRNA-Asn"
FT   gene            164549..165583
FT                   /locus_tag="CPn_0131"
FT   CDS_pept        164549..165583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18284"
FT                   /db_xref="GOA:A0A0F7WU86"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WU86"
FT                   /protein_id="AAD18284.1"
FT                   /translation="MENAMSSSFVYNGPSWILKTSVAQEVFKKHGKGIQVLLSTSVMLF
FT                   IGLGVCAFIFPQYLIVFVLTIALLMLAISLVLFLLIRSVRSSMVDRLWCSEKGYALHQH
FT                   ENGPFLDVKRVQQILLRSPYIKVRALWPSGDIPEDPSQAAVLLLSPWTFFSSVDVEALL
FT                   PSPQEKEGKYIDPVLPKLSRIERVSLLVFLSAFTLDDLNEQGVNPLMNNEEFLFFINKK
FT                   AREHGIQDLKHEIMSSLEKTGVPLDPSMSFQVSQAMFSVYRYLRQRDLTTSELRCFHLL
FT                   SCFKGDVVHCLASFENPKDLADSDFLEACKNVEWGEFISACEKALLKNPQGISIKDLKQ
FT                   FLVR"
FT   gene            165587..166564
FT                   /locus_tag="CPn_0132"
FT   CDS_pept        165587..166564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18285"
FT                   /db_xref="GOA:Q9Z949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z949"
FT                   /protein_id="AAD18285.1"
FT                   /translation="MIEFAFVPHTSVTADRIEDRMACRMNKLSTLAITSLCVLISSVCI
FT                   MIGILCISGTVGTYAFVVGIIFSVLALVACVFFLYFFYFSSEEFKCASSQEFRFLPIPA
FT                   VVSALRSYEYISQDAINDVIKDTMQLSTLSSLLDPEAFFLEFPYFNSLIVNHSMKEADR
FT                   LSREAFLILLGEITWKDCETKILPWLKDPNITPDDFWKLLKDHFDLKDFKKRIATWIRK
FT                   AYPEIRLPKKHCLDKSIYKGCCKFLLLSENDVQYQRLLHKVCYFSGEFPAMVLGLGSEV
FT                   PMVLGLPKVPKDLTWEMFMENMPVLLQSKREGHWKISLEDVASL"
FT   gene            complement(166561..167334)
FT                   /locus_tag="CPn_0133"
FT   CDS_pept        complement(166561..167334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0133"
FT                   /product="CHLPS hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18286"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z948"
FT                   /protein_id="AAD18286.1"
FT                   /translation="MFKLLKNLFLIGCCIVGYFWMRKESIVEQWLSNRLHTQVTVGRVS
FT                   IRTSGIKIRHICIHNPLASERFPYAAEIEYADVRFSSISMLLTKQLEISELIIHGANFT
FT                   IFPYDSHGTKTNWSLVWKNFHPQKETPSNLWIDRAPVLIRRCLFLNTRLYGLRANHKDI
FT                   PHLSVPSLEFHSHTSSAKELPKLSEALPSLLYLALEESLYHLNLPGDIIKPLSQQAHKH
FT                   FYSSYPQFQDRLNDINTPGTPTEEIIGFIRGLFFH"
FT   gene            complement(167464..169098)
FT                   /gene="groEL_1"
FT                   /locus_tag="CPn_0134"
FT   CDS_pept        complement(167464..169098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL_1"
FT                   /locus_tag="CPn_0134"
FT                   /product="Heat Shock Protein-60"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18287"
FT                   /db_xref="GOA:P31681"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31681"
FT                   /protein_id="AAD18287.1"
FT                   /translation="MAAKNIKYNEEARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFG
FT                   SPQVTKDGVTVAKEIELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGL
FT                   RNVTAGANPMDLKRGIDKAVKVVVDELKKISKPVQHHKEIAQVATISANNDSEIGNLIA
FT                   EAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFSTNPETQECVLEDALILI
FT                   YDKKISGIKDFLPVLQQVAESGRPLLIIAEEIEGEALATLVVNRLRAGFRVCAVKAPGF
FT                   GDRRKAMLEDIAILTGGQLVSEELGMKLENTTLAMLGKAKKVIVTKEDTTIVEGLGNKP
FT                   DIQARCDNIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDA
FT                   QHATIAAVEEGILPGGGTALVRCIPTLEAFLPMLANEDEAIGTRIILKALTAPLKQIAS
FT                   NAGKEGAIICQQVLARSANEGYDALRDAYTDMIDAGILDPTKVTRSALESAASIAGLLL
FT                   TTEALIADIPEEKSSSAPAMPSAGMDY"
FT   gene            complement(169140..169448)
FT                   /gene="groES"
FT                   /locus_tag="CPn_0135"
FT   CDS_pept        complement(169140..169448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="CPn_0135"
FT                   /product="10 KDa Chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18288"
FT                   /db_xref="GOA:P31682"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31682"
FT                   /protein_id="AAD18288.1"
FT                   /translation="MSDQATTLRIKPLGDRILVKREEEEATARGGIILPDTAKKKQDRA
FT                   EVLVLGTGKRTDDGTLLPFEVQVGDIILMDKYAGQEITIDDEEYVILQSSEIMAVLK"
FT   gene            complement(169566..171401)
FT                   /gene="pepF"
FT                   /locus_tag="CPn_0136"
FT   CDS_pept        complement(169566..171401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="CPn_0136"
FT                   /product="Oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18289"
FT                   /db_xref="GOA:Q9Z947"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z947"
FT                   /protein_id="AAD18289.1"
FT                   /translation="MTTELKTEALPTRTQVDPKHCWDTTLMYANREEWKKDFDLCSSGK
FT                   DRSPIWPEFSPSHYQIDNPESLLELLSKKFSVERKLDQLYIYAHLIHDQDITNPEGESD
FT                   YQSIVYLYTLFSQEISWIQPALIALSEEKVAALLSSSVLAPYRFYLEKIFRLSPHTGTA
FT                   NEEKILASSFAALNVSNKAFSSLSDAEIPFGIAKDSNGEEHPLSHALASLYMQSPDQEL
FT                   RRTAYLAQFQRYYDYRNTFANLLNGKVQAHLFEAKARNYPSCLEASLFQHNIPTTVYIN
FT                   LINETKKHTSLINRYFNLKKEALNLKEFHFYDVYAPISQTTSKNYSYEEGVDLVCKSLL
FT                   PLGTHYVEILRNGLLSNRWVDRYENKHKRSGAYSSGCYDSAPYILLNYTNTLYDVSVIA
FT                   HEAGHSMHSYFSREAQPYHDAQYPLFLAEIASTFNEMLLMEALSKSDQSKEDKIVIITK
FT                   TLDTIFATLFRQTFFAAFEYEIHSAAEQGTPLTEEFLSATYGNLQKEFYGGVVTSDSLS
FT                   ALEWARIPHFYYNFYVYQYATGIIAALSFAEKILTQEPGALELYLKFLKSGRSDFPLNI
FT                   LKKSGLDMTTSAPLDKAFAFITKKIDLLSSLLSED"
FT   gene            complement(171499..172254)
FT                   /gene="ybgI"
FT                   /locus_tag="CPn_0137"
FT   CDS_pept        complement(171499..172254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="CPn_0137"
FT                   /product="ACR family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18290"
FT                   /db_xref="GOA:Q9Z946"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z946"
FT                   /protein_id="AAD18290.1"
FT                   /translation="MNVADLLSHLETLLSSKIFQDYGPNGLQVGDPQTPVKKIAVAVTA
FT                   DLETIKQAVAAEANVLIVHHGIFWKGMPYPITGMIHKRIQLLIEHNIQLIAYHLPLDAH
FT                   PTLGNNWRVALDLNWHDLKPFGSSLPYLGVQGSFSPIDIDSFIDLLSQYYQAPLKGSAL
FT                   GGPSRVSSAALISGGAYRELSSAATSQVDCFITGNFDEPAWSTALESNINFLAFGHTAT
FT                   EKVGPKSLAEHLKSEFPISTTFIDTANPF"
FT   gene            complement(172697..174019)
FT                   /gene="hemL"
FT                   /locus_tag="CPn_0138"
FT   CDS_pept        complement(172697..174019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="CPn_0138"
FT                   /product="Glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18291"
FT                   /db_xref="GOA:Q9JRW9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JRW9"
FT                   /protein_id="AAD18291.1"
FT                   /translation="MLNCSNQKHTVTFEEACQVFPGGVNSPVRACRSVGVTPPIVSSAQ
FT                   GDIFLDTHGREFIDFCGGWGALIHGHSHPKIVKAIQKTALKGTSYGLTSEEEILFATML
FT                   LSSLKLKEHKIRFVSSGTEATMTAVRLARGITNRSIIIKFIGGYHGHADTLLGGISTTE
FT                   ETIDNLTSLIHTPSPHSLLISLPYNNSQILHHVMEALGPQVAGIIFEPICANMGIVLPK
FT                   AEFLDDIIELCKRFGSLSIMDEVVTGFRVAFQGAQDIFNLSPDITIYGKILGGGLPAAA
FT                   LVGHRSILDHLMPEGTIFQAGTMSGNFLAMATGHAAIQLCQSEGFYDHLSQLEALFYSP
FT                   IEEEIRSQGFPVSLVHQGTMFSLFFTESAPTNFDEAKNSDVEKFQTFYSEVFDNGVYLS
FT                   PSPLEANFISSAHTEENLTYAQNIIIDSLIKIFDSSAQRFF"
FT   gene            complement(174090..174656)
FT                   /gene="yqgE"
FT                   /locus_tag="CPn_0139"
FT   CDS_pept        complement(174090..174656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgE"
FT                   /locus_tag="CPn_0139"
FT                   /product="YqgE hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18292"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z944"
FT                   /protein_id="AAD18292.1"
FT                   /translation="MKIPYARLEKGSLLVASPDINQGVFARSVILLCEHSLNGSFGLIL
FT                   NKTLGFEISDDIFTFEKVSNHNIRFCMGGPLQANQMMLLHSCSEIPEQTLEICPSVYLG
FT                   GDLPFLQEIASSESGPEINLCFGYSGWQAGQLEKEFLSNDWFLAPGNKDYVFYSEPEDL
FT                   WALVLKDLGGKYASLSTVPDNLLLN"
FT   gene            complement(174670..175110)
FT                   /gene="yqdE"
FT                   /locus_tag="CPn_0140"
FT   CDS_pept        complement(174670..175110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqdE"
FT                   /locus_tag="CPn_0140"
FT                   /product="YqdE hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18293"
FT                   /db_xref="GOA:Q9Z943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z943"
FT                   /protein_id="AAD18293.1"
FT                   /translation="MSLEKELLEETPLVLLNFYKLVSFCNYAGMILGTEEKKFAIYGHV
FT                   SMGQAFQGADTEGHSPQRPFAHDLLNFVFSGFDIQVLRVVINDYKDNVFYTRLFLEQKD
FT                   REFLYVVDVDARPSDSIPLALTHKIPILCVKSVFDAVVPYEE"
FT   gene            complement(175107..175802)
FT                   /gene="rpiA"
FT                   /locus_tag="CPn_0141"
FT   CDS_pept        complement(175107..175802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="CPn_0141"
FT                   /product="Ribose-5-P Isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18294"
FT                   /db_xref="GOA:Q9Z942"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z942"
FT                   /protein_id="AAD18294.1"
FT                   /translation="MEKDLHLHEKKCLAHEAATQVTSGMILGLGSGSTAKEFIFALAHR
FT                   IQTESLAVHAIASSQNSYALAKQLAIPLLNPEKFSSLDLTVDGADEVDPQLRMIKGGGG
FT                   AIFREKILLRAAKRSIILVDESKLVPVLGKFRVPLEISRFGRSAIIEEIRHLGYEGEWR
FT                   LQDTGDLFITDSSNYIYDIFSPNSYPNPEKDLLKLIQIHGVIEVGFVIEKVEVWSSNSQ
FT                   GLISKKYSV"
FT   gene            complement(175813..176091)
FT                   /locus_tag="CPn_0142"
FT   CDS_pept        complement(175813..176091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UL75"
FT                   /protein_id="AAD18295.1"
FT                   /translation="MEKFHFKILQLLSTKNSILNFCSHFEISRVSHDNAIQKIRSYPLK
FT                   PIAENRINTLSFKDLKIDYPKDSSKRFRFLYSIGRIPLHKLWEYFVT"
FT   gene            complement(176211..177335)
FT                   /gene="yxjG_1"
FT                   /locus_tag="CPn_0143"
FT   CDS_pept        complement(176211..177335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxjG_1"
FT                   /locus_tag="CPn_0143"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18296"
FT                   /db_xref="GOA:Q9Z940"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z940"
FT                   /protein_id="AAD18296.1"
FT                   /translation="MNTSLKRPLKSHFDVVGSFLRPEHLKKTRESLKEGSISLDQLMQI
FT                   EDIAIQDLIKKQKAAGLSFITDGEFRRATWHYDFMWGFHGVGHHRATEGVFFDGERAMI
FT                   DDTYLTDKISVSHHPFVDHFKFVKALEDEFTTAKQTLPAPAQFLKQMIFPNNIEVTRKF
FT                   YPTNQELIEDIVAGYRKVIRDLYDAGCRYLQLDDCTRGGLVDPRVCSWYGIDEKGLQDL
FT                   IQQYLLINNLVIADRPDDLVVNLHVCRGNYHSKFFASGSYDFIAKPLFEQTNVDGYYLE
FT                   FDHERSGDFSPLTFISGEKTVCLGLVTSKTPTLENKDEVIARIHQAADYLPLERLSLSP
FT                   QCGFASCEIGNKLTEEEQWAKVALVKEISEEVWK"
FT   gene            177963..180563
FT                   /gene="clpB"
FT                   /locus_tag="CPn_0144"
FT   CDS_pept        177963..180563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="CPn_0144"
FT                   /product="Clp Protease ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18297"
FT                   /db_xref="GOA:Q7AJA9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AJA9"
FT                   /protein_id="AAD18297.1"
FT                   /translation="MEKFSDAVSEALEKAFELAKSSKHTYVTENHLLLALLENTESLFY
FT                   LVIKDIHGNPGLLNTAVKDALSREPTVVEGEVDPKPSPGLQTLLRDAKQEAKTLGDEYI
FT                   SGDHLLLAFWSSNKEPFNSWKQTTKVSFKDLKNLITKIRRGNRMDSPSAESNFQGLEKY
FT                   CKNLTALAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPMLIGEPGVGKTAIAEGLALRL
FT                   IQGDVPESLKGKQLYVLDMGALIAGAKYRGEFEERLKSVLKDVESGDGEHIIFIDEVHT
FT                   LVGAGATDGAMDAANLLKPALARGTLHCIGATTLNEYQKYIEKDAALERRFQPIFVTEP
FT                   SLEDAVFILRGLREKYEIFHGVRITEGALNAAVLLSYRYIPDRFLPDKAIDLIDEAASL
FT                   IRMQIGSLPLPIDEKERELAALIVKQEAIKREQSPSYQEEADAMQKSIDALREELASLR
FT                   LGWDEEKKLISGLKEKKNSLESMKFSEEEAERVADYNRVAELRYSLIPQLEEEIKQDEA
FT                   SLNQRDNRLLQEEVDERLIAQVVANWTGIPVQKMLEGEAEKLLILEESLEERVVGQPFA
FT                   VSAVSDSIRAARVGLNDPQRPLGVFLFLGPTGVGKTELAKALADLLFNKEEAMVRFDMS
FT                   EYMEKHSISKLIGSSPGYVGYEEGGSLSEALRRRPYSVVLFDEIEKADKEVLNILLQVF
FT                   DDGILTDGKKRKVNCKNALFIMTSNIGSPELADYCSKKGSELTKEAILSVVSPVLKRYL
FT                   SPEFMNRIDEILPFVPLTKEDIVKIVGIQMRRIAQRLKARRINLSWDDSVILFLSEQGY
FT                   DSAFGARPLKRLIQQKVVILLSKALLKGDIKPDTSIELTMAKEVLVFKKVETPS"
FT   gene            180777..182372
FT                   /locus_tag="CPn_0145"
FT   CDS_pept        180777..182372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0145"
FT                   /product="CT114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18298"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X9A9"
FT                   /protein_id="AAD18298.1"
FT                   /translation="MFKSFIVRYMFVGGLVSFLLPIPDLECANNVTKTYDKKASVISRD
FT                   LKLQEDCQKFWNLDPYKLESLCAYQVLYHDDYSSKRIRELFPQIQKDEVPIFATMILTL
FT                   GKVDRGFSPEEISLIQKLSYPGLSLASLRGSTEIDPNTDLARALVVSEFSGDLGKNRAD
FT                   YYSNCLDILALRIHAERQRYLDQSPCVPGTSEFHKATIEAINTILFYEEAVRYPSKKEM
FT                   FSDEFSFLSSVTDRKFGVCLGVSSLYFSLSQRLDLPLEAVTPPGHIYLRYQGGEVNIET
FT                   TAGGRHLPTASYCDCLDLEDLQVRTPEEMIGLTFMNQGSFALQKKKYKEAEEAYKKAQE
FT                   YLGDEELQELLGFVQILGGKKKEGKSLIGKSPRASQKGSVAYDYLKGRINIPTLALLFS
FT                   YPGSNYEEIASYEEELKKAMKSSMPCCEGQRRLASVAFHLGKTAEAVALLEKCVEDIPN
FT                   DLSLHLRLCKILCDRHEYTKALKYFIIAERLMEDQGFLKKDNRSFALFYEVKKIISKVA
FT                   PQKANTLLLMESER"
FT   gene            182613..183098
FT                   /locus_tag="CPn_0146"
FT   CDS_pept        182613..183098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18299"
FT                   /db_xref="GOA:Q9Z937"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z937"
FT                   /protein_id="AAD18299.1"
FT                   /translation="MSSSEVVFQTVHGLGFGGLSSKSVVPFKKSLSDAPRVVCSILVLT
FT                   LGLGALVCGIAITCWCVPGVILMGGICAIVLGAISLALSLFWLWGLFSNCCGSKRVLPG
FT                   EGLLRDKLLDGGFSRAAPSGMGLPGDGSPRASTPSCLEELQAEIQAVTQAIDQMSDD"
FT   gene            183225..183674
FT                   /locus_tag="CPn_0147"
FT   CDS_pept        183225..183674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18300"
FT                   /db_xref="GOA:Q9Z936"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z936"
FT                   /protein_id="AAD18300.1"
FT                   /translation="MAVQSIKEAVTSAATSVGCVNCSREAIPAFNTEERATSIARSVIA
FT                   AIIAVVAISLLGLGLVVLAGCCPLGMAAGAITMLLGVALLAWAILITLRLLNIPKAEIP
FT                   SPGNNGEPNERNSATPPLEGGVAGEAGRGGGSPLTQLDLNSGAGS"
FT   gene            183846..185705
FT                   /locus_tag="CPn_0148"
FT   CDS_pept        183846..185705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0148"
FT                   /product="S/T Protein Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18301"
FT                   /db_xref="GOA:Q7AJA5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AJA5"
FT                   /protein_id="AAD18301.1"
FT                   /translation="MESEKDIGAKFLGDYRILYRKGQSLWSEDLLAEHRFIKKRYLIRL
FT                   LLPDLGSSQPFMEAFHDVVVKLAKLNHPGILSIENVSESEGRCFLVTQEQDIPILSLTQ
FT                   YLKSIPRKLTELEIVDIVSQLASLLDYVHSEGLAQEEWNLDSVYIHILNGVPKVILPDL
FT                   GFASLIKERILDGFISDEENRESKIKERVLLHTSEGKQGREDTYAFGAITYYLLFGFLP
FT                   QGIFPMPSKVFSDFIYDWDFLISSCLSCFMEERAKELFPLIRKKTLGEELQNVVTNCIE
FT                   SSLREVPDPLESSQNLPQAVLKVGETKVSHQQKESAEHLEFVLVEACSIDEAMDTAIES
FT                   ESSSGVEEEGYSLALQSLLVREPVVSRYVEAEKEEPKPQPILTEMVLIEGGEFSRGSVE
FT                   GQRDELPVHKVILHSFFLDVHPVTNEQFIRYLECCGSEQDKYYNELIRLRDSRIQRRSG
FT                   RLVIEPGYAKHPVVGVTWYGASGYAEWIGKRLPTEAEWEIAASGGVAALRYPCGEEIEK
FT                   SRANFFTADTTTVMSYPPNPYGLYDMAGNVYEWCQDWYGYDFYEISAQEPESPQGPAQG
FT                   VYRVLRGGCWKSLKDDLRCAHRHRNNPGAVNSTYGFRCAKNIN"
FT   gene            185715..187703
FT                   /gene="dnlJ"
FT                   /locus_tag="CPn_0149"
FT   CDS_pept        185715..187703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnlJ"
FT                   /locus_tag="CPn_0149"
FT                   /product="DNA Ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18302"
FT                   /db_xref="GOA:Q9Z934"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z934"
FT                   /protein_id="AAD18302.1"
FT                   /translation="MKEENSQAHYLALCRELEDHDYSYYVLHRPRISDYEYDMKLRKLL
FT                   EIERSHPEWKVLWSPSTRLGDRPSGTFSVVSHKEPMLSIANSYSKEELSEFFSRVEKSL
FT                   GTSPRYTVELKIDGIAVAIRYEDRVLVQALSRGNGKQGEDITSNIRTIRSLPLRLPEDA
FT                   PEFIEVRGEVFFSYSTFQIINEKQQQLEKTIFANPRNAAGGTLKLLSPQEVAKRKLEIS
FT                   IYNLIAPGDNDSHYENLQRCLEWGFPVSGKPRLCSTPEEVISVLKTIETERASLPMEID
FT                   GAVIKVDSLASQRVLGATGKHYRWALAYKYAPEEAETLLEDILVQVGRTGVLTPVAKLT
FT                   PVLLSGSLVSRASLYNEDEIHRKDIRIGDTVCVAKGGEVIPKVVRVCREKRPEGSEVWN
FT                   MPEFCPVCHSHVVREEDRVSVRCVNPECVAGAIEKIRFFVGRGALNIDHLGVKVITKLF
FT                   ELGLVHTCADLFQLTTEDLMQIPGIRERSARNILESIEQAKHVDLDRFLVALGIPLIGI
FT                   GVATVLAGHFETLDRVISATFEELLSLEGIGEKVAHAIAEYFSDSTHLNEIKKMQDLGV
FT                   CISPYHKSGSTCFGKAFVITGTLEGMSRLDAETAIRNCGGKVGSSVSKQTDYVVMGNNP
FT                   GSKLEKARKLGVSILDQEAFTNLIHLE"
FT   gene            187834..192447
FT                   /locus_tag="CPn_0150"
FT   CDS_pept        187834..192447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0150"
FT                   /product="CT147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18303"
FT                   /db_xref="GOA:A0A0F7WI89"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WI89"
FT                   /protein_id="AAD18303.1"
FT                   /translation="MASSSNNSTKQDGIPSWVNPNVQWNRASQVGDQEANSLTPEAQTS
FT                   RSWFSDRKHFLEVLDVSLEEMENNDLKKYSRYKTIILIATLVTVAITCIVPISMVFGIP
FT                   MWVPCLILFGAGLSSAFLSHRLQSKCKEIHLRYRAYQIYRQQLLSQYPDLRKSTLYKYS
FT                   ITHVKPKKGFVGKLVENLRPDLHKNKDDGGAAADSRLDFAGYGVKHYQTDALLGVSGVN
FT                   SVEWQRLASLIMSVKNDILNDVGSREPIDKAQRSALVVSGKDIGGEIQPGGILDISRDI
FT                   LAICGYGMNVGVEAKKAIDQYKKWYLNSSTFIAWNPQLPAIAQSYLLEQQRHLDYAAKI
FT                   FQDLSALTTAHGTGQALEDLDSLLCYYDQLIESKGVGEKIIASIHQKHLDLAMQDSCDQ
FT                   EHLKKWSNLYHVFSITIKEFTEGKLEQNEVVSRIQRLRGKLEKSKCSILGNCRTNAEYA
FT                   TKSEKKLADYLLQIGDREPFLTGMHKAIATGKAIQGKVEGVISQHPEKQIMMLRCSIER
FT                   LEGMLRREDWGAILQKNEDEVLALKSTMEAQLQGFKDLVGTWEGKYQEFKKNKLSKVLV
FT                   YDFTKSYSNLLNRLEVLHAESSTDDLVLHVDRMSEDLKKTIEEIDGNLFQVTPEELSLL
FT                   AREYQGLMNELPLIVQEGNRLQEAISSEGVSQGLMLLNSLLNRDEKINKNIESSRKNLV
FT                   AIAKQARSDARNIDSQGLAPLIQRNRASLDNILQNMYLFNGSIRNIHALDTETLVATSS
FT                   NMFSAMHTFDWNIYTNLLDVLEIQSKPAPAPMENPDLPGALPEEVQDAVAEDVSGTHRL
FT                   HHQVLKRRCADLKNMISQLQKSINKWGMAKAIVLGIVAVLFCVLSAIFIGQNILSLLIL
FT                   SCVGLLLTQVCPLIFDRISKSKEFEKQVLETAQSLIPATKILPSEFNNKDLNRLAKLQD
FT                   NLNLEGFGPTWARNIVSDLEGIPTKEKSLKDLTKEFRKDSKNLNKRIKRRFKEGLGQEA
FT                   PVVRPTIPQDIRGAEVFAELHRELEHLQKQKEEISIRGDALVQERMGLCLEKSKYDNEK
FT                   AHAAAMTKKVGKLQNIDRLQKNNETYVRIQNFFRTLIQEKLGRDTVQEIDVVKEAKELH
FT                   ELAAIIYGNTSGKSQKQRAKKQFKENVLHIAGKGQLELLEAYLNVTASQGLCRHQMQAS
FT                   FRERILLNPDGAKHGEAERTLASREEMLKTLGLSYLTPFVRFSSPESTQSGYNQILKVR
FT                   EQLFDIEQRLQNQETVSPEDYAAVQAALAAYVRKHESLIVSTYGLGAQEGQTSSKVTTL
FT                   MRDLHAVEELVEMGVETYRLNRSDQILHRVHSVLHSHLRDCDSSGNGIIDVVKKLFELL
FT                   NNNGNNPNDPECQKYMQILLDAPVSLLYGAFKSFKNEFLLNFTELNIANSTKAAEEEAK
FT                   RYVEEKGRGFETYWEEAKQRLEAIAAELDDLRNQETLLEQEIRLANLKISIFSDLNLRE
FT                   KVSVEKAALEEEIQGIQEQYAEMQGIEDLELKQKFEDLQKKLEALEERLLQIGRRIDSS
FT                   VDKQKELLGLLGREEAA"
FT   gene            complement(192622..194142)
FT                   /gene="mhpA"
FT                   /locus_tag="CPn_0151"
FT   CDS_pept        complement(192622..194142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="CPn_0151"
FT                   /product="Monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18304"
FT                   /db_xref="GOA:A0A0F7X2Y1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X2Y1"
FT                   /protein_id="AAD18304.1"
FT                   /translation="MADILVIGANPTGLILANMLIQHGISVKVIDHRASPEDPSFLDCR
FT                   KLPVILSCSSLELLHNSEMLGDFIQANHKIFGARYHWKKRTLLFKFSQATDSPVPFSLS
FT                   TTYQSLEQHLIDEFLKRGGVIDWSTRPVTLVDNSIFIESTKVSQNFENREIYNPKWIIA
FT                   CEADNNLDIRDLVKSQLRARRINREVIFINCDEGEPFEEDHIHLLPITKNFLNFVFYNP
FT                   QEKTKQLCLPQGTHSISPKLKQKLLYTYNLVISDENFHIKTSHHAFPPEHGNVLFLGSL
FT                   SNTLLLSYLNGINTNIHAAFNLAWKLLPVLKKAALKHLVITKEQEDGNILPYISPTTEK
FT                   RAKKLPFSRFYTPALMYYFLKGCRKFNTTGEEYYYPPHQALKYRSSDIIKMSPQDKEIH
FT                   GPGPGMRAIDARLENGSFLLDPLKSSKHLLIFFKDIPDLKEALQEEYGEWIEICNVKEP
FT                   RILNLYHANPNSLFIIRPDRYIGYRTHTFKLHELISYLLRIFASEKTS"
FT   gene            complement(194315..195265)
FT                   /locus_tag="CPn_0152"
FT   CDS_pept        complement(194315..195265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0152"
FT                   /product="CT149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18305"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WTK4"
FT                   /protein_id="AAD18305.1"
FT                   /translation="MRKVAFLVSCLFSVAIGASAAPVRVPGFPQIPEDLVQIKTEVCPK
FT                   QEVCLAVTIKCDDHNLIGVLHLPNTPTPEGGFPTVVLFHGFRGTKFGGLTGAYRKLGRK
FT                   FAAVGIATLRVDMAGCGDSEGVAEEVPIETYLRDAQTILETVQEHPDLNAYRLGISGFS
FT                   LGCHIAFELAKIYNPRDLNIKALSVWAPIADGGILLKELYENFSKHGEGDIISVGKDFG
FT                   FGPPPIIVCSGDVDLLIRIQDHVTANSLPTKPYILHQQGIDDTLVSRTQQTLFKNTAPG
FT                   RMTFISYPNTGHNLATAPDLDMILDQIVSHFQRTL"
FT   gene            195433..197895
FT                   /gene="leuS"
FT                   /locus_tag="CPn_0153"
FT   CDS_pept        195433..197895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="CPn_0153"
FT                   /product="Leucyl tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18306"
FT                   /db_xref="GOA:Q9Z930"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z930"
FT                   /protein_id="AAD18306.1"
FT                   /translation="MRYDPNLIEKKWQQFWKEHRSFQANEDEDKVKYYVLDMFPYPSGA
FT                   GLHVGHLIGYTATDIVARYKRARGFSVLHPMGWDSFGLPAEQYAIRTGTHPKVTTQKNI
FT                   ANFKKQLSAMGFSYDEGREFATSDPDYYHWTQKLFLFLYDQGLAYMADMAVNYCPELGT
FT                   VLSNEEVENGFSIEGGYPVERKMLRQWILKITAYADKLLEGLDALDWPENVKQLQKNWI
FT                   GKSEGALVTFHLTQEGSLEAFTTRLDTLLGVSFLVIAPEHPDLDSIVSEEQRDEVTAYV
FT                   QESLRKSERDRISSVKTKTGVFTGNYAKHPITGNLLPVWISDYVVLGYGTGVVMGVPAH
FT                   DERDREFAEMFSLPIHEVIDDNGVCIHSNYNDFCLNGLSGQEAKDYVINYLEMRSLGRA
FT                   KTMYRLRDWLFSRQRYWGEPIPIIHFEDGTHRPLEDDELPLLPPNIDDYRPEGFGQGPL
FT                   AKAQDWVHIYDEKTGRPGCRETYTMPQWAGSCWYYLRFCDAHNSQLPWSKEKESYWMPV
FT                   DLYIGGAEHAVLHLLYSRFWHRVFYDAGLVSTPEPFKKLINQGLVLASSYRIPGKGYVS
FT                   IEDVREENGTWISTCGEIVEVRQEKMSKSKLNGVDPQVLIEEYGADALRMYAMFSGPLD
FT                   KNKTWSNEGVGGCRRFLNRFYDLVTSSEVQDIEDRDGLVLAHKLVFRITEHIEKMSLNT
FT                   IPSSFMEFLNDFSKLPVYSKRALSMAVRVLEPIAPHISEELWVILGNPPGIDQAAWPQI
FT                   DESYLVAQTVTFVVQVNGKLRGRLEVAKEAPKEEVLSLSRSVVAKYLENAQIRKEIYVP
FT                   NKLVNFVL"
FT   gene            197892..199205
FT                   /gene="gseA"
FT                   /locus_tag="CPn_0154"
FT   CDS_pept        197892..199205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gseA"
FT                   /locus_tag="CPn_0154"
FT                   /product="KDO Transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18307"
FT                   /db_xref="GOA:Q46222"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46222"
FT                   /protein_id="AAD18307.1"
FT                   /translation="MMLRGVHRIFKCFYDVVLVCAFVIALPKLLYKMLVYGKYKKSLAV
FT                   RFGLKKPHVPGEGPLVWFHGASVGEVRLLLPVLEKFCEEFPGWRCLVTSCTELGVQVAS
FT                   QVFIPMGATVSILPLDFSIIIKSVVAKLRPSLVVFSEGDCWLNFIEEAKRIGATTLVIN
FT                   GRISIDSSKRFKFLKRLGKNYFSPVDGFLLQDEVQKQRFLSLGIPEHKLQVTGNIKTYV
FT                   AAQTALHLERETWRDRLRLPTDSKLVILGSMHRSDAGKWLPVVQKLIKEGVSVLWVPRH
FT                   VEKTKDVEESLHRLHIPYGLWSRGANFSYVPVVVVDEIGLLKQLYVAGDLAFVGGTFDP
FT                   KIGGHNLLEPLQCEVPLIFGPHITSQSELAQRLLLSGAGLCLDEIEPIIDTVSFLLNNQ
FT                   EVREAYVQKGKVFVKAETASFDRTWRALKSYIPLYKNS"
FT   gene            complement(199229..199301)
FT                   /locus_tag="CPn_t05"
FT   tRNA            complement(199229..199301)
FT                   /locus_tag="CPn_t05"
FT                   /product="tRNA-Met"
FT   gene            complement(199317..199390)
FT                   /locus_tag="CPn_t06"
FT   tRNA            complement(199317..199390)
FT                   /locus_tag="CPn_t06"
FT                   /product="tRNA-Met"
FT   gene            complement(199485..199691)
FT                   /locus_tag="CPn_0155"
FT   CDS_pept        complement(199485..199691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18308"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z929"
FT                   /protein_id="AAD18308.1"
FT                   /translation="MSFGVPFLEKLKISLIPIEEMRHELFMKTHNSSSNGFSNQEKGIR
FT                   TYFKSDLLGYEDLYFLRENINPN"
FT   gene            complement(199767..200117)
FT                   /locus_tag="CPn_0156"
FT   CDS_pept        complement(199767..200117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WDN7"
FT                   /protein_id="AAD18309.1"
FT                   /translation="MMHNIVVLSEEPGRSAFLGRTAFFPNKYPIAQGGVGIPSTIGNLF
FT                   TIWYCFYFYRAATPQSDHPDGCGFILLERLKELGAGFFYCDLRESNTTGFTLFFEGSNK
FT                   GVLKNHLFIRDE"
FT   gene            complement(200295..200723)
FT                   /locus_tag="CPn_0157"
FT   CDS_pept        complement(200295..200723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18310"
FT                   /db_xref="GOA:Q9Z927"
FT                   /db_xref="InterPro:IPR006974"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z927"
FT                   /protein_id="AAD18310.1"
FT                   /translation="MNIYQFSPGASPNWQASLMAQLNSYFCLGGETVTRIISLRPSGLI
FT                   LAKKEKAVVSTAEKILKILSFILFPLVLIALAIRYLLYNKFNKDLDRAVFFIPTEITKA
FT                   EELIIAKNPALVKEAALTVSPLFYSLPKKYQLMKVETP"
FT   gene            complement(200891..201430)
FT                   /locus_tag="CPn_0158"
FT   CDS_pept        complement(200891..201430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18311"
FT                   /db_xref="GOA:Q9Z926"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z926"
FT                   /protein_id="AAD18311.1"
FT                   /translation="MLLEDLDTDSIPWPKLYLSEDFDFAYYPESKAIIDTVAKLEKNNP
FT                   GEEFCLESKKILARYLLEQLFKLETGLNFPTSTIDGGRESFLIEFSHETKKPTVWAFIY
FT                   FYYYHSNGPKLEKDFKQAGCEVHNRLLNLGLKYRPQAGAQNDGRNGGPYGPIGFLIVWE
FT                   ENYGSVLKDHGFIKDN"
FT   gene            complement(201464..201772)
FT                   /locus_tag="CPn_0159"
FT   CDS_pept        complement(201464..201772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18312"
FT                   /db_xref="GOA:Q9Z925"
FT                   /db_xref="InterPro:IPR006974"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z925"
FT                   /protein_id="AAD18312.1"
FT                   /translation="MTPSGFSLATEEKVQVSTAEKVIKILALIFFPIILIALAIRYFLH
FT                   RKFDRKCFVIPQDTPKELELILAANPQLVEKAAREVHPGFFALPTKYQSMYIQTSKG"
FT   gene            complement(202124..203791)
FT                   /gene="pfkA_1"
FT                   /locus_tag="CPn_0160"
FT   CDS_pept        complement(202124..203791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA_1"
FT                   /locus_tag="CPn_0160"
FT                   /product="Fructose-6-P Phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18313"
FT                   /db_xref="GOA:A0A0F7WKZ4"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WKZ4"
FT                   /protein_id="AAD18313.1"
FT                   /translation="MELLSLNKSYFEIQRLRYRPEILTLLETIRSKHIQETSSPPSPPP
FT                   ELQKHIPNLCRIPEVSIYTEQETSSKPLKIGVLLSGGQAPGGHNVVIGLFDALRVFNPK
FT                   TRLFGFIKGPLGLTRGLYKDLDISVIYDYYNMGGFDMLSSSREKIKTEEQKKNILNTVK
FT                   QLKLDGLLIIGGNNSNTDTAMLAEYFLAHNCKTSVIGVPKTIDGDLKNCWIETSLGFHT
FT                   SCRTYSEMIGNLAKDALSAKKYHHFIRLMGQQASYTTLECGLQTLPNIALISELIATRK
FT                   ISLKQLSEQLALGLVRRYKSGKNYSTVLIPEGLIEHIFDTRKLIDELNVLLANGDSSIE
FT                   KILSKLSPETLKTFHLFPKDIANQLLLARDSHGNVRVSKIATEELLAVMVKKEIEKIKP
FT                   HMEFHSVSHFFGYEARAGFPSNFDCNYGIALGIISALFLVRQKTGYMITINNLAQSYTE
FT                   WQGGATPLYKMMHLENRCGTETPVIKTDSVDPKSPAVQHLLQQSDSCLVEDLYRFPGPL
FT                   QYFGKEELIDQRPLTLLWENQTHSPFQALYSTSGKRSL"
FT   gene            complement(203795..204622)
FT                   /locus_tag="CPn_0161"
FT   CDS_pept        complement(203795..204622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0161"
FT                   /product="predicted acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18314"
FT                   /db_xref="GOA:Q9Z923"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z923"
FT                   /protein_id="AAD18314.1"
FT                   /translation="MITGVVLEKHEQRTMFSLTLLNNFTTFGLLHTPLHYNPPYPIVIL
FT                   LHGLASDKTGSKRSHVRLAQELTRLGIAALRVDLLGHGDCEGELMDFSLENYKQNIREI
FT                   IEYTHSLLHIDQERLAIFGSSLGGTLALQTLPFFNKIKALAVWAPTISGELMAAEAQKN
FT                   APEVITMSQKGAITYAGMTLNPDFYTQFLKIDIVKELMPSARNLPPILYMQGEQDLLVS
FT                   INHRTLFTEAFANQDKPITILTYPDVDHAFPFAESSALSDLTQWLKRELTSGE"
FT   gene            complement(204800..205828)
FT                   /locus_tag="CPn_0162"
FT   CDS_pept        complement(204800..205828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18315"
FT                   /db_xref="GOA:Q9Z922"
FT                   /db_xref="InterPro:IPR006974"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z922"
FT                   /protein_id="AAD18315.1"
FT                   /translation="MKLYSISSDVDTPWIFQLMSKVDSYLFLGGNRIKVVSIVMQEPNL
FT                   IIGKVENVRISTIVKILKILSFLIFPLILIALALHYFLHAKYANHLLVSKILERAPQYV
FT                   PIPGRSGDTASHYKLTTLVPVSQKNLQAMGSNPLEVEAALRTTKPSFFCVPAKYRQIII
FT                   SSHGIRFSLDLEQLADDINLDSVSWPTEYLNSTMDFCSKADKRVIQNVQNLRTGTYINS
FT                   VGKRSLLKFMLQHLFIDGITQENPEALPNNTSGRLTLFPSVRYIYSHFTPQNPTIWPQV
FT                   FFRQGPLDEDRGGGFEILEQLQELGVRFPICPSQGPDNPNFQGFQGIRIYWEDSYQPNK
FT                   EV"
FT   gene            206026..206397
FT                   /locus_tag="CPn_0163"
FT   CDS_pept        206026..206397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7YXH0"
FT                   /protein_id="AAD18316.1"
FT                   /translation="MRAGGSLVTTYPKEGQRLRSPEQLRVLDDLVQSYPNHLHAIELDC
FT                   GAIPQDLIGATYIITFADFSTYILSLRSYQANSPSDDTWGIWFGSIDDPVQAVISFLKD
FT                   HGFALPSTLAQDPLLCTNK"
FT   gene            206498..207001
FT                   /locus_tag="CPn_0164"
FT   CDS_pept        206498..207001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18317"
FT                   /db_xref="GOA:A0A0H2UL83"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UL83"
FT                   /protein_id="AAD18317.1"
FT                   /translation="MTRSTIESSDSLCSRSFSQKLSVQTLKNLCESRLMKITSLVIAFL
FT                   TLIVGGALIALAGGGVLSFPLGLILGSVLVLFSSIYLVSCCKFFTLKEMTMTCSVKSKI
FT                   NIWFEKQRNKDIEKALENPDLFGENKRNVGNRSARNQLEMILHETDGIILKRYMKGAKM
FT                   YFYL"
FT   gene            206998..207585
FT                   /locus_tag="CPn_0165"
FT   CDS_pept        206998..207585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z919"
FT                   /protein_id="AAD18318.1"
FT                   /translation="MNWVPKTIDHVDPESEIDIRKVVSCYKLIKECQPEFRSLISELLG
FT                   VIRCGLRLLKRSKYQEQARTVSDEDAPLFCLTRSYYQDGYLTPLRAGPRDLINHYIHLR
FT                   RRENPKHFFSPKHPCYYARLAFNESVCVYRELFDIERLTKMYVEGDYSKEQEKNLQAIL
FT                   SFVKTLDEGKDFLIEHKDTDLIGRGFTDVFCT"
FT   gene            207630..207965
FT                   /locus_tag="CPn_0166"
FT   CDS_pept        207630..207965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18319"
FT                   /db_xref="GOA:Q9Z918"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z918"
FT                   /protein_id="AAD18319.1"
FT                   /translation="MSESINRSIHLEASTPFFIKLTNLCESRLVKITSLVISLLALVGA
FT                   GVTLVVLFVAGILPLLPVLILEIILITVLVLLFCLVLEPYLIEKPSKIKELPKVDELSV
FT                   VETDSTL"
FT   gene            complement(207974..208306)
FT                   /locus_tag="CPn_0167"
FT   CDS_pept        complement(207974..208306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18320"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z917"
FT                   /protein_id="AAD18320.1"
FT                   /translation="MWSHFPRGFFMLPFCPTILLAKPFLNSENYGLERLAATVDSYFDL
FT                   GQSQIVFLSKQDQGITVEELSAKDRKFKPGSMNCTLYTEDPILPAHNSFSNCSDIQMRT
FT                   PISPIH"
FT   gene            complement(208414..208641)
FT                   /locus_tag="CPn_0168"
FT   CDS_pept        complement(208414..208641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18321"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z916"
FT                   /protein_id="AAD18321.1"
FT                   /translation="MAFNESVRIYRKLFNTAELKQMYGAGDYEQQNEDNLKSILSFVQI
FT                   LDEKDGFDDFLATHKDTTFIGRGGADIFCS"
FT   gene            complement(208707..209501)
FT                   /locus_tag="CPn_0169"
FT   CDS_pept        complement(208707..209501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18322"
FT                   /db_xref="GOA:Q9Z915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z915"
FT                   /protein_id="AAD18322.1"
FT                   /translation="MKNVGSECSQPLVMELNTQPLRNLCESRLVKITSFVIALLALVGG
FT                   ITLTALAGAGILSFLPWLVLGIVLVVLCALFLLFSYKFCPIKELGVVYNTDSQIHQWFQ
FT                   KQRNKDLEKATENPELFGENRAEDNNRSARSQVKETLRDCDGNVLKKIYERNLDVLLFM
FT                   NWVPKTMDDVDPVSEDSIRTVISCYKLIKACKPEFRSLISELLRAMQSGLGLLSRCSRY
FT                   QERAKTVSHKDAPLFCPTHSYYRDGYLTPLRAGPRYIINRAI"
FT   gene            complement(210022..211026)
FT                   /locus_tag="CPn_0170"
FT   CDS_pept        complement(210022..211026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18323"
FT                   /db_xref="GOA:Q9Z914"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z914"
FT                   /protein_id="AAD18323.1"
FT                   /translation="MSYDTLFKNLEKEDSVHKICNEIFALVPRLNTIACTEAIIKNLPK
FT                   ADIHVHLPGTITPQLAWILGVKNGFLKWSYNSWTNHRLLSPKNPHKQYSNIFRNFQDIC
FT                   HEKDPDLSVLQYNILNYDFNSFDRVMATVQGHRFPPGGIQNEEDLLLIFNNYLQQCLDD
FT                   TIVYTEVQQNIRLAHVLYPSLPEKHARMKFYQILYRASQTFSKHGITLRFLNCFNKTFA
FT                   PQINTQEPAQEAVQWLQEVDSTFPGLFVGIQSAGSESAPGACPKRLASGYRNAYDSGFG
FT                   CEAHAGEGIETRTIFSSAKVNPEGLIEITRVTFSSLKRKQPSSLPIRVTCQLG"
FT   gene            complement(211146..212435)
FT                   /gene="guaA"
FT                   /locus_tag="CPn_0171"
FT   CDS_pept        complement(211146..212435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="CPn_0171"
FT                   /product="GMP Synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18324"
FT                   /db_xref="GOA:Q9Z913"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z913"
FT                   /protein_id="AAD18324.1"
FT                   /translation="MQSARRHLNTIFILDFGSQYTYVLAKQVRKLFVYCEVLPWNISVQ
FT                   CLKERAPLGIILSGGPHSVYENKAPHLDPEIYKLGIPILAICYGMQLMARDFGGTVSPG
FT                   VGEFGYTPIHLYPCELFKHIVDCESLDTEIRMSHRDHVTTIPEGFNVIASTSQCSISGI
FT                   ENTKQRLYGLQFHPEVSDSTPTGNKILETFVQEICSAPTLWNPLYIQQDLVSKIQDTVI
FT                   EVFDEVAQSLDVQWLAQGTIYSDVIESSRSGHASEVIKSHHNVGGLPKNLKLKLVEPLR
FT                   YLFKDEVRILGEALGLSSYLLDRHPFPGPGLTIRVIGEILPEYLAILRRADLIFIEELR
FT                   KAKLYDKISQAFALFLPIKSVSVKGDCRSYGYTIALRAVESTDFMTGRWAYLPCDVLSS
FT                   CSSRIINEIPEVSRVVYDISDKPPATIEWE"
FT   gene            complement(212437..213177)
FT                   /gene="guaB"
FT                   /locus_tag="CPn_0172"
FT   CDS_pept        complement(212437..213177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="CPn_0172"
FT                   /product="Inosine 5'-monophosphase dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18325"
FT                   /db_xref="GOA:A0A0F7XSM0"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XSM0"
FT                   /protein_id="AAD18325.1"
FT                   /translation="MEAGANVLVIDTAHAHSKGVFQTVLEIKSQFPQISLVVGNLVTAE
FT                   AAVSLAEIGVDAVKVGIGPGSICTTRIVSGVGYPQITAITNVAKALKNSAVTVIADGRI
FT                   RYSGDVVKALAAGADCVMLGSLLAGTDEAPGDIVSIDEKLFKRYRGMGSLGAMKQGSAD
FT                   RYFQTQGQKKLVPGGVEGLVAYKGSVHDVLYQILGGIRSGMGYVGAETLKDLKTKASFV
FT                   RITESGRAESHIHNIYKVQPTLNY"
FT   gene            complement(213712..213987)
FT                   /locus_tag="CPn_0173"
FT   CDS_pept        complement(213712..213987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18326"
FT                   /db_xref="GOA:Q9Z911"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z911"
FT                   /protein_id="AAD18326.1"
FT                   /translation="MDFSVFPDRFVESTSPSPIEDIDAKTLVSNCCHYCSRCLFIFLSL
FT                   LSIIICFSVYGTSGETASLVFGILSLIVLVLLIIECRNRECCRRIS"
FT   gene            214257..214727
FT                   /locus_tag="CPn_0174"
FT   CDS_pept        214257..214727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18327"
FT                   /db_xref="GOA:A0A0F7WL04"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WL04"
FT                   /protein_id="AAD18327.1"
FT                   /translation="MIMTTISNSPSPALNPELSLIPPPTLVSSGTQTSLAYTIPAQGRR
FT                   STLRIILDIFIIILGLATIISTFIVIFFLNGLNLLSTPSIISSSCLIIVGLLFLIMGLY
FT                   FMISSLDQGLVGLLQKELSQAEEREEEYIQEIEALRGAPRAESPTESPSTWL"
FT   gene            214898..215278
FT                   /locus_tag="CPn_0175"
FT   CDS_pept        214898..215278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18328"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z909"
FT                   /protein_id="AAD18328.1"
FT                   /translation="MEQPNCVIQDTTTVLYALNSFDPRLSDDTHRLGKQSPLEAENALG
FT                   EFIEGLDTNSFPLEEVAIPILPGYHPKFYLSFIDRDDQGVHYEVLDGVFLKTVAACIIE
FT                   NSFLTDSMSPELLSEVKEALKR"
FT   gene            215286..216521
FT                   /locus_tag="CPn_0176"
FT   CDS_pept        215286..216521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0176"
FT                   /product="CT153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18329"
FT                   /db_xref="GOA:A0A0F7X9F1"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X9F1"
FT                   /protein_id="AAD18329.1"
FT                   /translation="MDESDGEEASKDSAFSASFSYEFVKSSTRESKNTVTHSTASRTLY
FT                   ILRQDCSYDPRALKVDDEFRYWVEKRLDAKNPDSLNAFVKEVGTHYVASVTYGGIGFQV
FT                   LKMSYLQVEELEKEKISISVAAASSLLKSKTSNATEKGYSSYQSESSAQTVFLGGTVLP
FT                   DLQQDKLDFKDWSESIPNEPIPLAISVSSITDLIIPELFPSEDAQVLSQKKSALGQVIL
FT                   NYLESHKPKEEGPKPVQITSGFNSSSSVFTLQAAKAPKTVSFPYIDYWSTIPYLFPTLK
FT                   ETSGAQPLSFYLRFDDIFEQQNLVHNTSYILASTSVRLGYFGDSYRDYDALSFYGSWPQ
FT                   AYFDWAGYKDRCTWTLEKLNTTGDLFIRSGDEIRLKHNTSGKYLATTSMSDGYQKLTCT
FT                   TQTSDSVFIITV"
FT   gene            complement(216605..217459)
FT                   /locus_tag="CPn_0177"
FT   CDS_pept        complement(216605..217459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18330"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z907"
FT                   /protein_id="AAD18330.1"
FT                   /translation="MKQPMSLIFSSVCLGLGLGSLSSCNQKPSWNYHNTSTSEEFFVHG
FT                   NKSVSQLPHYPSAFRTTQIFSEEHNDPYVVAKTDEESRKIWREIHKNLKIKGSYIPIST
FT                   YGSLMHPKSAALTLKTYRPHPIWINGYERSFNIDTGKYLKNGSRRRTSHDGPKNRAVLN
FT                   LIKSSGRRCNAIGLEMTEEDFVIARRREGVYSLYPVEVCSYPQGNPFVIAYAWIADESA
FT                   CSKEVLPVKGYYSLVWESVSSSDSLNAFGDSFAEDYLRSTFLANGTSILCVHESYKKVP
FT                   PQP"
FT   gene            complement(217786..218052)
FT                   /locus_tag="CPn_0178"
FT   CDS_pept        complement(217786..218052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18331"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z906"
FT                   /protein_id="AAD18331.1"
FT                   /translation="MKEYLDFLVQRNVERDPQTKRHCTVSQKFGGESIDAKTTTGQLFH
FT                   IAGKTEPGHGKLCLGESILKQLLALGIITGYENREREVWVYLD"
FT   gene            complement(218053..218403)
FT                   /locus_tag="CPn_0179"
FT   CDS_pept        complement(218053..218403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18332"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z905"
FT                   /protein_id="AAD18332.1"
FT                   /translation="MQAGRSGIIPGKKAILLNVNDAKTPNYSCIFESIGFFNEQDLEAQ
FT                   HNQQAALVRKILKVVPHHFLKGLIAKLPRSLKKDRKFMSSLIFTKLSYALDLSAPMHLE
FT                   GKPNLSYEEKLD"
FT   gene            complement(218352..218906)
FT                   /locus_tag="CPn_0180"
FT   CDS_pept        complement(218352..218906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18333"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z904"
FT                   /protein_id="AAD18333.1"
FT                   /translation="MASETYPSQILHAQREVRDAYFNQADCHPARANQILEAKKICLLD
FT                   VYHTNHYSVFTFCVDNYPNLRFTFVSSKNNEMNGLSNPLDNVLVEAMVRRTHARNLLAA
FT                   CKIRNIEVPRVVGLDLRSGILISKLELKQPQFQSLTEDFVNHSTNQEEARVHQKHVLLI
FT                   SLILLCKQAVLESFQEKKRSS"
FT   gene            complement(218774..219175)
FT                   /locus_tag="CPn_0181"
FT   CDS_pept        complement(218774..219175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18334"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z903"
FT                   /protein_id="AAD18334.1"
FT                   /translation="MHELFKIDGVYYFFKKFMKLFYNNYSLNSHHEKPSSLEKAVQALD
FT                   SYFYWGGDTTDVLARDDISREIYCVRRLYIRFWIVSISQSLSRIPWRLKRILLRYCTLR
FT                   GKYVMPILIKRIAILLGLIRFSRLRKSVY"
FT   gene            complement(219331..220695)
FT                   /gene="accC"
FT                   /locus_tag="CPn_0182"
FT   CDS_pept        complement(219331..220695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="CPn_0182"
FT                   /product="Biotin Carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18335"
FT                   /db_xref="GOA:A0A0F7X5U3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X5U3"
FT                   /protein_id="AAD18335.1"
FT                   /translation="MKKVLIANRGEIAVRIIRACHDLGLSTVAVYSLADQEALHVLLAD
FT                   EAICIGEPQAAKSYLKISNILAACEITGADAVHPGYGFLSENANFASICESCGLTFIGP
FT                   SSESIAMMGDKIAAKSLAKKIKCPVIPGSEGIIEDESEGLKIAEKIGFPIVIKAVAGGG
FT                   GRGIRIVKEKDEFYRAFSAARAEAEAGFNNPNVYIEKFIENPRHLEIQVIGDTHGNYVH
FT                   LGERDCTIQRRRQKLIEETPSPILNAEIRVKVGKVAVDLARSAGYFSVGTVEFLLDKDK
FT                   KFYFMEMNTRIQVEHTITEEVTGIDLVKEQIHVAMGNKLPWKQKNIEFSGHIIQCRINA
FT                   EDPTNNFSPSPGRLDYYLPPAGPSIRVDGACYSGYAIPPYYDSMIAKVIAKGKNREEAI
FT                   AIMKRALKEFHIGGVQSTIPFHQFMLDNPKFLESNYDINYIDNLLAQGNSFFKEF"
FT   gene            complement(220692..221195)
FT                   /gene="accB"
FT                   /locus_tag="CPn_0183"
FT   CDS_pept        complement(220692..221195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="CPn_0183"
FT                   /product="Biotin Carboxyl Carrier Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18336"
FT                   /db_xref="GOA:Q9Z901"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z901"
FT                   /protein_id="AAD18336.1"
FT                   /translation="MDLKQIEKLMIAMGRNGMKRFAIKREGLELELERDTREGNRQEPV
FT                   FYDSRLFSGFSQERPIPTDPKKDTIKETTTENSETSTTTSSGDFISSPLVGTFYGSPAP
FT                   DSPSFVKPGDIVSEDTIVCIVEAMKVMNEVKAGMSGRVLEVLITNGDPVQFGSKLFRIA
FT                   KDAS"
FT   gene            complement(221218..221775)
FT                   /gene="efp_1"
FT                   /locus_tag="CPn_0184"
FT   CDS_pept        complement(221218..221775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp_1"
FT                   /locus_tag="CPn_0184"
FT                   /product="Elongation Factor P"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18337"
FT                   /db_xref="GOA:Q9Z900"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z900"
FT                   /protein_id="AAD18337.1"
FT                   /translation="MVLSSQLSVGMFISTKDGLYKVTSVSKVAGPKGESFIKVALQAAD
FT                   SDVVIERNFKATQEVKEAQFETRTLEYLYLEDESYLFLDLGNYEKLFIPQEIMKDNFLF
FT                   LKAGVTVSAMVYDNVVFSVELPHFLELMVSKTDFPGDSLSLSGGVKKALLETGIEVMVP
FT                   PFVEIGDVIKIDTRTCEYIQRV"
FT   gene            complement(221762..222451)
FT                   /gene="rpe"
FT                   /locus_tag="CPn_0185"
FT   CDS_pept        complement(221762..222451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="CPn_0185"
FT                   /product="Ribulose-P Epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18338"
FT                   /db_xref="GOA:Q9Z8Z9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Z9"
FT                   /protein_id="AAD18338.1"
FT                   /translation="MKKQESVLVGPSIMGADLTCLGVEAKKLEQAGSDFIHIDIMDGHF
FT                   VPNLTFGPGIIAAINRSTDLFLEVHAMIYNPFEFIESFVRSGADRIIVHFEASEDIKEL
FT                   LSYIKKCGVQAGLAFSPDTSIEFLPSFLPFCDVVVLMSVYPGFTGQSFLPNTIEKIAFA
FT                   RHAIKTLGLKDSCLIEVDGGIDQQSAPLCRDAGADILVTASYLFEADSLAMEDKILLLR
FT                   GENYGVK"
FT   gene            222899..224071
FT                   /locus_tag="CPn_0186"
FT   CDS_pept        222899..224071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0186"
FT                   /product="similarity to CT119 IncA"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18339"
FT                   /db_xref="GOA:Q9Z8Z8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Z8"
FT                   /protein_id="AAD18339.1"
FT                   /translation="MSSPVNNTPSAPNIPIPAPTTPGIPTTKPRSSFIEKVIIVAKYIL
FT                   FAIAATSGALGTILGLSGALTPGIGIALLVIFFVSMVLLGLILKDSISGGEERRLREEV
FT                   SRFTSENQRLTVITTTLETEVKDLKAAKDQLTLEIEAFRNENGNLKTTAEDLEEQVSKL
FT                   SEQLEALERINQLIQANAGDAQEISSELKKLISGWDSKVVEQINTSIQALKVLLGQEWV
FT                   QEAQTHVKAMQEQIQALQAEILGMHNQSTALQKSVENLLVQDQALTRVVGELLESENKL
FT                   SQACSALRQEIEKLAQHETSLQQRIDAMLAQEQNLAEQVTALEKMKQEAQKAESEFIAC
FT                   VRDRTFGRRETPPPTTPVVEGDESQEEDEGGTPPVSQPSSPVDRATGDGQ"
FT   gene            224248..225048
FT                   /locus_tag="CPn_0187"
FT   CDS_pept        224248..225048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0187"
FT                   /product="predicted methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18340"
FT                   /db_xref="GOA:Q9Z8Z7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Z7"
FT                   /protein_id="AAD18340.1"
FT                   /translation="MHSKFLSRRKKNSSHKEETSWDCIASSYNKIVQDKGHYYHRETIL
FT                   PQLLPSLTLGSKSSVLDIGCGQGFLERALPKECRYLGIDISSRLIALAKKMRSVNSHQF
FT                   KVADLSKRLEFVEPTLFSHAVAILSLQNMEFPGEAIRNTATLLEPLGQFFIVLNHPCFR
FT                   IPRASSWHYDENKKAISRHIDRYLSPMKIPIMAHPGQKDSPSTLSFHFPLSYWFKELSS
FT                   HGFLVSGLEEWTSSKTSTGKRAKAENLCRKEFPLFLMISCIKIK"
FT   gene            225111..226403
FT                   /locus_tag="CPn_0188"
FT   CDS_pept        225111..226403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0188"
FT                   /product="CT132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18341"
FT                   /db_xref="GOA:A0A0F7WHU6"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WHU6"
FT                   /protein_id="AAD18341.1"
FT                   /translation="MFRKLFPFSKKKTGQKQRLRNNGLLQAIIQSIKVLLHNEASKEAC
FT                   VLSYYGLLTCVPILVFFLRLSQHLFTNLNWKEWLIIKFPDYKKPIVAIVEAAYHATESN
FT                   IGLVLVGSFFVFCWAGILMLLSLEDGLNKIFRTSWTPISLKRLVSYFVITLVSPMIFII
FT                   VCGSWIYITQIMPIQYAKLFSLSHSMTALYFISRFVPYLLLYLALFCCYAFLPRVAIQK
FT                   TSALISTLIIGSVWIVFQKAFFSLQVSIFNYSFTYGALVALPSFLLLLYIYTMIYLFGG
FT                   ALTFIIQNRGCTFIFLGDKILPSCYLQLITSTYILALTTRQFNEGLSPLTAQFIAKQSK
FT                   VPIGEVSQCLDVLEKEGFLFPYNNGYQPVFNFSELTIKDIADKLLHREIFKKFNPDLGI
FT                   TFIENSFQNIFNQASKNKENLTLSEIARRIK"
FT   gene            226400..229828
FT                   /locus_tag="CPn_0189"
FT   CDS_pept        226400..229828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0189"
FT                   /product="CT131 homolog-(Possible Transmembrane Protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18342"
FT                   /db_xref="GOA:A0A0F7XL85"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XL85"
FT                   /protein_id="AAD18342.1"
FT                   /translation="MKRRSWLKILGICLGSSIVLGFLIFLPQLLSTESRKYLVFSLIHK
FT                   ESGLSCSAEELKISWFGRQTARKIKLTGEAKDEVFSAEKFELDGSLLRLLIYKKPKGIT
FT                   LSGWSLKINEPASIDHPSVSHLDPGSLLTYLNDCKIISEHGFITMKTVSGSSLSVSGFY
FT                   LEKSSEKFMTKCVVSEDQQSGNIFIESVLSPDVSISAQFSSVPVAFFKIFIASPFWDHL
FT                   LSYEDIINLSAEATHTNDGKISMTASGEGNQIQMKLQGHIHKSTFYIVEGSSSFIELKP
FT                   ELASALCNQIIPLSTPITSKQIHATVSYAKIPLDITKWKHIEITSQAQLPEVAIHPKDP
FT                   NLALQLRDTKLGIKKTEKFSDIRYSSSTVLGGASPSHLNGLISIDNKKHLTKFRLQQAQ
FT                   LPHTYLRAIFPQPFVINVPLDVAYYSLNIEGTYKNAHLEADAILDNPLLKLSCSMSGTW
FT                   KNFLFKGQGTYHFNKKWQEILSPHFSYAEARFSGKAQITDTNLFFPKFSGKITARENEL
FT                   LIHAKFGSPNEPIKPETTSILIHGQFCSLPLSLVSNHLAPFHLKKLTFSFHTDGGKFVT
FT                   KGNLQALIENPDYPDLNNTRILIPDLLLSLDESSTSPSSKDLKIQGSGEIFSLPLDSIT
FT                   KTYGKQVRLSPYFGSSGDLNFVVNYNPKDQNKLTLLSNFKSEALLGELKLVMDFSMKLS
FT                   SGTQGTLQWEVSPERYASFFKNASCSPTCLLHRTANVRLDISKLSCPEETKGLSCLTLL
FT                   AAGGLEGSLEATPLIFYDNVSKETFIINDFKGSLRANNLDAKIEYDLKGSCLAPRQDSK
FT                   TLAEFSLEGQVDHLFSPESREFKQTANWIHIPSSFIAGIIPMSPGLKAQISSLAGPRIN
FT                   VSIKNAFRFGEGPVDIMVDSENLQAQIPLILNEKSILLRENLTAHLSINEDVNKAFLQE
FT                   FNPLLAGGAYSQYPVTLEIDKQNFYLPIRPYSFEEFRIQSATLDMGKISIANTGTMYAL
FT                   FQFLDITDQKQFVESWFTPIFFSVQKGSIICKRLDALIDRRIRLALWGKTDIAHDRLFM
FT                   TLGIDPEVIKKYFHNTSLKTKNFFLIKIRGSISSPEVDWSSAYARIALLKSYSLGNPFS
FT                   SLADKLFSSLGDSTPPPTVHPFPWEKSNFDSIENK"
FT   gene            229919..231277
FT                   /locus_tag="CPn_0190"
FT   CDS_pept        229919..231277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18343"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Z4"
FT                   /protein_id="AAD18343.1"
FT                   /translation="MRKRHSFDSTSTKKEAVSKAIQKIIKIMETTDPSLNVETPNAEIE
FT                   SILQEIKEIKQKLSKQAEDLGLLEKYCSQETLSNLENTNASLKLSIGSVIEELASLKQL
FT                   VEESIEESLGQQDQLIQSVLIEISDKFLSSIGETLSGNLDMNQNVIQGLLIKENPEKSE
FT                   AASVGYVQTLLEPLSKRIGETHKKVATHDVNISSLQFHMMSVAGGRFRGHIDMNGYRVL
FT                   GLGEPKNGEDAVSKDYLERYVSSQLTIDKVEDKPITKPNKGKLLYSQGTSPKLESPLPL
FT                   GLLTSGISGFTWKSASKSNDGSFPFSALRHKETESDTDCFQITSTTLSGNQAGTYTWSL
FT                   SLKVLVPSIFQIEKPEVQLSLVYSYEDWLPIDNIFNMSQPRTIPLALLGQTMLAGQKYD
FT                   ILELAAHQTNQTLMISPNCSRFSLQLKQTNQFENSPVDFYIVHAAHSCHWSGF"
FT   gene            complement(231311..231991)
FT                   /gene="glnQ"
FT                   /locus_tag="CPn_0191"
FT   CDS_pept        complement(231311..231991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="CPn_0191"
FT                   /product="ABC Amino Acid Transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18344"
FT                   /db_xref="GOA:Q9Z8Z3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Z3"
FT                   /protein_id="AAD18344.1"
FT                   /translation="MTIRVRNLAYSVNKKKILDGVTFSLERGHITLFVGKSGSGKTMIL
FT                   RALAGLVQPTQGDIWIEGEAPALVFQQPELFSHMTVLGNCTHPQIHIKGRSTEEAREKA
FT                   FELLHLLDIEEVAKNYPDQLSGGQKQRVAIVRSLCMDKHTLLFDEPTSALDPFATASFR
FT                   HLLETLRDQELTVGLTTHDMQFVHSCLDRIYLIDQGTVAGVYDKRDGELDSGHPLSKYI
FT                   HSAQ"
FT   gene            complement(231981..232634)
FT                   /gene="glnP"
FT                   /locus_tag="CPn_0192"
FT   CDS_pept        complement(231981..232634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="CPn_0192"
FT                   /product="ABC Amino Acid Transporter Permease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18345"
FT                   /db_xref="GOA:Q9Z8Z2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Z2"
FT                   /protein_id="AAD18345.1"
FT                   /translation="MDHWLAIARLLLRGCGYTLCVSGIGILCGSILGLLIGTVTSLYFP
FT                   SKLTKLLANSYVTVIRGTPLFIQILIIYFGLPEVLPIEPTPLVAGIIALSMNSAAYLAE
FT                   NIRGGINSLSIGQWESAMVLGYKKYQIFVYIIYPQVFKNILPSLTNEFVSLIKESSILM
FT                   VVGVPELTKVTKDIVSRELNPMEMYLICAGLYFLMTTSFSCISRLSEKRRSYDN"
FT   gene            complement(232683..233126)
FT                   /gene="argR"
FT                   /locus_tag="CPn_0193"
FT   CDS_pept        complement(232683..233126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="CPn_0193"
FT                   /product="Arginine Repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18346"
FT                   /db_xref="GOA:Q9Z8Z1"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Z1"
FT                   /protein_id="AAD18346.1"
FT                   /translation="MKKKVTIDEALKEILRLEGAATQEELCAKLLAQGFATTQSSVSRW
FT                   LRKIQAVKVAGERGARYSLPSSTEKTTTRHLVLSIRHNASLIVIRTVPGSASWIAALLD
FT                   QGLKDEILGTLAGDDTIFVTPIDEGRLPLLMVSIANLLQVFLD"
FT   gene            233210..234244
FT                   /gene="gcp_2"
FT                   /locus_tag="CPn_0194"
FT   CDS_pept        233210..234244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp_2"
FT                   /locus_tag="CPn_0194"
FT                   /product="O-Sialoglycoprotein Endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18347"
FT                   /db_xref="GOA:Q9Z8Z0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Z0"
FT                   /protein_id="AAD18347.1"
FT                   /translation="MLTLGLESSCDETACAIVNEDKQILANIIASQDIHASYGGVVPEL
FT                   ASRAHLHIFPQVINKALQQANLLIEDMDLIAVTQTPGLIGSLSVGVHFGKGIAIGAKKS
FT                   LIGVNHVEAHLYAAYMAAQNVQFPALGLVVSGAHTAAFFIENPTSYKLIGKTRDDAIGE
FT                   TFDKVGRFLGLPYPAGPLIEKLALEGSEDSYPFSPAKVPNYDFSFSGLKTAVLYAIKGN
FT                   NSSPRSPAPEISLEKQRDIAASFQKAACTTIAQKLPTIIKEFSCRSILIGGGVAINEYF
FT                   RSAIQTACNLPVYFPPAKLCSDNAAMIAGLGGENFQKNSSIPEIRICARYQWESVSPFS
FT                   LASP"
FT   gene            234190..235788
FT                   /gene="oppA_1"
FT                   /locus_tag="CPn_0195"
FT   CDS_pept        234190..235788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA_1"
FT                   /locus_tag="CPn_0195"
FT                   /product="Oligopeptide Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18348"
FT                   /db_xref="GOA:Q9Z8Y9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Y9"
FT                   /protein_id="AAD18348.1"
FT                   /translation="MRKISVGICITILLSLSVVLQGCKESSHSSTSRGELAINIRDEPR
FT                   SLDPRQVRLLSEISLVKHIYEGLVQENNLSGNIEPALAEDYSLSSDGLTYTFKLKSAFW
FT                   SNGDPLTAEDFIESWKQVATQEVSGIYAFALNPIKNVRKIQEGHLSIDHFGVHSPNEST
FT                   LVVTLESPTSHFLKLLALPVFFPVHKSQRTLQSKSLPIASGAFYPKNIKQKQWIKLSKN
FT                   PHYYNQSQVETKTITIHFIPDANTAAKLFNQGKLNWQGPPWGERIPQETLSNLQSKGHL
FT                   HSFDVAGTSWLTFNINKFPLNNMKLREALASALDKEALVSTIFLGRAKTADHLLPTNIH
FT                   SYPEHQKQEMAQRQAYAKKLFKEALEELQITAKDLEHLNLIFPVSSSASSLLVQLIREQ
FT                   WKESLGFAIPIVGKEFALLQADLSSGNFSLATGGWFADFADPMAFLTIFAYPSGVPPYA
FT                   INHKDFLEILQNIEQEQDHQKRSELVSQASLYLETFHIIEPIYHDAFQFAMNKKLSNLG
FT                   VSPTGVVDFRYAKEN"
FT   gene            235939..237522
FT                   /gene="oppA_2"
FT                   /locus_tag="CPn_0196"
FT   CDS_pept        235939..237522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA_2"
FT                   /locus_tag="CPn_0196"
FT                   /product="Oligopeptide Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18349"
FT                   /db_xref="GOA:Q9Z8Y8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Y8"
FT                   /protein_id="AAD18349.1"
FT                   /translation="MLRFFAVFISTLWLITSGCSPSQSSKGIFVVNMKEMPRSLDPGKT
FT                   RLIADQTLMRHLYEGLVEEHSQNGEIKPALAESYTISEDGTRYTFKIKNILWSNGDPLT
FT                   AQDFVSSWKEILKEDASSVYLYAFLPIKNARAIFDDTESPENLGVRALDKRHLEIQLET
FT                   PCAHFLHFLTLPIFFPVHETLRNYSTSFEEMPITCGAFRPVSLEKGLRLHLEKNPMYHN
FT                   KSRVKLHKIIVQFISNANTAAILFKHKKLDWQGPPWGEPIPPEISASLHQDDQLFSLPG
FT                   ASTTWLLFNIQKKPWNNAKLRKALSLAIDKDMLTKVVYQGLAEPTDHILHPRLYPGTYP
FT                   ERKRQNERILEAQQLFEEALDELQMTREDLEKETLTFSTFSFSYGRICQMLREQWKKVL
FT                   KFTIPIVGQEFFTIQKNFLEGNYSLTVNQWTAAFIDPMSYLMIFANPGGISPYHLQDSH
FT                   FQTLLIKITQEHKKHLRNQLIIEALDYLEHCHILEPLCHPNLRIALNKNIKNFNLFVRR
FT                   TSDFRFIEKL"
FT   gene            237578..238885
FT                   /gene="oppA_3"
FT                   /locus_tag="CPn_0197"
FT   CDS_pept        237578..238885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA_3"
FT                   /locus_tag="CPn_0197"
FT                   /product="Oligopeptide Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18350"
FT                   /db_xref="GOA:Q9Z8Y7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Y7"
FT                   /protein_id="AAD18350.1"
FT                   /translation="MFSRWITLFLLFISLTGCSSYSSKHKQSLIIPIHDDPVAFSPEQA
FT                   KRAMDLSIAQLLFDGLTRETHRESNDLELAIASRYTVSEDFCSYTFFIKDSALWSDGTP
FT                   ITSEDIRNAWEYAQENSPHIQIFQGLNFSTPSSNAITIHLDSPNPDFPKLLAFPAFAIF
FT                   KPENPKLFSGPYTLVEYFPGHNIHLKKNPNYYDYHCVSINSIKLLIIPDIYTAIHLLNR
FT                   GKVDWVGQPWHQGIPWELHKQSQYHYYTYPVEGAFWLCLNTKSPHLNDLQNRHRLATCI
FT                   DKRSIIEEALQGTQQPAETLSRGAPQPNQYKKQKPLTPQEKLVLTYPSDILRCQRIAEI
FT                   LKEQWKAAGIDLILEGLEYHLFVNKRKVQDYAIATQTGVAYYPGANLISEEDKLLQNFE
FT                   IIPIYYLSYDYLTQDFIEGVIYNASGAVDLKYTYFP"
FT   gene            239169..240749
FT                   /gene="oppA_4"
FT                   /locus_tag="CPn_0198"
FT   CDS_pept        239169..240749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA_4"
FT                   /locus_tag="CPn_0198"
FT                   /product="Oligopeptide Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18351"
FT                   /db_xref="GOA:A0A0H2ULD1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULD1"
FT                   /protein_id="AAD18351.1"
FT                   /translation="MHRLKPTLKSLIPNLLFLLLTLSSCSKQKQEPLGKHLVIAMSHDL
FT                   ADLDPRNAYLSRDASLAKALYEGLTRETDQGIALALAESYTLSKDHKVYTFKLRPSVWS
FT                   DGTPLTAYDFEKSIKQLYFEEFSPSIHTLLGVIKNSSAIHNAQKSLETLGIQAKDDLTL
FT                   VITLEQPFPYFLTLIARPVFSPVHHTLRESYKKGTPPSTYISNGPFVLKKHEHQNYLIL
FT                   EKNPHYYDHESVKLDRVTLKIIPDASTATKLFKSKSIDWIGSPWSAPISNEDQKVLSQE
FT                   KILTYSVSSTTLLIYNLQKPLIQNKALRKAIAHAIDRKSILRLVPSGQEAVTLVPPNLS
FT                   QLNLQKEISTEERQTKARAYFQEAKETLSEKELAELSILYPIDSSNSSIIAQEIQRQLK
FT                   DTLGLKIKIQGMEYHCFLKKRRQGDFFIATGGWIAEYVSPVAFLSILGNPRDLTQWRNS
FT                   DYEKTLEKLYLPHAYKENLKRAEMIIEEETPIIPLYHGKYIYAIHPKIQNTFGSLLGHT
FT                   DLKNIDILS"
FT   gene            241042..241986
FT                   /gene="oppB_1"
FT                   /locus_tag="CPn_0199"
FT   CDS_pept        241042..241986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB_1"
FT                   /locus_tag="CPn_0199"
FT                   /product="Oligopeptide Permease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18352"
FT                   /db_xref="GOA:Q9Z8Y5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Y5"
FT                   /protein_id="AAD18352.1"
FT                   /translation="MFSYIKNRILFNLLSLWIVLTLTFLVMKTIPGDPFNDEGCNVLSE
FT                   EVLQTLKSRYGLDKPLYQQYTQYLHSIAKLDFGNSLVYKDRKVTNIISTAFPISAILGL
FT                   QSLFLSIGGGIALGTIAALKKKKQRRYILGASILQISIPAFIFATLLQYVFAVKIPLLP
FT                   IACWGSFTHTILPTLALAVTPMAFIIQLTYSSVSAALNKDYVLLAYAKGLSPLKVVIKH
FT                   ILPYAIFPTISYSAFLTTTVITGTFAIENIFCIPGLGKWFICSIKQRDYPVALGLSVFY
FT                   GTLFMLSSLLSDLIQSIIDPQIRYAHGKEKKRK"
FT   gene            242017..242871
FT                   /gene="oppC_1"
FT                   /locus_tag="CPn_0200"
FT   CDS_pept        242017..242871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC_1"
FT                   /locus_tag="CPn_0200"
FT                   /product="Oligopeptide Permease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18353"
FT                   /db_xref="GOA:Q9Z8Y4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Y4"
FT                   /protein_id="AAD18353.1"
FT                   /translation="MENLSSAPSRSIWKSIIQNKMLVLGLTTLIILMLGALLLPWFYQD
FT                   YEQTSLKDILVSPCSRFPFGTDTLGRCMFARTLRGLRLSLLIATIATLIDVCVGLLWAT
FT                   VAISGGKKIDFLMMRTTEILFSLPRIPIIILLLVIFHHGLLPLILAMTITGWIPISRII
FT                   YGQFLLLKNKPFVLSAKAMHASTFHILKKHLLPNTLAPIISTLIFTIPNAIYTEAFISF
FT                   LGLGIQPPQASLGTLVKEGINAIDYYPWLFFFPSLIMIALSISFNLIGEGAKTLCLEEG
FT                   SHG"
FT   gene            242864..243718
FT                   /gene="oppD"
FT                   /locus_tag="CPn_0201"
FT   CDS_pept        242864..243718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="CPn_0201"
FT                   /product="Oligopeptide Transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18354"
FT                   /db_xref="GOA:A0A0F7XSR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XSR7"
FT                   /protein_id="AAD18354.1"
FT                   /translation="MDNYLLNIKDLTITSTNPKRTLIENLSLQLKENRNLALVGESGSG
FT                   KTTITKAILGFLPENCLIKTGSILFEDIDITKLSPKELHKIRGQKIATILQNAMGSLTP
FT                   SMRIGMQIIETLRQHHKMNKEEAYNKAMQLLTDVCIPNPKYSFSQYPFELSGGMRQRVV
FT                   IAIALASQPKLILADEPTTALDSMSQAQVLRILRNIQQQKQATILLVTHNLSLVKELCN
FT                   DICIIKDGKLIETGTVEEIFLSPKHPYTLKLLNAVSKIPIKKTSSPILKNKFQPLMSMQ
FT                   GGL"
FT   gene            243715..244503
FT                   /gene="oppF"
FT                   /locus_tag="CPn_0202"
FT   CDS_pept        243715..244503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="CPn_0202"
FT                   /product="Oligopeptide Transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18355"
FT                   /db_xref="GOA:Q9Z8Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Y2"
FT                   /protein_id="AAD18355.1"
FT                   /translation="MTTLLSIKDLSLTIRGKKILNHINLNLIKGSYLTIVGPSGSGKSS
FT                   LALTILDLLKPTTGTITFHMDPKIPRARKVQVIWQDIDSSLNPCMSIKGIISEPLNIIG
FT                   TYSKAEQNKEIYNVLDLVNLPKSVLHLKPYKLSGGQKQRIAIAKALVSKPELLICDEPL
FT                   SSLDTLNQSLILDLFQTIKKEYQNTLLFITHDMSAAYYIADTIAVMDQGSLVEHACREK
FT                   IFSTPKHTTTQDLLDAIPIFSLISTEMEPSEEYELQVASK"
FT   gene            245008..245805
FT                   /locus_tag="CPn_0203"
FT   CDS_pept        245008..245805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18356"
FT                   /db_xref="GOA:Q9Z8Y1"
FT                   /db_xref="InterPro:IPR006974"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Y1"
FT                   /protein_id="AAD18356.1"
FT                   /translation="MNTYTFSPTLQKSFSLFLLEKLDSYFFFGGTRTQILVITPTNIRL
FT                   AAKKRGCKVSTIEKIIKILSFILLPLVIIAFILRYFLHKKFDKQFLCIPKVISNEDEAL
FT                   LGSRPQAVEKAVREISPAFFSIPRKYQLIRIDTPKDDAPSILFPIGIEIILKDLCIDTL
FT                   KQSNLFLKREMDFLGHPEEKALFDSICSIEKDQEWMSLESKKLLITHFLKYLFVSGIEQ
FT                   LNPGFNPENGRGYFSEISTAKIHFHQHGRYGPIRSSGPIMKEI"
FT   gene            245817..246005
FT                   /locus_tag="CPn_0204"
FT   CDS_pept        245817..246005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18357"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Y0"
FT                   /protein_id="AAD18357.1"
FT                   /translation="MGYQIFTRLKKLGISFSSYNSINPNPYFFDEGCFVYWESQFKSAL
FT                   QDHGILQKQTETFYRNT"
FT   gene            246133..246330
FT                   /locus_tag="CPn_0205"
FT   CDS_pept        246133..246330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18358"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8X9"
FT                   /protein_id="AAD18358.1"
FT                   /translation="MLKFFLVCEELCILTVATHRALLETPLALSFFKELKTKYVYRAKD
FT                   ILQLHNYKGFTILNTSPLCS"
FT   gene            246409..247164
FT                   /locus_tag="CPn_0206"
FT   CDS_pept        246409..247164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0206"
FT                   /product="CT203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18359"
FT                   /db_xref="InterPro:IPR010602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8X8"
FT                   /protein_id="AAD18359.1"
FT                   /translation="MLMDISHILEDLAYDEGILPREAIEAAIVKQMQITPYLLHILHDA
FT                   TQRVPEIVNDGSYQGHLYAMYLLAQFRESRALPLIIKLFAFEDDTPHAIAGDVLTEDLP
FT                   RILASVCNDDSLIKELIETPKINPYVKAAAISGLVTLVGAGKIPRDKVIRYFAELLNYR
FT                   LEKQPSFAWDNLIAGICTLYPGELFYPISKAFDGGLVDTSFISMEDVENIIHEETVESC
FT                   IHTLCSSTELINDTLEEMEKWLEDFPIEP"
FT   gene            247208..248620
FT                   /gene="ybhI"
FT                   /locus_tag="CPn_0207"
FT   CDS_pept        247208..248620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhI"
FT                   /locus_tag="CPn_0207"
FT                   /product="Dicarboxylase Translocator"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18360"
FT                   /db_xref="GOA:A0A0F7WKW0"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WKW0"
FT                   /protein_id="AAD18360.1"
FT                   /translation="MNKKKRFLSLLFLTAVLLGIWFSPHPASINSNAWQLFAIFTTTIM
FT                   GIIFQPVPMGAIAIIGISTLLLTQTLTLEQGLSGFHNPIAWLVFLSFSIAKGIIKTGLG
FT                   ERIAYFFVSALGKSPLGLSYGLVITDFFLAPAIPSVTARAGGILYPVVTSLSDSFGSSA
FT                   EKGTQDLIGSFLIKVAYQSSVITSAMFLTAMAGNPLVAALAGHVGVSLSWVLWAKAAII
FT                   PGLPSLFLMPIILYKLYPPKITSCEEAIRSAKLRLKEMGPLKKEEKTILMIFFLLVVLW
FT                   TFGDLLGISATTAALIGLSLLILTNILDWQKDVIANTTAWETFIWFGALIMMASFLNQL
FT                   GFIPLVGDSAAALVSGLSWKIGFPLLFLIYFYSHYLFASNTAHIGAMYPIFLAVSISLG
FT                   TNPIFAALTLAFASNLFGGLTHYGSGPAPLYFGSHLVTVQEWWRSGFALSIVNIVIWIG
FT                   IGSLWWKALGLI"
FT   gene            248953..250605
FT                   /gene="pfkA_2"
FT                   /locus_tag="CPn_0208"
FT   CDS_pept        248953..250605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA_2"
FT                   /locus_tag="CPn_0208"
FT                   /product="Fructose-6-P Phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18361"
FT                   /db_xref="GOA:Q9Z8X6"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8X6"
FT                   /protein_id="AAD18361.1"
FT                   /translation="MHPLYVDLDTIISSYSPPLPKEFQEAASLIAVPDTSHSKPVVPGV
FT                   KTLFPQTYHLPYLKFVQGENVVHTPLKVGVMFSGGPAPGGHNVIQGLFNSLKDFHPDSS
FT                   LVGFVNNGDGLTNNKSIDITEEFLSKFRNSGGFNCIGTGRKKIVTPEAKEACLKTAEAL
FT                   DLDGLVIIGGDGSNTATAILAEYFAKRRPKTSIVGVPKTIDGDLQHTFLDLTFGFDTAT
FT                   KFYSSIISNISRDALSCKAHYHFIKLMGRSASHIALECALQTHPNIALIGEEIAEKNLP
FT                   LKTIIHKICSVIADRAAMEKYYGVILIPEGIIEFIPEIINLITEIESLSEYEDKISRLS
FT                   PESQRLLKSFPAPIIEQILNDRDAHGNVYVSKISVDKLLIHLVSNHLQQYFPNVPFNAI
FT                   SHFLGYEGRSGLPTKFDNTYGYSLGYGAGILVRNHCNGYLSTIESLACPFMKWKLRAIP
FT                   VVKMFTVKQQADGTLQPKIKKYLVDIGSTAFRKFKLYRKIWALEDSYRFLGPLQIETPP
FT                   EMHSDNFPPLTLLLNHNFWQRHQGCIEIPDTTY"
FT   gene            251036..251275
FT                   /locus_tag="CPn_0209"
FT   CDS_pept        251036..251275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18362"
FT                   /db_xref="InterPro:IPR006974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WL39"
FT                   /protein_id="AAD18362.1"
FT                   /translation="METYSFSTELQKNTSLYIMEKLDSYFSFQGKRTRVIAITPAGLAI
FT                   AYEQNIHLSMTVKILKVLSFPRSLLRTTSLWYRP"
FT   gene            complement(251437..252384)
FT                   /locus_tag="CPn_0210"
FT   CDS_pept        complement(251437..252384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18363"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8X4"
FT                   /protein_id="AAD18363.1"
FT                   /translation="MLVELEALKREFAHLKDQKPTSDQEITSLYQCLDHLEFVLLGLGQ
FT                   DKFLKATEDEDVLFESQKAIDAWNALLTKARDVLGLGDIGAIYQTIEFLGAYLSKVNRR
FT                   AFCIASEIHFLKTAIRDLNAYYLLDFRWPLCKIEEFVDWGNDCVEIAKRKLCTFEKETK
FT                   ELNESLLREEHAMEKCSIQDLQRKLSDIIIELHDVSLFCFSKTPSQEEYQKDCLYQSRL
FT                   RYLLLLYEYTLLCKTSTDFQEQARAKEEFIREKFSLLELEKGIKQTKELEFAIAKSKLE
FT                   RGCLVMRKYEAAAKHSLDSMFEEETVKSPRKDTE"
FT   gene            complement(252460..252756)
FT                   /locus_tag="CPn_0211"
FT   CDS_pept        complement(252460..252756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18364"
FT                   /db_xref="GOA:Q9Z8X3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8X3"
FT                   /protein_id="AAD18364.1"
FT                   /translation="MSYPDISNVQASSIQSALLHKTSDQIQQKRCFKQSTFVILAVSLV
FT                   IIGSLFLLAGVAILTVFSHGVLSLVFGVLGIVLGLLLLAGGVGLLVEEAKSLL"
FT   gene            complement(252885..254066)
FT                   /locus_tag="CPn_0212"
FT   CDS_pept        complement(252885..254066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18365"
FT                   /db_xref="GOA:Q9Z8X2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8X2"
FT                   /protein_id="AAD18365.1"
FT                   /translation="MVVSIYSEILSFSELTSCKHSLFPFGPIETASIRIHHVFNVVIVC
FT                   LIILGTLFVCLGMVFLGVFSTYLLGMSSMILGLLLISIGLALLKFKERYGLEPKELFGV
FT                   EGGFDKKLPSEIIQMQDQIADLARELDLEQKKDTLIRGFSARLDVLEGSKTEKKQILKI
FT                   GVPRNLSEIQERAQEQNSILEQCKEALLFRRKSAQEIFKKLYDRKAAFWRSYREDLWCY
FT                   SEIHVSKKALSNLYIGDVFEGTAPHFLMEAYAMCRTAKNLRNYVKVCVEDMRVNEEKKR
FT                   AKQLSVSELLCCCTEIETDLENETNLFTSDSEDVLEEYQIHCIRVTMLHALWAIYNDEV
FT                   VSRKPIDTLDRVRARMAVEDCIETFEELQMCVVHTKTLELEIAQLYVDILLEA"
FT   gene            complement(254187..254342)
FT                   /locus_tag="CPn_0213"
FT   CDS_pept        complement(254187..254342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULC3"
FT                   /protein_id="AAD18366.1"
FT                   /translation="MVVFSRVIFSNTNQIGIPRLELILPLWKKENDPFCFLFSRVEGTF
FT                   IILNIK"
FT   gene            complement(254443..255657)
FT                   /locus_tag="CPn_0214"
FT   CDS_pept        complement(254443..255657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18367"
FT                   /db_xref="GOA:Q9Z8X0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8X0"
FT                   /protein_id="AAD18367.1"
FT                   /translation="MVVVALFILGIFFLSGSLAFLVHTSCGVLLGAALPILCIGLVLLA
FT                   VALIVFLCHKHKTRQDLDYYDQDLDSLVIHKKEIPNDISELRVTFEKLQNLFQFHTKDF
FT                   SDLSQELQGKFINCMEKWLTLEDEVTKFLIVRDRFLETRRNFTTFGEQVKGIQSNIFDL
FT                   HEEKSSLYLELYRLRKDLQVLLNFFLLPPGILKVDYDEIEAIKGLFIRLTSRLDKLDVK
FT                   AQERKKFINEMSREFKEVEKAFDIVDRATKKLMDRAKKESPARLFMGRTESLLEMKKNE
FT                   EALKNQGLDPENLSHPELFSPYQQLLILNYLNSEIVLHHYEFLISGTVTSGLTLEECEN
FT                   RMRAASTGLNALLVRKLQFRGAIKSAYFEKLTEIEKELRSLQDVIKSLELELIHKIKDI
FT                   VTEET"
FT   gene            complement(255756..257015)
FT                   /locus_tag="CPn_0215"
FT   CDS_pept        complement(255756..257015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18368"
FT                   /db_xref="GOA:Q9Z8W9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8W9"
FT                   /protein_id="AAD18368.1"
FT                   /translation="MSSAIARDCFPSPSPQPSSTLGVHPPKYKSLILSVSLIVLGVLLL
FT                   CVGMLLLVNAIFSFSVLTVGLGGAGVFLGSLLLILGLIFFVSYHRKLSEATRSLEQKIT
FT                   LEYQPWADLRKELNEVQEWSNFLLDEWEDFKEVVAQHKSQFATFEGDLLLFGREVEKYE
FT                   TIWKELDGRDVALLTELKNIWGPLEFLRKKGDRLQCEIDKLRKEVMKVGKSGLKLACEL
FT                   TKFKSALKDVKIEQECYRDKRKVEKLEVFPEGYRRELLEVLKTRLSVEKEIQLFEEVVS
FT                   AFEEKLASLHRTVFSEEELQEALDKAKAELLDIQVRKSVVEDLSCEPTLIQYHLLRLYE
FT                   VQCRIVEQFLTQTFSSEQEKVLEEYEALKARIRKTLRVKLDQVRANVAFVASTTDLLSE
FT                   SESLDGNDSVFEDAHDDFLD"
FT   gene            complement(257171..257608)
FT                   /locus_tag="CPn_0216"
FT   CDS_pept        complement(257171..257608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18369"
FT                   /db_xref="GOA:Q9Z8W8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8W8"
FT                   /protein_id="AAD18369.1"
FT                   /translation="MNPVTFDRIQVDFIPEDTSLRINSYIVAGGLLILGVVLSILSVIC
FT                   LDIGLVGLSAGAAFTLGLGCLIFALFLFSFSLILLLSQEKRVPDVLSLYLEKEVPQYET
FT                   PLYKEDLESERDMSAISERLGIIEEKLRIAEKFRYSDSVFV"
FT   gene            257896..258582
FT                   /gene="ypdP"
FT                   /locus_tag="CPn_0217"
FT   CDS_pept        257896..258582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ypdP"
FT                   /locus_tag="CPn_0217"
FT                   /product="YpdP hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18370"
FT                   /db_xref="GOA:A0A0F7WS23"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WS23"
FT                   /protein_id="AAD18370.1"
FT                   /translation="MKGFLSVNELIFGFQTFSVVVLGVFFASRGKAWLTGWLSLLSSIM
FT                   NVFVLKQIHLWGFEVTSADVYVIGLLTCLNYAREHYEKNDINDAMLCSWVISIAFLVLT
FT                   QLHLFLIPSPNDSSQEHFLALFSSTPRIVVASLVTLIFVQIVDIKLFTFLQRVFSKKYF
FT                   AMRSTISLLFSQLIDTIIFSFLGLYGLVSNLCDVMIFAMLVKGIVITLAIPTLTVTKAV
FT                   LDRRSS"
FT   gene            complement(258579..259058)
FT                   /locus_tag="CPn_0218"
FT   CDS_pept        complement(258579..259058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18371"
FT                   /db_xref="GOA:A0A0H2ULC8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULC8"
FT                   /protein_id="AAD18371.1"
FT                   /translation="MSKKVFFESYEDFANVASSWPKSLRALVQGRYFVDSELKETPYRI
FT                   HDFKKTPIHHRLYRSLPIISTIGGIIRLIEAHSGPIHPRDKMKYRFEVLQAVIEILGLG
FT                   VLILVFDIIGCFLAFLVAIILSLLLYCNSTFTCVQNLSFTERMLEGIGEAVNFLA"
FT   gene            259357..260475
FT                   /gene="tgt"
FT                   /locus_tag="CPn_0219"
FT   CDS_pept        259357..260475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="CPn_0219"
FT                   /product="Queuine tRNA Ribosyl Transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18372"
FT                   /db_xref="GOA:Q9Z8W5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8W5"
FT                   /protein_id="AAD18372.1"
FT                   /translation="MALKFHLIHQSKKSQARVGQIETSHGVIDTPAFVPVATHGALKGV
FT                   IDHSDIPLLFCNTYHLLLHPGPEAVAKLGGLHQFMGRQAPIITDSGGFQIFSLAYGSVA
FT                   EEIKSCGKKKGMSSLVKITDEGAWFKSYRDGRKLFLSPELSVQAQKDLGADIIIPLDEL
FT                   LPFHTDQEYFLTSCSRTYVWEKRSLEYHRKDPRHQSMYGVIHGGLDPEQRRIGVRFVED
FT                   EPFDGSAIGGSLGRNLQEMSEVVKITTSFLSKERPVHLLGIGDLPSIYAMVGFGIDSFD
FT                   SSYPTKAARHGLILSKAGPIKIGQQKYSQDSSTIDPSCSCLTCLSGISRAYLRHLFKVR
FT                   EPNAAIWASIHNLHHMQQVMKEIREAILKDEI"
FT   gene            260696..261241
FT                   /locus_tag="CPn_0220"
FT   CDS_pept        260696..261241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18373"
FT                   /db_xref="GOA:Q9Z8W4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8W4"
FT                   /protein_id="AAD18373.1"
FT                   /translation="MSKESIRSYSEISTPTPIFRETPSKEGVAYKLQLRSPAKDCILRN
FT                   RVSLKGALLRSIPFYGSFLGAKRIHSAWSAKDAPCTTRVYHYLVGGLELLGLGVVVLAC
FT                   KVLATALKFLFSKASSKIKQMKWREKARNLAAKDTVQSIKEFCSVDLTSCFTRCFRLRN
FT                   RVVEEGASENQTVREIIV"
FT   gene            261657..262067
FT                   /locus_tag="CPn_0221"
FT   CDS_pept        261657..262067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18374"
FT                   /db_xref="GOA:Q9Z8W3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8W3"
FT                   /protein_id="AAD18374.1"
FT                   /translation="MVNRYKSSAEFSADHYYDDNLVRMGYKRNLRGLAPVENEVCLFEE
FT                   NNLLESVMASIPIMGSILGLGRLHSVWSTQDPKDSKISIIFHTALGILETLGLGIIVLL
FT                   IKITITILLILFTPCLLCYFMYSAAYSDFHPI"
FT   gene            262504..262845
FT                   /locus_tag="CPn_0222"
FT   CDS_pept        262504..262845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0222"
FT                   /product="hypothetical protein"
FT                   /note="weak similarity to Bacteriophage CHP1 (Orf4)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18375"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8W2"
FT                   /protein_id="AAD18375.1"
FT                   /translation="MRELNAFELTQPEEYRNRWVLMPCLKCRFCRTQHAKVWSYRCVHE
FT                   ASLYEKNCFLTLTYDDKHLPQYGSLVKLHLQLFLKRLRKMISPHKIRYFECGAYGTKLQ
FT                   RPHYHLLLS"
FT   gene            262956..263336
FT                   /locus_tag="CPn_0223"
FT   CDS_pept        262956..263336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18376"
FT                   /db_xref="GOA:Q9Z8W1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8W1"
FT                   /protein_id="AAD18376.1"
FT                   /translation="MLIGRYSSDDQFTEATKNTPTIIKLGFVRDNLEGLTNPISEIVSE
FT                   TSSSIKDSVLRSLPILGSILGCARLYSTLSTNDPLDETQEKIWHTIFGALETLGLGILI
FT                   LLFKIIFVILHCIFHLVIGFCK"
FT   gene            263435..263677
FT                   /locus_tag="CPn_0224"
FT   CDS_pept        263435..263677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18377"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8W0"
FT                   /protein_id="AAD18377.1"
FT                   /translation="MKPNSIIFLENTKHYPDIFREGFVRDRHGLMEASDWLLSTEITII
FT                   RSILGAIPILGNILGAGRLYSVWYTSDEDWKKQVV"
FT   gene            263873..264544
FT                   /locus_tag="CPn_0225"
FT   CDS_pept        263873..264544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18378"
FT                   /db_xref="GOA:Q9Z8V9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8V9"
FT                   /protein_id="AAD18378.1"
FT                   /translation="MTKNAINSQTTTPQPNLTDAEPIASRAQCKSIAVIISLFALGMLL
FT                   LCLGIILISIPIPGLAAQVALGLGIVSLILGIALANIGFLCLLLRCKQVPQKPDTLPSE
FT                   SSKQPSEGSTPTALPWQAGEFLEKVQVSATPILLPKNKDEELSAKVMKEGAEAASSIKQ
FT                   AVLESTEKLIDARKQEESRREARKKIVAEEAEASRKRIQQQMAADQEALRKRKEEVAKR
FT                   K"
FT   gene            264566..264970
FT                   /locus_tag="CPn_0226"
FT   CDS_pept        264566..264970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18379"
FT                   /db_xref="GOA:Q9Z8V8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8V8"
FT                   /protein_id="AAD18379.1"
FT                   /translation="MPYYANTLEFIQGTQSLCPLFKYGFVRHHYKGQLEIEDASHDWDF
FT                   LEPPSTWKRTLLAAIPILGSVIGLGRLFSIWSIREPQDSQEYKSIFWHTLCAVLEILGL
FT                   GIVALILKILATFIMAMPGLKRVATFLFYS"
FT   gene            complement(265006..265416)
FT                   /gene="dsbB"
FT                   /locus_tag="CPn_0227"
FT   CDS_pept        complement(265006..265416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="CPn_0227"
FT                   /product="Disulfide bond Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18380"
FT                   /db_xref="GOA:Q9Z8V7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8V7"
FT                   /protein_id="AAD18380.1"
FT                   /translation="MINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRIC
FT                   LFPLTVILGISAYREDSSIKLYILPQAVLGLGISIYQVFLQEIPGMQLDICGRVSCSTK
FT                   IFLFSYVTIPMASVVAFGAIVCLLVLTKKYRG"
FT   gene            complement(265409..266110)
FT                   /gene="dsbG"
FT                   /locus_tag="CPn_0228"
FT   CDS_pept        complement(265409..266110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="CPn_0228"
FT                   /product="Disulfide Bond Chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18381"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8V6"
FT                   /protein_id="AAD18381.1"
FT                   /translation="MNKKILVLCTAMFFIVCFGFLIHKKHTILPPKAHIPTNAKHFPTI
FT                   GNPYAPINITVFEEPSCSACAEFTTEVFPLLKKHYIDTGEISFTLIPVCFIRGSKPAAQ
FT                   ALLCIYHHDPRQADIDAYMEYFHRILTYPKEEGSHWATPEVLTKLAEGLKINSGRSVNP
FT                   KGLEQCIASGQYNEQIKKNNLYGSQVLGGQLATPTAVVGDYLIEDPTFHEIERAIQHIR
FT                   QLQAVEGDHDD"
FT   gene            266328..267563
FT                   /locus_tag="CPn_0229"
FT   CDS_pept        266328..267563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0229"
FT                   /product="CT178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18382"
FT                   /db_xref="GOA:Q9Z8V5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8V5"
FT                   /protein_id="AAD18382.1"
FT                   /translation="MDKETLENIYRHFRYRFLKLNILPAFLGLLLLCSPNTLNYTQVDV
FT                   IFSDRLCSCLLIFLAIASLTKRSLLWLGAPLGIWVTLFACVAGRSPTIFANDTLIGFAI
FT                   LAVVCISPTRPEALEVGPTLPEGFSYNPSAGGRRAAVLFLSLLGWLEARYLTASSLGIT
FT                   SSQSSNFLLLYSSIMTVYSLLVVLSLAGSERRWHTRPKIVIATALALTGVIILTLLPII
FT                   LHQLRYDCWLCLCLTIEPALAVVFAYDETRATLRYISQFLGDKRALTRASFFGSEYYKH
FT                   TLSWEERTVLPLRKAYKQAFEGISFPINQLLAILVATVFVKVNSSMGLPTFPRNFLNIC
FT                   CWFIIVLFILAFAESLRHLRWMNLIFSAAILFSPVLFHIPVESPMFLPIIVTGLILIIL
FT                   SIGKRRRTKRKL"
FT   gene            complement(267573..268253)
FT                   /locus_tag="CPn_0230"
FT   CDS_pept        complement(267573..268253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0230"
FT                   /product="CT179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18383"
FT                   /db_xref="GOA:A0A0F7XSQ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XSQ2"
FT                   /protein_id="AAD18383.1"
FT                   /translation="MSSQPLVTTSSSLSRYVVLTGEEKVACYKKAFNHIWHGAPAIILA
FT                   AALLMFCIFGFVLGSILLGAPLEGASILYDVILPWLLPSILVFVLLVLPLNIYAYSHHK
FT                   QVLALHERITQSNYKEIYDHCEKEKKTPNKKALSLYIESQVLVPEYSKRFSSMILGKTL
FT                   KIIPKKDSPESLKHDELIQKALERAKENIYMNKNQREKRDEREAKKEAKNASKTNPLWE
FT                   GLGT"
FT   gene            complement(268250..268957)
FT                   /gene="tauB"
FT                   /locus_tag="CPn_0231"
FT   CDS_pept        complement(268250..268957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="CPn_0231"
FT                   /product="ABC Transport ATPase (Nitrate/Fe)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18384"
FT                   /db_xref="GOA:Q9Z8V3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8V3"
FT                   /protein_id="AAD18384.1"
FT                   /translation="MLQAHRLCYSCDNQVILKDASFQASPGTITIILGSSGVGKTTLFR
FT                   LLAGFLPLQEGELLWNGSPLNRKDVAYMQQKEALLPWRTALKNMTLSTELGINTSHNAL
FT                   SNERLEEIIHNFDLGQLLDRYPDELSGGQRQRIALAAQCLSLKPILLLDEPFSSLDVLL
FT                   KEQLYQDIVALAKKENKTVLLVTHDFHDVSCLGDVLYVIKNKTLTPVPLDPSMRPLNNG
FT                   LCFIKDLKKHLYT"
FT   gene            268992..269065
FT                   /locus_tag="CPn_t07"
FT   tRNA            268992..269065
FT                   /locus_tag="CPn_t07"
FT                   /product="tRNA-Ile"
FT   gene            269070..269142
FT                   /locus_tag="CPn_t08"
FT   tRNA            269070..269142
FT                   /locus_tag="CPn_t08"
FT                   /product="tRNA-Ala"
FT   gene            complement(269229..270122)
FT                   /locus_tag="CPn_0232"
FT   CDS_pept        complement(269229..270122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0232"
FT                   /product="similarity to 5'-Methylthioadenosine
FT                   Nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18385"
FT                   /db_xref="GOA:A0A0F7WP41"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WP41"
FT                   /protein_id="AAD18385.1"
FT                   /translation="MRRFLFLILSSLPLVAFSADNFTILEEKQSPLSRVSIIFALPGVT
FT                   PVSFDGNCPIPWFSHSKKTLEGQRIYYSGDSFGKYFVVSALWPNKVSSAVVACNMILKH
FT                   RVDLILIIGSCYSRSQDSRFGSVLVSKGYINYDADVRPFFERFEIPDIKKSVFATSEVH
FT                   REAILRGGEEFISTHKQEIEELLKTHGYLKSTTKTEHTLMEGLVATGESFAMSRNYFLS
FT                   LQKLYPEIHGFDSVSGAVSQVCYEYSIPCLGVNILLPHPLESRSNEDWKHLQSEASKIY
FT                   MDTLLKSVLKELCSSH"
FT   gene            complement(270245..270424)
FT                   /locus_tag="CPn_0233"
FT   CDS_pept        complement(270245..270424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18386"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8V1"
FT                   /protein_id="AAD18386.1"
FT                   /translation="MFLGKVLLFLLRISRRSYVQEIGIFFHLETPDLKIVLCAFVSTFI
FT                   VVEMDVSLKNKGQS"
FT   gene            complement(270545..271240)
FT                   /locus_tag="CPn_0234"
FT   CDS_pept        complement(270545..271240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0234"
FT                   /product="CT181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8V0"
FT                   /protein_id="AAD18387.1"
FT                   /translation="MLQSCKKALLSIVVSILAFHPIPGMGVEAKSGFLGKVKGWFSKKE
FT                   IQEEARILPVKDSLSWKRYDYTSSSGFSVEFPGEPDHSGQIVEVPQSEITIRYDTYVTE
FT                   THPDNTVYVVSVWEYPEKVDISRPELNLQEGFSGMMQALPESQVLFMQARQIQGHKALE
FT                   FWIVCEDVYFRGMLISVNHTLYQVFMVYKNKNPQALDKEYEAFSQSFKITKIREPRTIP
FT                   SSVKKKVSL"
FT   gene            271416..272180
FT                   /gene="kdsB"
FT                   /locus_tag="CPn_0235"
FT   CDS_pept        271416..272180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="CPn_0235"
FT                   /product="deoxyoctulonosic Acid Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18388"
FT                   /db_xref="GOA:Q9Z8U9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U9"
FT                   /protein_id="AAD18388.1"
FT                   /translation="MKPEESECLCIGVLPARWNSSRYPGKPLAKIHGKSLIQRTYENAS
FT                   QSSLLDKIVVATDDQHIIDHVTDFGGYAVMTSPTCSNGTERTGEVARKYFPKAEIIVNI
FT                   QGDEPCLNSEVVDALVQKLRSSPEAELVTPVALTTDREEILTEKKVKCVFDSEGRALYF
FT                   SRSPIPFILKKATPVYLHIGVYAFKREALFRYLQHSSTPLSDAEDLEQLRFLEHGGKIH
FT                   VCIVDAKSPSVDYPEDIAKVEQYITCLSNAYF"
FT   gene            272156..273769
FT                   /gene="pyrG"
FT                   /locus_tag="CPn_0236"
FT   CDS_pept        272156..273769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="CPn_0236"
FT                   /product="CTP Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18389"
FT                   /db_xref="GOA:Q9Z8U8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U8"
FT                   /protein_id="AAD18389.1"
FT                   /translation="MPFKCIFLTGGVVSSLGKGLTAASLALILERQRLNVAMLKLDPYL
FT                   NVDPGTMNPFEHGEIYVTDDGVETDLDLGHYHRFSSAALSRHSSATSGQIYARVIKRER
FT                   EGDYLGSTVQVIPHITNEIIQVILDAAKEHSPDVLIVEIGGTIGDIESLPFLEAIRQFR
FT                   YDHSEDCLNIHMTYVPYLQAADEVKSKPTQHSVQTLRGIGIIPDAILCRSEKPLTQEVK
FT                   SKISLFCNVPNRAVFNVIDVKHTIYEMPLMLAQEKIANFIGEKLKLATVPENLDDWKVL
FT                   VNQLSQDLPKVKIGVVGKYVQHRDAYKSIFEALTHAALRLGHAAEIIPIDAEDENLTME
FT                   LSQCDACLVPGGFGVRGWEGKIAAAKFCREQGIPYFGICLGMQVLVVEYARNVLNLDQA
FT                   NSLEMDPNTPHPIVYVMEGQDPLVATGGTMRLGAYPCLLKPGSKAHKAYNESSLIQERH
FT                   RHRYEVNPDYIQSLEDHGLRIVGTCPPQGLCEIIEVSDHPWMIGVQFHPEFVSKLISPH
FT                   PLFIAFIEAALVYSKDASHV"
FT   gene            273762..274217
FT                   /gene="yggF"
FT                   /locus_tag="CPn_0237"
FT   CDS_pept        273762..274217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggF"
FT                   /locus_tag="CPn_0237"
FT                   /product="YggF Family hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18390"
FT                   /db_xref="GOA:Q9Z8U7"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U7"
FT                   /protein_id="AAD18390.1"
FT                   /translation="MSKPSSCKAYLGIDYGKKRIGLAYAAEPLLLTLPIGNIEAGKNLK
FT                   LSAEALHKIILSRNITCVVLGNPLPMQKGLYSSLQEEVSLLAEELKKLSTVEIILWDER
FT                   LSSVQAERMLKQDCGLSRKDRKGKTDSLAATLILTSFLDSLPKKLTL"
FT   gene            274303..275841
FT                   /gene="zwf"
FT                   /locus_tag="CPn_0238"
FT   CDS_pept        274303..275841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="CPn_0238"
FT                   /product="Glucose-6-P Dehyrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18391"
FT                   /db_xref="GOA:Q9Z8U6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U6"
FT                   /protein_id="AAD18391.1"
FT                   /translation="MTNVVQETIGGLNSPRTCPPCILVIFGATGDLTARKLLPALYHLT
FT                   KEGRLSDQFVCVGFARREKSNELFRQEMKQAVIQFSPSELDIKVWEDFQQRLFYHRSEF
FT                   DNNMGYTSLKDSLEDLDKTYGTRGNRLFYLSTPPQYFSRIIENLNKHKLFYKNQDQGKP
FT                   WSRVIIEKPFGRDLDSAKQLQQCINENLNENSVYHIDHYLGKETVQNILTTRFANTIFE
FT                   SCWNSQYIDHVQISLSETIGIGSRGNFFEKSGMLRDMVQNHMMQLLCLLTMEPPTTFDA
FT                   DEIRKEKIKILQRISPFSEGSSIVRGQYGPGTVQGVSVLGYREEENVDKDSRVETYVAL
FT                   KTVINNPRWLGVPFYLRAGKRLAKKSTDISIIFKKSPYNLFAAEECSRCPIENDLLIIR
FT                   IQPDEGVALKFNCKVPGTNNIVRPVKMDFRYDSYFQTTTPEAYERLLCDCIIGDRTLFT
FT                   GGDEVMASWKLFTPVLEEWDQDSSPSFPNYPAGSSGPKEADALIERDGRSWRPL"
FT   gene            275899..276675
FT                   /gene="devB"
FT                   /locus_tag="CPn_0239"
FT   CDS_pept        275899..276675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devB"
FT                   /locus_tag="CPn_0239"
FT                   /product="Glucose-6-P Dehyrogenase (DevB family)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18392"
FT                   /db_xref="GOA:Q9Z8U5"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U5"
FT                   /protein_id="AAD18392.1"
FT                   /translation="MATLINFNDTNKLLLTKQPSLFIDLASKDWIASANQAIKQRGAFY
FT                   VALSGGKTPLEIYKDIVINKDKLIDPSKIFLFWGDERLAPITSSESNYGQAMSILRDLN
FT                   IPDEQIFRMETENPDGAKKYQELIENKIPDASFDMIMLGLGEDGHTLSLFSNTSALEEE
FT                   NDLVVFNSVPHLETERMTLTFPCVHKGKHVVVYVQGENKKPILKSVFFSEGREEKLYPI
FT                   ERVGRDRSPLFWIISPESYDIADFDNISSIYKMDIL"
FT   gene            complement(276695..277861)
FT                   /locus_tag="CPn_0240"
FT   CDS_pept        complement(276695..277861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18393"
FT                   /db_xref="GOA:A0A0H2ULE1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULE1"
FT                   /protein_id="AAD18393.1"
FT                   /translation="MVYFMVFSPSSESVVKANSVVRSNFCYFLENKFVSPSESTEVMFS
FT                   EIMKGRVPDIESLFDRPTDMMMTGFKAAQNLGNLFNSFGILIMCFSQCKSCQTPEKETS
FT                   AIVLGATLLFFVVALILGPTLGALVYCAYKVYTLGKMIYSLNKAKAKVLRHPAQNVFHR
FT                   AAGVATIRSSEEAVKACKLYKSAMIGSLVVSLIASLALIALTAGIVLVLFFVAPGAAPV
FT                   ITAAMMGCCAAGGGALLISLLGLWIAIVRKAKHQEACVGHLTNVVLHTAVSEALLHDPS
FT                   HFQTNALARDLFLTDCLSHYGHLFSNEEVAQLVQGGAPGGGSRPSQHYGGSSDYQNRRG
FT                   GNGNFGGSHFGGGGGFAGSHFGAGYPTAPTMPSAPPPFPPPAYDTIYG"
FT   gene            complement(278200..279354)
FT                   /locus_tag="CPn_0241"
FT   CDS_pept        complement(278200..279354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18394"
FT                   /db_xref="GOA:Q9Z8U3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8U3"
FT                   /protein_id="AAD18394.1"
FT                   /translation="MSAMISLSSSHEASIASNTQVRDVLVSLAMDEFVEHNTEILPIKV
FT                   FLARGTLSSTAIIDDLKDVVETEGEHHFQVYSNISLKMIYQRFFEKIFGIGCCPLLLVT
FT                   DSHHTDPCGALITGIFAAVLFTVLAIVFGPTLGILCYSAYKIYQLTKKISSLSRTHTEV
FT                   INSVQKSDPFIHRSGAVAAAAASQSTIKACKVFRQSTLIFFVLGLIITISLAALIVGLV
FT                   FALFFLDPGAPAVMTAAMIGCCAAGGTGILLSVIGFLLASVYSVQKSQEGVHHMHTALL
FT                   RCIVSNTIIQMPYLPITPGTKKVLTQSIRRYQQFFSDDEYRDIESEVPLNRQTTPPPSY
FT                   ETLFHEEGSDGSSNVIPRESPPAYSTIDSSNSPFPSSSPPPYYR"
FT   gene            complement(279484..279918)
FT                   /locus_tag="CPn_0242"
FT   CDS_pept        complement(279484..279918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18395"
FT                   /db_xref="GOA:Q9Z8U2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8U2"
FT                   /protein_id="AAD18395.1"
FT                   /translation="MACSIFFRMSQGDYDDEPLSKKTACLVVDTMLYPVIAVVCAVVSV
FT                   VLLILKVLFLLLSFPFKLCSASSALPGERVSLGSHFKCLYGGGLPYLLACLLIVPVIGT
FT                   AIHGFIISHRTSEDARLSSAIVFMQAPILQLAGMSGLIKP"
FT   gene            complement(280130..280555)
FT                   /locus_tag="CPn_0243"
FT   CDS_pept        complement(280130..280555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18396"
FT                   /db_xref="GOA:Q9Z8U1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8U1"
FT                   /protein_id="AAD18396.1"
FT                   /translation="MACSIGYHLCNANEPDRFVASKVALVADILLYPFMAVICAVVFAV
FT                   LMVVKLLFLAIKFLVNTCIAACKSRPLPSCKENFQCLFGPKDKPGPSDWLGCLVLIPII
FT                   GTLIYSTIITVQSDTNRLRYFIISPAYQVGSTAIINW"
FT   gene            280918..281559
FT                   /gene="adk"
FT                   /locus_tag="CPn_0244"
FT   CDS_pept        280918..281559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="CPn_0244"
FT                   /product="Adenylate Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18397"
FT                   /db_xref="GOA:Q9Z8U0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U0"
FT                   /protein_id="AAD18397.1"
FT                   /translation="MTKGSVFIIMGPPGSGKGTQSQYLANRIGLPHISTGDLLRAIIRE
FT                   GTPNGLKAKAYLDKGAFVPSDFVWEILKEKLQSQACSKGCIIDGFPRTLDQAHLLDSFL
FT                   MDVHSNYTVIFLEISEDEILKRVCSRFLCPSCSRIYNTSQGHTECPDCHVPLIRRSDDT
FT                   PEIIKERLTKYQERTAPVIAYYDSLGKLCRVSSENKEDLVFEDILKCIYK"
FT   gene            281645..282502
FT                   /gene="ydhO"
FT                   /locus_tag="CPn_0245"
FT   CDS_pept        281645..282502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhO"
FT                   /locus_tag="CPn_0245"
FT                   /product="Polysaccharide Hydrolase-Invasin Repeat Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18398"
FT                   /db_xref="GOA:Q9Z8T9"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8T9"
FT                   /protein_id="AAD18398.1"
FT                   /translation="MKHYLSFSPSADFFSKQGAIETQVLFGERVLVKGSTCYAYSQLFH
FT                   NELLWKPYPGHSFRSTLVPCTPEFHIHPNVSVVSVDAFLDPWGIPLPFGTLLHVNSQNT
FT                   VIFPKDILNHMNTIWGSGTPQCDPRHLRRLNYNFFAELLIKDADLLLNFPYVWGGRSVH
FT                   ESLEKPGVDCSGFINILYQAQGYNVPRNAADQYADCHWISSFENLPSGGLIFLYPKEEK
FT                   RISHVMLKQDSSTLIHASGGGKKVEYFILEQDGKFLDSTYLFFRNNQRGRAFFGIPRKR
FT                   KAFL"
FT   gene            complement(282548..282952)
FT                   /gene="rs9"
FT                   /locus_tag="CPn_0246"
FT   CDS_pept        complement(282548..282952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs9"
FT                   /locus_tag="CPn_0246"
FT                   /product="S9 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18399"
FT                   /db_xref="GOA:Q9Z8T8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8T8"
FT                   /protein_id="AAD18399.1"
FT                   /translation="MAKSTIQESVATGRRKQAVSSVRLRPGSGKIDVNGKSFEDYFPLE
FT                   IQRTTILSPLKKITEDQSQYDLIIRVSGGGIQGQVIATRLGLARALLKENEENRQDLKS
FT                   CGFLTRDPRKKERKKYGHKKARKSFQFSKR"
FT   gene            complement(282966..283415)
FT                   /gene="rl13"
FT                   /locus_tag="CPn_0247"
FT   CDS_pept        complement(282966..283415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl13"
FT                   /locus_tag="CPn_0247"
FT                   /product="L13 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18400"
FT                   /db_xref="GOA:Q9Z8T7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8T7"
FT                   /protein_id="AAD18400.1"
FT                   /translation="MEKRKDTKTTIVKSSETTKSWYVVDAAGKTLGRLSSEVAKILRGK
FT                   HKVTYTPHVAMGDGVIVINAEKVRLTGAKKGQKIYRYYTGYISGMREIPFENMMARKPN
FT                   YIIEHAIKGMMPRTRLGKKQLKSLRIVKGDSYETFESQKPILLDI"
FT   gene            complement(283647..284327)
FT                   /gene="ycfV"
FT                   /locus_tag="CPn_0248"
FT   CDS_pept        complement(283647..284327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfV"
FT                   /locus_tag="CPn_0248"
FT                   /product="ABC Transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18401"
FT                   /db_xref="GOA:Q9Z8T6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8T6"
FT                   /protein_id="AAD18401.1"
FT                   /translation="MSLLIEAKNLSKTIQQQNQNISILTDVSLSLHAGETISITGASGN
FT                   GKTTLLHLLGTLDVPSSGSLRFFDKDLKNQDLANFRNQHIGFVFQNFYLLEDDTVLKNV
FT                   LMPALIARKNISKGSPVYTRALELLDLVNLEDKVRTRCSKLSGGEKQRVAIARALINEP
FT                   AILLADEPSGNLDEETSEQIHNLLLEQASALCGILIVTHNKHLASRCSREGVLSNGKLF
FT                   FHNS"
FT   gene            complement(284330..285841)
FT                   /locus_tag="CPn_0249"
FT   CDS_pept        complement(284330..285841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0249"
FT                   /product="CT151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18402"
FT                   /db_xref="GOA:Q9Z8T5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8T5"
FT                   /protein_id="AAD18402.1"
FT                   /translation="MKFEFSVALKYLIPGRGRLYSAIVSLFSVGIISLVVWLSIVFISV
FT                   IHGLEQRWIEDLSQLHSPITILPSDTYYSSYYYQIDKHSSLSNYTTKTLGEKIASPQVD
FT                   PYDPESDYLLPETFPLKDCDLGGQQKDPVKMTLESLGPYLQSQHGKVIEFEQGVGYLDI
FT                   KTSLKLQKPQPRNLTHFLTYPSKLSYEDKVLPYDETDYTSAELNPFNRSPSGWQQDFHH
FT                   LEELYRGASIILPSTYKDSGYKVGDTGVFSTYSIENEKETQYTVHVIGFYNPGLSPLGG
FT                   RTVFIDPDLARSIRSQSEGLGMSNGFHLFFPNTKRIVFVKKQIENILTSLGVDDYWEIS
FT                   SLHDYDYFQPILDQLQSDQVLFLFVCILILIVACSNIVTMSMLLVNNKKKEIGILKAMG
FT                   TSSRSLKIIFACCGAFSGACGVVIGTIFAIITLKNLQFIVKALNYLQGRETFNTAFFGQ
FT                   NLPNSVHPQAIYFLGLGTLLLAAVSGALPARKVAKMHVSEILKAD"
FT   gene            complement(285899..286057)
FT                   /gene="rl33"
FT                   /locus_tag="CPn_0250"
FT   CDS_pept        complement(285899..286057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl33"
FT                   /locus_tag="CPn_0250"
FT                   /product="L33 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18403"
FT                   /db_xref="GOA:Q9Z8T4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8T4"
FT                   /protein_id="AAD18403.1"
FT                   /translation="MASKNREIIKLKSSESSDMYWTVKNKRKTTGRLELKKYDRKLRRH
FT                   VIFKEAR"
FT   gene            286060..287562
FT                   /locus_tag="CPn_0251"
FT   CDS_pept        286060..287562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18404"
FT                   /db_xref="GOA:Q9Z8T3"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8T3"
FT                   /protein_id="AAD18404.1"
FT                   /translation="MSPFKKIVNRLLCYISFQKESRTLPIIIREPRMTTKSLGSFNSVI
FT                   SKNKIHFISLGCSRNLVDSEVMLGILLKAGYESTNEIEDADYLILNTCAFLKSARDEAK
FT                   DYLDHLIDVKKENAKIIVTGCMTSNHKDELKPWMSHIHYLLGSGDVENILSAIESRESG
FT                   EKISAKSYIEMGEVPRQLSTPKHYAYLKVAEGCRKRCAFCIIPSIKGKLRSKPLDQILK
FT                   EFRILVNKSVKEIILIAQDLGDYGKDLSTDRSSQLESLLHELLKEPGDYWLRMLYLYPD
FT                   EVSDGIIDLMQSNPKLLPYVDIPLQHINDRILKQMRRTTSREQILGFLEKLRAKVPQVY
FT                   IRSSVIVGFPGETQEEFQELADFIGEGWIDNLGIFLYSQEANTPAAELPDQIPEKVKES
FT                   RLKILSQIQKRNVDKHNQKLIGEKIEAVIDNYHPETNLLLTARFYGQAPEVDPCIIVNE
FT                   AKLVSHFGERCFIEITGTAGYDLVGRVVKKSQNQALLKTSKA"
FT   misc_feature    complement(287573..288456)
FT                   /note="CT144 hypothetical protein; contains frame shift"
FT   gene            complement(287573..288112)
FT                   /locus_tag="CPn_0252"
FT   gene            complement(287947..288456)
FT                   /locus_tag="CPn_0253"
FT   gene            complement(288456..289262)
FT                   /locus_tag="CPn_0254"
FT   CDS_pept        complement(288456..289262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0254"
FT                   /product="CT143 hypothetical protein_1"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18405"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8T2"
FT                   /protein_id="AAD18405.1"
FT                   /translation="MKTLGVKDQNLFIDQATLSVERNVRIENNLETRDLKVLDTTTSPC
FT                   EFIVKGNVSAEGSQLNATTLSDGFNIYSKTDVSQTPVCNNISDPQSARDALTFSYYRKT
FT                   GCQAANLYTYYPGNGYYVAPNTTIETHVAAITSKSVSRNATPDFSRYADIEPVVKLKQV
FT                   GIYQVTMQLTRWSGQHDGDNSATLILNFVSGNNKTLLCTSDTRGGYSSDRTSVAVTAIF
FT                   SVTELVSSPPYDYPWINLESTIWMNLMSLSTCVIWFPFPSNFVEVD"
FT   gene            complement(289326..290165)
FT                   /locus_tag="CPn_0255"
FT   CDS_pept        complement(289326..290165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0255"
FT                   /product="CT142 hypothetical protein_1"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18406"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8T1"
FT                   /protein_id="AAD18406.1"
FT                   /translation="MKNNINNNECYFKLDSTVDGDLLAANLKTFDTQAQGISSTETFSV
FT                   QGNATFKDQVSATGLTSGTTYNLNAQNFTSSQISIDFKNNRLSNCALPKEDCDPVPANY
FT                   VRSPEYFFCSKPLIGDFDFNSGESYLPLTGSEYTLYQSRNVNSIFRFIGWKQSTRELTV
FT                   GGNTAIQFLAAGTYIVSFTVGKRWGWNNGWGGAIYINNGLGQVQCESTIYSGGGYATIG
FT                   TLGTSIYRASVDVAPNPNDPNASDRYRAGIFYLSNGGSSAGIGNYSFSLLYYPDDRG"
FT   gene            complement(290395..291264)
FT                   /locus_tag="CPn_0256"
FT   CDS_pept        complement(290395..291264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0256"
FT                   /product="CT144 hypothetical protein_3"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18407"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8T0"
FT                   /protein_id="AAD18407.1"
FT                   /translation="MSNPTPKTKISIPTFVRFNIQSINLTEDQKKTTFTVGGKVTTENT
FT                   VVRGDLTCTDGGLTCQSDLTIQKDINIRPTSTNSMVFDGRLNLSNSPLSYKNSQGQDIT
FT                   DYEKMSSGKPQEYVPFGYYKRTQIMMAQRAAHSSGYVGGGSVPSGSYVPWNKFDQTSTQ
FT                   KTSGTEIYIDPNDSTKLVFEVNNKVPKLFRISVIMAKHGSWLDNGTGADILLAANEYEQ
FT                   GGGRINVTDLAMTTSRGSSYYETRPLQVVCVTYYAQNNGYFTFQNRAGGGLRVSFFSWN
FT                   IVALPYVE"
FT   gene            complement(291264..292127)
FT                   /locus_tag="CPn_0257"
FT   CDS_pept        complement(291264..292127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0257"
FT                   /product="CT143 hypothetical protein_2"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18408"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8S9"
FT                   /protein_id="AAD18408.1"
FT                   /translation="MKRRNLQKILPNASTPSTNVAENTGIKDQNLFLDQATLNVDGNVD
FT                   IENFLETRDLKVADTITSPCEFTVGGGLSAESSQFKATTLSKGLEITSEDQDGRVPKFT
FT                   NVSDPQSPRDALTYNYYRNTGCQALNLYTYYSSSQPTTVGKPIETVCQNPNPETYRISA
FT                   SAKIYDAVTRFPYIQFKAPGIYQVTIQIRRESGQHSGLDNPNLYLNLMIGNNKTLLCAS
FT                   DTRGYSGGHRTSIAVTGTFTLTEIVATPPHDYPWLFLETTIGLDIKSMSTCVIWFPFQA
FT                   NFAEVD"
FT   misc_feature    complement(292130..292986)
FT                   /note="CT142 hypothetical protein; contains frame shift"
FT   gene            complement(292130..292534)
FT                   /locus_tag="CPn_0258"
FT   gene            complement(292438..292986)
FT                   /locus_tag="CPn_0259"
FT   gene            complement(293317..293399)
FT                   /locus_tag="CPn_t09"
FT   tRNA            complement(293317..293399)
FT                   /locus_tag="CPn_t09"
FT                   /product="tRNA-Tyr"
FT   gene            complement(293405..293477)
FT                   /locus_tag="CPn_t10"
FT   tRNA            complement(293405..293477)
FT                   /locus_tag="CPn_t10"
FT                   /product="tRNA-Thr"
FT   gene            complement(293545..294045)
FT                   /gene="secA_1"
FT                   /locus_tag="CPn_0260"
FT   CDS_pept        complement(293545..294045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA_1"
FT                   /locus_tag="CPn_0260"
FT                   /product="Protein Translocase Subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18409"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULH2"
FT                   /protein_id="AAD18409.1"
FT                   /translation="MSKKINRNDLCPCGSNKKYKQCCLKKEEQTARYTTEGKFKFSAEV
FT                   LSASEQGEAGDNCTKLFQRLSQSLTSEQKAAVGKFHQITKNKEVMSKKALKKAQAKEEK
FT                   LVTEKLQQHNFEILNTGENLAPPMESTATLNQDTNFVCEDFIPTQEDFRISENSQKPPV
FT                   EED"
FT   gene            294302..295036
FT                   /gene="ydaO"
FT                   /locus_tag="CPn_0261"
FT   CDS_pept        294302..295036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaO"
FT                   /locus_tag="CPn_0261"
FT                   /product="PP-Loop Superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18410"
FT                   /db_xref="GOA:Q9Z8S7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8S7"
FT                   /protein_id="AAD18410.1"
FT                   /translation="MSTLLLNPPWMKAGKRIESLVRKALYTHTMLANHRKIVVALSGGK
FT                   DSLTLLLMLKAISGRGFPDLDLHAVNIGGKYSCGAEVNKPYLTRICDQLCIPFRTIPSP
FT                   YAPETPECYPCSQARRRLLFQAAKEIGASAIAFGHHRDDLVQTALLNLLHKAEFAGMLP
FT                   VLDMVHFGVTILRPLIFTPEFWIRKFAKENGFARVTCRCPVVSLRSKAEQSLKLLEEVF
FT                   PLARHNIALAIQEHGSSKSQKI"
FT   gene            295091..295936
FT                   /gene="surE"
FT                   /locus_tag="CPn_0262"
FT   CDS_pept        295091..295936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="CPn_0262"
FT                   /product="SurE-like Acid Phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18411"
FT                   /db_xref="GOA:Q9Z8S6"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8S6"
FT                   /protein_id="AAD18411.1"
FT                   /translation="MVLMNKRLKIILTNDDGITAKGMSCLVSALLEANIGDIYIAAPQA
FT                   EQSGKSMAISLNQVVCASPYAYPQPVKEAWAVGGSPTDCVRLGLRTLFESVSPDLVISG
FT                   INCGNNICKNAWYSGTIGAAKQALVDGIPSMALSQDNHISFFQQDKAPEILKALVIYLL
FT                   SQPFPCLTGLNINFPTSPGGSSWEGMRLVPPGDEFFYEEPQYLGSVNKNQYYVGKISGV
FT                   RIGEHPSEELACMLENHISVSPIFSQNSPIGLMTLEEFQKTQENFNASLLSSELTTKIF
FT                   "
FT   gene            complement(296075..296147)
FT                   /locus_tag="CPn_t11"
FT   tRNA            complement(296075..296147)
FT                   /locus_tag="CPn_t11"
FT                   /product="tRNA-Val"
FT   gene            complement(296151..296224)
FT                   /locus_tag="CPn_t12"
FT   tRNA            complement(296151..296224)
FT                   /locus_tag="CPn_t12"
FT                   /product="tRNA-Asp"
FT   gene            296249..297139
FT                   /gene="yqfU"
FT                   /locus_tag="CPn_0263"
FT   CDS_pept        296249..297139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqfU"
FT                   /locus_tag="CPn_0263"
FT                   /product="YqfU hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18412"
FT                   /db_xref="GOA:Q9Z8S5"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8S5"
FT                   /protein_id="AAD18412.1"
FT                   /translation="MSHGPRPTKFSFPLYFSKTLSWFILGGFLAACGVQMVLVPNELID
FT                   GGIVGLSIIASHFLGHKALPFCLVLFNLPFVFLAFKQIGKYFVIQMLTAVIIFSCSLWL
FT                   IDQLPSWLGMSPFVFKGSEMETVVLGGAIIGVGCGLIIRHGGSTDGTEILGIIINKKKG
FT                   YTVGQIILFVNFFIFALSGIVYKNWHTAFVSFLTYGIATKVMDMVILGLEDTKSVTIIT
FT                   SSPRKLGHILMETLGIGLTYIHAEGGYSGEPRNLLYVVVERLQLSQLKEIVHREDPSAF
FT                   IAIENLHEVINGRRT"
FT   gene            complement(297152..297730)
FT                   /gene="ubiD"
FT                   /locus_tag="CPn_0264"
FT   CDS_pept        complement(297152..297730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="CPn_0264"
FT                   /product="Phenylacrylate Decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18413"
FT                   /db_xref="GOA:Q9Z8S4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8S4"
FT                   /protein_id="AAD18413.1"
FT                   /translation="MKRYVVGISGASGVILAVKLIKELVNAKHQVEVIISPSGRKTLYY
FT                   ELGCQSFDALFSEENLEYIHTHSIQAIESSLASGSCPVEATIIIPCSMTTVAAISIGLA
FT                   DNLLRRVADVALKERRPLILVPRETPLHTIHLENLLKLSKSGATIFPPMPMWYFKPQSV
FT                   EDLENALVGKILAYLNIPSDLTKQWSNPE"
FT   gene            complement(297727..298620)
FT                   /gene="ubiA"
FT                   /locus_tag="CPn_0265"
FT   CDS_pept        complement(297727..298620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="CPn_0265"
FT                   /product="Benzoate Octaphenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18414"
FT                   /db_xref="GOA:Q9Z8S3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8S3"
FT                   /protein_id="AAD18414.1"
FT                   /translation="MRLNYFLNLVNFKYSIFSILFLSASTVFALSINEISQNLSFKEGF
FT                   KISVFGAIAFVFARTTGIVVNQCIDRFIDKKNTRTSKRVLPANLVSLNFAWVLSLFCSF
FT                   LFLFLCKILRIFSLGIASLTLMIVYPYMKRVTFFCHWGLGLVYTVAILMNFCAFAESGL
FT                   SMRLCFLALLWGGSVGMVIAANDIIYAIEDTEFDREEGLRSVPAHYGEKKAVEIAKVNL
FT                   WVSYLAYIFSGFVGSLDKEFYFTAIIPLVVILKVVRMYSNYSKKDQEGESKFFLANIAI
FT                   ALSFLVSMTLFWSLSR"
FT   gene            299184..299879
FT                   /locus_tag="CPn_0266"
FT   CDS_pept        299184..299879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18415"
FT                   /db_xref="GOA:Q9Z8S2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8S2"
FT                   /protein_id="AAD18415.1"
FT                   /translation="MALDEINNQNNPSQQIASSTSQTSKINQDRKTFACTVTLLVVATL
FT                   MILSGIVLLFTIGSLGLSVPLSGILGTFAVTVGAVLFITGLTILVRKSLGIEQKNEDLN
FT                   FLKIKTPTPPARPLMSKFSVTCSTTSIVLGMALLIGAVVSVFFLTGYLQLGLCAGLVGL
FT                   GTALFVAGLARMSPRSLADQEGSGSADSQSNIVGIGEPKAAQEQKWYKMAVVRGEDGIP
FT                   TAIRLTPEK"
FT   gene            300122..300913
FT                   /locus_tag="CPn_0267"
FT   CDS_pept        300122..300913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18416"
FT                   /db_xref="GOA:Q9Z8S1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8S1"
FT                   /protein_id="AAD18416.1"
FT                   /translation="MSIMSLNKTNALLNQPEPAVCLNAWDPKYINQDRKTFACTVTLLV
FT                   IATLMILTTGVIVLLAMGSPGLSVLVSTIIGTSVTTLGTALFIIGLVKLIKKSLAWIQY
FT                   QKYFQEVVKQKYEPFSIPKNDNVHKLTSCLPSPLDIESPSPEASTPVSKLRIACSGVAI
FT                   VLGVTLLIGAVVSVFFCTGYLQLALCVGFACLGTALFVGGLAGLRTHSLIAQGIMYLYL
FT                   TYYLSSALEERNETVKDQRNEINTYLTEECRQQKREKALLE"
FT   gene            300935..301321
FT                   /locus_tag="CPn_0268"
FT   CDS_pept        300935..301321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8S0"
FT                   /protein_id="AAD18417.1"
FT                   /translation="MSQCQSSSTSTWEWMKSFVPNWKNPTPPLSPIPSEDEFILAYEPF
FT                   VLPKTDPENAQANPPGTSTPNVENGIDDLNPLLGQPNEQNNANNPGTSGSNPTSLPAPE
FT                   RLPETEENSQEEEQGSQNNEDLIG"
FT   gene            complement(301473..302450)
FT                   /locus_tag="CPn_0269"
FT   CDS_pept        complement(301473..302450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0269"
FT                   /product="Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18418"
FT                   /db_xref="GOA:Q9Z8R9"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8R9"
FT                   /protein_id="AAD18418.1"
FT                   /translation="MTIDMHCDLLSHPHFCRKDPAVRCSPEQLLSGGVRQQVCAIFVPH
FT                   SRGEPNCDKQNSLFFSLPNQYPDIGLLSYEEEENGSSSQKKSLSLIRSIENASALGDDT
FT                   APLGTLLAKLIHLTKQGPLAYLGIVWKGDNRFGGGTEAPKRLSNDGKVLLDIMYELGVP
FT                   IDLSHCSDKLAEDILDYTADKLPNLAVIASHSNFRSVLDHRRNLVDAHAKEIVRRKGVI
FT                   GLNLVRSYVGDSLGDLEKHVLHAENLGILSSIVLGSDFFYANEDENFFFNECSSAEAHP
FT                   VLNQLIHRIFSKGKAESILSSRAEKFLKQVIVEQVNPKITDVKL"
FT   gene            complement(302465..303325)
FT                   /gene="ywlC"
FT                   /locus_tag="CPn_0270"
FT   CDS_pept        complement(302465..303325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywlC"
FT                   /locus_tag="CPn_0270"
FT                   /product="SuA5 Superfamily-related Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18419"
FT                   /db_xref="GOA:Q9Z8R8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011416"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8R8"
FT                   /protein_id="AAD18419.1"
FT                   /translation="MPDKKAQITFSLPEVMSAIHQGKIVALPTDTVYGFVLSLYASEAE
FT                   ERLYALKDREPSKAFALYVNSIEDIENISGYPLSPTAKKLAQLFPGAITLVVKHRNPRF
FT                   PKETLAFRIVDHSVVREIVDHCGTLIGTSANLSEFPSALTAQEIFADFADHDLCIFDGP
FT                   CSHGLESTVVASDPLYIYREGLISRSVIENIAGTEAKIFHRTSHAFSKHIKIYTVKNQE
FT                   QLVSFLSGSLDFKGVVCEHPKPKNFYTRLREALKKKTPSIVFIYDINTSDYPELFPFLS
FT                   PYYIE"
FT   gene            303634..304365
FT                   /locus_tag="CPn_0271"
FT   CDS_pept        303634..304365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0271"
FT                   /product="Lysophospholipase esterase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18420"
FT                   /db_xref="GOA:Q9Z8R7"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8R7"
FT                   /protein_id="AAD18420.1"
FT                   /translation="MTDYSFFRRKIGNIEAIECPGNPQDPIIILCHGYGSLADNLTFFP
FT                   SICSFSKLRPTWIFPNGILPLENDFRGSRACFPLNVLLLQELSRLYANGVGNLQEKYDE
FT                   LFDVDLETPKEALEELILNLNRPYNEIIIGGFSQGAILATHLVLTSQNPYAGALIFAGA
FT                   RLFNQGWEEGLKQCAQVPFLQSHGYEDEILPYHLGAHLNDLLLTKLNGQFVSFHGGHEI
FT                   PSVVFQKMQVTVPNWIDPARG"
FT   gene            complement(304337..305233)
FT                   /gene="dnaX_2"
FT                   /locus_tag="CPn_0272"
FT   CDS_pept        complement(304337..305233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX_2"
FT                   /locus_tag="CPn_0272"
FT                   /product="DNA Polymerase III Gamma and Tau"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18421"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8R6"
FT                   /protein_id="AAD18421.1"
FT                   /translation="MHLEEENQGWEALLRKVYHQEVPPAILLHGFTLPVLQDKAEQLAS
FT                   EILLSSSPGSEHKVSQKIHPDIYQFFPEGKGRLHSIDLPRGIKKQIYISPFEANYKIYI
FT                   IHEADRMTLAAISAFLKVFEEPPKHAVIILTTAKVQRLPKTIISRSLSIFIERGEKILC
FT                   SKETFSYLFRYAQCEIPVTEVSQIIKESSETDKQVLRDKVQRFMEVLLELYRDRYTLNL
FT                   GLKASALNYPEHVKEILQLPLLPLDKVLLIVESACRSLNNSSSAASVLEWVAIQLVSLQ
FT                   YKEKELVSVSPGQDLSN"
FT   gene            complement(305224..305844)
FT                   /gene="tdk"
FT                   /locus_tag="CPn_0273"
FT   CDS_pept        complement(305224..305844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="CPn_0273"
FT                   /product="Thymidylate Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18422"
FT                   /db_xref="GOA:Q9Z8R5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8R5"
FT                   /protein_id="AAD18422.1"
FT                   /translation="MFIVIEGGEGSGKSSLAKALGDQLVAQDRKVLLTREPGGCLIGER
FT                   LRDLILEPPHLELSRCCELFLFLGSRAQHIQEVIIPALRDGYIVICERFHDSTIVYQGI
FT                   AEGLGADFVADLCSKVVGPTPFLPNFVLLLDIPADIGLQRKHRQKVFDKFEKKPLSYHN
FT                   RIREGFLSLASADPSRYLVLDARESLASLIDKVMLHTQLGLCT"
FT   gene            complement(305849..308353)
FT                   /gene="gyrA_1"
FT                   /locus_tag="CPn_0274"
FT   CDS_pept        complement(305849..308353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA_1"
FT                   /locus_tag="CPn_0274"
FT                   /product="DNA Gyrase Subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18423"
FT                   /db_xref="GOA:Q9Z8R4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8R4"
FT                   /protein_id="AAD18423.1"
FT                   /translation="MFNKDEIIVPKNLEEEMKESYLRYSMSVIISRALPDIRDGLKPSQ
FT                   RRVLYAMKQLSLSPGAKHRKCAKICGDTSGDYHPHGESVIYPTLVRMAQNWAMRYPLVD
FT                   GQGNFGSIDGDPPAAMRYTEARLTHSAMYLMEDLDKDTVDIVPNYDETKHEPVVFPSKF
FT                   PNLLCNGSSGIAVGMATNIPPHNLGELIEATLLLLANPQASVDEILQVMPGPDFPTGGI
FT                   ICGSEGIRSAYTTGRGKIKVRARLHVEENEDKHRESIIITEMPYNVNKSRLIEQIANLV
FT                   NEKTLAGISDVRDESDKDGIRVVLEIKKGESSEIIINRLYKFTDVQVTFGANMLALDKN
FT                   LPRTMSIHRMISAWIRHRKEVIRRRTRYELNKAETRAHVLEGYLKALSCLDALVKTIRE
FT                   SGNKEHAKERIIESFGFTEPQALAILELRLYQLTGLEAEKIQKEYEELLNKIAYYKQVL
FT                   SDEGLVKDIIRNELQDLLKHHKVARRTTIEFDADDIRDIEDIITNESVIITISGDDYVK
FT                   RMPVKVFKEQRRGGHGVTGFDMKKGAGFLKAVYSAFTKDYLLIFTNFGQCYWLKVWQLP
FT                   EGERRAKGKPIINFLEGIRPGEELAAILNIKNFDNAGFLFLATKRGVVKKVSLDAFSNP
FT                   RKKGIRALEIDEGDELIAACHIVSDEEKVMLFTHLGMAVRFPHEKVRPMGRTARGVRGV
FT                   SLKNEEDKVVSCQIVTENQSVLIVCDQGFGKRSLVEDFRETNRGGVGVRSILINERNGN
FT                   VLGAIPVTDHDSILLMSSQGQAIRINMQDVRVMGRSTQGVRLVHLKEGDALVSMEKLSS
FT                   NENDDEVLSGSEEECSDTVSLR"
FT   gene            complement(308369..310786)
FT                   /gene="gyrB_1"
FT                   /locus_tag="CPn_0275"
FT   CDS_pept        complement(308369..310786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB_1"
FT                   /locus_tag="CPn_0275"
FT                   /product="DNA Gyrase Subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18424"
FT                   /db_xref="GOA:Q9Z8R3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8R3"
FT                   /protein_id="AAD18424.1"
FT                   /translation="MDPKEKNYDASAITVLEGLQAVRERPGMYIGDTGITGLHHLVYEV
FT                   VDNSIDEAMAGYCSRIDVRILEDGGIVIVDNGRGIPIEVHERESAKQGREVSALEVVLT
FT                   VLHAGGKFDKDSYKVSGGLHGVGVSCVNALSEKLVATVFKDKKCYQMEFSRGIPVTPLQ
FT                   YVSVSDRQGTEIVFYPDPKIFSTCTFDRSILMKRLRELAFLNRGITIVFEDDRDVSFDK
FT                   VTFFYEGGIQSFVSYLNQNKESLFSEPIYICGTRVGDDGEIEFEAALQWNSGYSELVYS
FT                   YANNIPTRQGGTHLTGFSTALTRVINTYIKAHNLAKNNKLALTGEDIREGLTAVISVKV
FT                   PNPQFEGQTKQKLGNSDVSSVAQQVVGEALTIFFEENPQIARMIVDKVFVAAQAREAAK
FT                   KARELTLRKSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAILP
FT                   IRGKILNVEKARLQKIFQNQEIGTIIAALGCGIGADNFNLSKLRYRRIIIMTDADVDGS
FT                   HIRTLLLTFFYRHMTALIENECVYIAQPPLYKVSKKKDFRYILSEKEMDSYLLMLGTNE
FT                   SSILFKSTERELRGEALESFINVILDVESFINTLEKKAIPFSEFLEMYKEGIGYPLYYL
FT                   APATGMQGGRYLYSDEEKEEALAQEETHKFKIIELYKVAVFVDIQNQLKEYGLDISSYL
FT                   IPQKNEIVIGNEDSPSCNYSCYTLEEVINYLKNLGRKGIEIQRYKGLGEMNADQLWDTT
FT                   MNPEQRTLIHVSLKDAVEADHIFTMLMGEEVPPRREFIESHALSIRINNLDI"
FT   gene            complement(310790..311137)
FT                   /locus_tag="CPn_0276"
FT   CDS_pept        complement(310790..311137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0276"
FT                   /product="CT191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8R2"
FT                   /protein_id="AAD18425.1"
FT                   /translation="MFLKRKKRGGSQVQNKRTASPIKHAKHYLHNYLQELQKIMAARPH
FT                   DAIDAWNQVFRDKYKGMSQAIGFRDHILLVKVYNSSLYALLKQTPQNDLIMSLYQVASH
FT                   VQIREIQFLLG"
FT   gene            complement(311401..311910)
FT                   /locus_tag="CPn_0277"
FT   CDS_pept        complement(311401..311910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18426"
FT                   /db_xref="GOA:Q9Z8R1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8R1"
FT                   /protein_id="AAD18426.1"
FT                   /translation="MIINVRAPAFGITSVQQFSTNFQAAIPILNIVIGCSRISSTYAED
FT                   IEEVAQEKLEKSTHSKSSTSVNLWAHRVRGVVEILGGGIVILALEITALVLQVIIKLIK
FT                   CLIDVLCVCLFGLGVCVVAIIGAIAFCVVVVVKYLGFCSQGEELEPIEVKTLISPDKPY
FT                   PTVVYV"
FT   gene            complement(312057..312875)
FT                   /locus_tag="CPn_0278"
FT   CDS_pept        complement(312057..312875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0278"
FT                   /product="conserved outer membrane lipoprotein protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18427"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8R0"
FT                   /protein_id="AAD18427.1"
FT                   /translation="MKKKLSLLVGLIFVLSSCHKEDAQNKIRIVASPTPHAELLESLQE
FT                   EAKDLGIKLKILPVDDYRIPNRLLLDKQVDANYFQHQAFLDDECERYDCKGELVVIAKV
FT                   HLEPQAIYSKKHSSLERLKSQKKLTIAIPVDRTNAQRALHLLEECGLIVCKGPANLNMT
FT                   AKDVCGKENRSINILEVSAPLLVGSLPDVDAAVIPGNFAIAANLSPKKDSLCLEDLSVS
FT                   KYTNLVVIRSEDVGSPKMIKLQKLFQSPSVQHFFDTKYHGNILTMTQDNG"
FT   gene            complement(312872..313537)
FT                   /locus_tag="CPn_0279"
FT   CDS_pept        complement(312872..313537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0279"
FT                   /product="Possible ABC Transporter Permease Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18428"
FT                   /db_xref="GOA:Q9Z8Q9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Q9"
FT                   /protein_id="AAD18428.1"
FT                   /translation="MQSDLIQILLKETVNTLYMVSTAFFFSCAIGGMLGLGLFCTSPKS
FT                   LNPKKSLYATISMILSFLTAIPFAILIVILFPITRWIVGTSLGPTASIVPLTIGAIPFV
FT                   VTIVVDAFRNSALNYLESAVALGIPKRNILFGILLPESYPQLIFSLKSLVVHLISCSTL
FT                   AGFVGGGGLGQLLLQYGYYRFEWSVTTSVLVITLVLIESVRILGDFWGRRVLKYRGIL"
FT   gene            complement(313547..314572)
FT                   /gene="dppF_1"
FT                   /locus_tag="CPn_0280"
FT   CDS_pept        complement(313547..314572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF_1"
FT                   /locus_tag="CPn_0280"
FT                   /product="Dipeptide Transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18429"
FT                   /db_xref="GOA:Q9Z8Q8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Q8"
FT                   /protein_id="AAD18429.1"
FT                   /translation="MSEQHSPIISVQDVSKKLGDHILLSKVSFSVYPGEVFGIVGHSGS
FT                   GKTTLLRCLDFLDMPTSGSISVAGFDNSLPTQKFSRRNFSKKVAYISQNYGLFSSKTVF
FT                   ENIAYPLRIHHSEMSKSEVEEQVYDTLNFLNLYHRHDAYPGNLSGGQKQKVAIARAIVC
FT                   QPEVVLCDEITSALDPKSTENIIERLLQLNQERGITLVLVSHEIDVVKKICSHVLVMHQ
FT                   GAVEELGTTEELFLNSENSITNELFHEDINIAALSSCYFAEDREEVLRLNFSKELAIQG
FT                   IISKVIQTGLVSINILSGNINLFRKSPMGFLIIVLEGEVEQRKKAKELLIELGVVIKEF
FT                   Y"
FT   gene            315057..316106
FT                   /gene="dhnA"
FT                   /locus_tag="CPn_0281"
FT   CDS_pept        315057..316106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhnA"
FT                   /locus_tag="CPn_0281"
FT                   /product="Predicted 1,6-Fructose Biphosphate Aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18430"
FT                   /db_xref="GOA:Q9Z8Q7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Q7"
FT                   /protein_id="AAD18430.1"
FT                   /translation="MLNIHDILGNDDENLLSYQCKHITKDKLTLPSHDFVDKVFGLSDR
FT                   NNRVLRSLQTMFSHGRLANSGYLSILPVDQGIEHSAGASFAINPIYFDPENIVKLAIES
FT                   GCSAVASTYGTLSLLSRKYAHKIPFMLKLNHNELLSYPTKYHQIFFTQVEAAYSMGAVA
FT                   VGATVYFGSETSNEEIVAVSNAFAKARSLGLATVLWCYLRNPAFVANGVDYHTAADLTG
FT                   QADHLGATLGADIVKQKLPTCQGGFKAINFGKTDERVYSELSSNHPIDLCRYQVLNSYC
FT                   GKVGLINSGGPSGKNDFTEAARTAVINKRAGGMGLILGRKAFQRPLSEGIQLLNLVQDI
FT                   YLDPNITIA"
FT   gene            316126..317532
FT                   /gene="xasA"
FT                   /locus_tag="CPn_0282"
FT   CDS_pept        316126..317532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xasA"
FT                   /locus_tag="CPn_0282"
FT                   /product="Amino Acid Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18431"
FT                   /db_xref="GOA:Q9Z8Q6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Q6"
FT                   /protein_id="AAD18431.1"
FT                   /translation="MHSHSKPTKPLGTFTVGMLSLAVVISLRNLPLTAKHGLSTLFFYG
FT                   LAVICFMIPYALISAELASFKPQGIYIWARDALGKWWGFFAIWMQWFHNMTWYPAVLAF
FT                   IASTIVYKINPELAHNKVYIATVILAGFWILTFFNFLGITSSALFSSICVIIGTLIPGV
FT                   ILVSLALFWIFSGNPIAISLSWGNLLPNFSNVSSLVLLAGMLLALCGLEANANLASDMV
FT                   NPRKNYPKAVFIGAIATLTILVLGSLSIAIVIPKEEISLVSGLVKTFTLFFDKYNLSWM
FT                   TGIVVVMTIAGSLGELNAWMFAGTKGLFISTQNDCLPRLFKKVNSKNVPTNLMLFQGIV
FT                   VTIFTLLFLCLDSADLVYWILTALSVQMYLAMYICLFLAGPILRIKEPRAQRLYSVPGK
FT                   FLGICTMSILGILSCAFALWVSFLPPRELAQISEGSKIGYTTFLLLAFSLNCLIPFGIY
FT                   FTHKRLSKKS"
FT   gene            complement(317529..318497)
FT                   /locus_tag="CPn_0283"
FT   CDS_pept        complement(317529..318497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WNI3"
FT                   /protein_id="AAD18432.1"
FT                   /translation="MKLLIKFAKKDLKNSSIAPLYEVLLEILEAPGEEILEVLFSLDPM
FT                   WLKSMLDPKKHSTLGIEISSETAETIESCSLGLISINLLLSGLCLRSSHDRSQAVKIIQ
FT                   QFCPQFSSEEVQNFVEQRNILTPFLHHLFEGDEVALLNQLSLRLDLIVPNALYPEPDPS
FT                   CWQSINSEDCAKDAEDQQEDFNKTKEACKEGLKKLVLPALSITSIPQLLRARRFKQGAE
FT                   ILMAIDRKKMKQNPFIFLEALLESEEFSISVGKYLKLLMPIHLWDKLLHAIYLGYFQTG
FT                   LICQGEIETFCRRANLNPEAFQAAIQQGRLLSFLFPKMLLD"
FT   gene            complement(318548..319045)
FT                   /locus_tag="CPn_0284"
FT   CDS_pept        complement(318548..319045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18433"
FT                   /db_xref="GOA:Q9Z8Q4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Q4"
FT                   /protein_id="AAD18433.1"
FT                   /translation="MNIPAPQVPVIDEPVVNNTSSYGLSLKSSLRPITYLILAILAIAT
FT                   LMSVLYFCGIISVGTFVLGMLIPLSVCSVLCVAYLFYQQSSIEKTKVFSITSPSVFFSD
FT                   EDLNLLLGREEDSVSAIDELLKNFPADDFRRPKMLPYSNFLDEQGRPNESREEDSHTSK
FT                   IL"
FT   gene            complement(319048..320595)
FT                   /locus_tag="CPn_0285"
FT   CDS_pept        complement(319048..320595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18434"
FT                   /db_xref="GOA:Q9Z8Q3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Q3"
FT                   /protein_id="AAD18434.1"
FT                   /translation="MFNLFFFTANKETTASHELIYRKNQSFSLSPVTILCLLAISVLLL
FT                   LGVVFALVGCHVLAAPLGLLVWGCAASVCSMMAIVSLMCLYKGGKPLIEPSNEEKIDPT
FT                   KDLEIKDPESLKPVPVEGQSLPKERKTVSFKAKIPSIVEDDFKPYVIQSTFYHQNKVYS
FT                   KPIAERMQSLEKEITTLIVDFPRALEESSKSSGSLLRGVISEIKNLFLPRFLSRKVKYS
FT                   LTACLRRLGSIVEEYASSDLLILLLTKPEPLNMVTQQLIAHLNSLKTEKRKLTPHMQKL
FT                   VLSINFWFYGWSLEEKCIEKIVAYDPNLLTDELKAHLEAGNIVQFLLSFQSSEMQREFR
FT                   ALFPSDAQELPSAKDGSNYVPAINSSEYMYDFKDLSVLKKSLSERLAFCEKIPSPSSWN
FT                   FTSSVASHYKDFSLLFTFFSNQQSVILQNPFLLIELLHENPKCQTFLKGLLEKAMPMSN
FT                   WAALFRPMLMGMLCSGIARKKELKIIAEHLGVPFKEITQAIASGKILDLLLQHLFDF"
FT   gene            complement(320647..322059)
FT                   /gene="mgtE"
FT                   /locus_tag="CPn_0286"
FT   CDS_pept        complement(320647..322059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="CPn_0286"
FT                   /product="Mg++ Transporter (CBS Domain)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18435"
FT                   /db_xref="GOA:Q9Z8Q2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Q2"
FT                   /protein_id="AAD18435.1"
FT                   /translation="MDSRTSHLDDELSFKLEKAFTCLSTDIHSHDLSKIVIEYNPIDLA
FT                   YAVSCLPSESRAILYKNLSCITAKVAFIINTDSASRWAIFRRLSDSEVCALIEQMPPDE
FT                   AVWVLDDIPDRRYRRILELIDSKKALKIRDLQKHGRNTAGRLMTNEFFAFLMETTVKDV
FT                   SACIRSNPGIDLTRLVFVLDFKGELQGVVTDRSLIINPPEMSLKQIMNQIEHKVLPDAT
FT                   REEVVDLVERYKIAALPVVDEENFLIGAITYEDVVEAIEDIADETIARMAGTTEDVGYQ
FT                   TCHVVQRFLLRAPWLLVTLFAGLISASVMAYFQKISPALLALIIFFIPLINGMSGNVGV
FT                   QCSTILVRSMATGTLSFGRRRETIFKEMSIGLLTGVVLGILCGLVVYLMGFLGLNIFSG
FT                   GGIQLGVTVATGVLGASLTATTLGVLSPFFFAKLGVDPALASGPIVTALNDIMSMIIFF
FT                   LIAGGINFLFFN"
FT   gene            complement(322086..324221)
FT                   /locus_tag="CPn_0287"
FT   CDS_pept        complement(322086..324221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18436"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Q1"
FT                   /protein_id="AAD18436.1"
FT                   /translation="MIRSPLPFISSKRALNMLGLQDEFSCPEDVVDFLFSEIELLAQQD
FT                   EPSEGYLALSRSLLMMTHNHPKVVKRVIFYGVSYGLKHKSMSIFIDVLTYIDFLFEKLG
FT                   ISASDRLSLCSARTCINFELYSQTGEMKFLSEVVDNFRLIEQLLKMHPQLKNRLGWEHF
FT                   RIGAKQEEVSLVASASVYQAVGRSFIELYHKHLELSDLACGMKCLALALDLSPNNAHIH
FT                   ADYAKGLVVLGTRQGKSLLIERGMEHFSKAIFLSFSRDGDTLAYQNYRYSYALASVKLF
FT                   DLTYKKEHFDQAMNILYQTVQAFPNLSGLWMVWGELLIRSGWLNSNMKYIEVGLEKLAS
FT                   LQKKTNDPIALSGLLATGIAILGLYLEEPNLFKDSRHRLISAMRTFPGNSALVHALGVV
FT                   QLCSALYFNEDSHFASAISCFQSCLEWDLDATGMWQKLFDAYFSWGIKKKSARLLRKAV
FT                   DVASRLCSLRPEAFLFWSDRGLALKCLAEATIDEAYKEIFLSESLLHYQRAWDLSGRLE
FT                   ILELWGQSHYLLAELQQSLFHYDEAYTLLTKVDLTLSSSRVKLILAAVLLGKGRLLQDT
FT                   DPAEEAREILEPLVEVYLEDENFLLLLGKVYLFLFWKNKNVCLGKLARTYLEKATSLGC
FT                   PEAYYTLGKFYAVIKDVNKAWGMVIRSAQYGVRITEAKWLNDPYLANLREIHAFREVVE
FT                   NQKGRLWLGNKTEMKRN"
FT   gene            complement(324568..325716)
FT                   /locus_tag="CPn_0288"
FT   CDS_pept        complement(324568..325716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0288"
FT                   /product="CT195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18437"
FT                   /db_xref="GOA:Q9Z8Q0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8Q0"
FT                   /protein_id="AAD18437.1"
FT                   /translation="MSCFNLTSTNESLRPISPKASFPKQGWQSYFRSALRKHRSDTLSV
FT                   SVCKVNKYDANLFVRLTVIALAVVGVLILFSIMLASIQGTLVITSWPLVTAAILIPTIL
FT                   LTGGMYILHRLGKKVDVISGVCIPPFSRRCWVPISSSHTLEKFDEKHVSACSYLDISTL
FT                   SADGSGIAAVYQCPPLLFRAFPCFGIPCAMPFVALLRMIYNLIRFLVVPFYIIFRMIYE
FT                   HFFCKHLPEDDRFIYKDVAREMGRSLAAFLKAPFYASACMIGAFYSLLDPLAGRVLMGS
FT                   VERDWNDNVILARSVSLANEAHSLFRFEGGGGRKGLGQHAFYLMLCCQPQSVFLFDKGE
FT                   IVSGAHPSIQLPERRGLDTSGRYPHISVIPDSGNDSAKNFIV"
FT   gene            325812..326999
FT                   /gene="aaaT"
FT                   /locus_tag="CPn_0289"
FT   CDS_pept        325812..326999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aaaT"
FT                   /locus_tag="CPn_0289"
FT                   /product="Neutral Amino Acid (Glutamate) Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18438"
FT                   /db_xref="GOA:A0A0F7WVB0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WVB0"
FT                   /protein_id="AAD18438.1"
FT                   /translation="MKKQRSHYKKNNLLLLLSILVGLGLGSVQSPWIVYSAECIANTFL
FT                   KFLRLLSIPLVFCALGSTITSIQNFNTMVTLGKRILYYTLLTTVIAASIGLLLFFLLRP
FT                   QMITQDALATTTKCNPLGYLDVLSDTLPENIFKPFLQGNVISAACLAVLLGTASLFLQE
FT                   KEKHFVNQFFNSFFSIFLNLARGGLKLLPIAMLGFSVILFKELKDQSNLTMFAEYLLCV
FT                   IGANLAQGFIVLPILLKINKVSPLKVAKAMSPALVTAFFSKSSAATLPLTMELAEDDLK
FT                   INKNLSRFSFPLCSVINMNGCAAFILITVLFVATSNGMIISPLMSLGWIFIATLAAIGN
FT                   AGVPMGCYFLTLSLLTSMNVPLSILGLILPFYTVIDMIETSLNVWSDCCVVSLAN"
FT   gene            327042..328526
FT                   /locus_tag="CPn_0290"
FT   CDS_pept        327042..328526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0290"
FT                   /product="Na-dependent Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18439"
FT                   /db_xref="GOA:A0A0F7XIC0"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XIC0"
FT                   /protein_id="AAD18439.1"
FT                   /translation="MNKKHASFSSRLGFIFSMIGIAVGAGNIWRFPRVAAQNGGGAFLI
FT                   LWLCFLFLWSIPLIIIELSIGKLTKKAPIGALIKTAGKKFAWAGGFITLVTTCILAYYS
FT                   TIVGWGLSYFYYAVSGKIHLGNDFAKLWTSHYQSSIPLWAHLTSLGLAYLVIRKGIVHG
FT                   IEKCNKILIPAFFLCTIALLLRAVTLPGAVQGIKQLFSCDKSCFSNYKVWIEALTQNAW
FT                   DTGAGWGLLLVYAGFASKKTGVVSNGALTAICNNLVSLIMGIIIFSTCASLDILGTTQL
FT                   QDGAGASSIGITFIYLPELFTRLPGGIYLTTLFSSIFFLAFSMAALSSMISMLFLLSQT
FT                   LAEFGIKPYISETLATIIAFVLGIPSALSLTFFSNQDTVWGVALIVNGLIFIYAALVYG
FT                   FPKLKKEVINAAPGDLRLNKAFDYIIKYLLPIEGILLLGWYFYEGLFPENGQWWNPISL
FT                   YSLGSLVLQWSLGLIILWKFNKQLYLRFSRYNHEIL"
FT   gene            328667..329197
FT                   /gene="incB"
FT                   /locus_tag="CPn_0291"
FT   CDS_pept        328667..329197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="incB"
FT                   /locus_tag="CPn_0291"
FT                   /product="Inclusion Membrane Protein B"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18440"
FT                   /db_xref="GOA:Q9Z8P7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8P7"
FT                   /protein_id="AAD18440.1"
FT                   /translation="MSAPIPTPQELSDQITCLNVQYQQVSELARENKGDIEGLKTLTAA
FT                   LTADAGIQPSADEIYSLQTAAALILSASEKPGSGPSGSTEGSVTVQSPCKFKKVLAVVL
FT                   TIIALIAIAVLIACIIAACGGFPLLLSALNLYTIGACVSLPIIASTSVALICLCTFVAN
FT                   SLIKPVITVRTTR"
FT   gene            329228..329839
FT                   /gene="incC"
FT                   /locus_tag="CPn_0292"
FT   CDS_pept        329228..329839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="incC"
FT                   /locus_tag="CPn_0292"
FT                   /product="Inclusion Membrane Protein C"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18441"
FT                   /db_xref="GOA:Q9Z8P6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8P6"
FT                   /protein_id="AAD18441.1"
FT                   /translation="MTSPIPFQSSGDASFLAEQPQQLPSTSESQLVTQLLTMMKHTQAL
FT                   SETVLQQQRDRLPTASIILQVGGAPTGGAGAPFQPGPADDHHHPIPPPVVPAQIETEIT
FT                   TIRSELQLMRSTLQQSTKGARTGVLVVTAILMTISLLAIIIIILAVLGFTGVLPQVALL
FT                   MQGETNLIWAMVSGSIICFIALIGTLGLILTNKNTPLPAS"
FT   gene            329949..332726
FT                   /locus_tag="CPn_0293"
FT   CDS_pept        329949..332726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0293"
FT                   /product="CT234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18442"
FT                   /db_xref="GOA:A0A0F7WNJ2"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WNJ2"
FT                   /protein_id="AAD18442.1"
FT                   /translation="MQRVLRLLFNLHHGEEKRAFLFFLLGLVWGIGCYGTLSLAEGLFI
FT                   EKLGSAELPKIYLGSSLILCVLSSLILYNLFKKHISATALFLIPVSLSILCNFYLILSS
FT                   IFAIDPPRSPLFFYRIVIWSLTILSYTSFWGFVDQFFNLQDGKRHFCIFNAIIFLGDAI
FT                   GSGIIASLVHTIGIQGILILFTAALVLTFPIVFYVSKSLKSLSDDHDLFIDTGHPPPLS
FT                   KALKLCFYDKYTFYLLCFYFLMQLLAIATEFNYLKIFEIQFASKEEFELVAHIGKCSLW
FT                   ISLGNMCFALFAYSRIVKRLGVNNIILFAPLCFLSLFLFWTFKTTLSIAVLAMVVREGV
FT                   TYALDDNNLQLLIYGVPNKIRNQIRIVVESFIEPIGMLVWSLICFLSSQQYVFCLIISL
FT                   IATILVCLVRSYYAKAILKNLSAQALQLTRSMQDWIKSMTVKQKRQVELFLLAHLKHPS
FT                   ERHQTFAFQHLLNLASRSVLPSLLAHMNKLSLPNKLKTIEMVKSSLWAKDFLTLELLKR
FT                   WTSIFPHPAIASAIHLYFAEHDLLHITHIAEDLYDTVGDRLLAAILTVRRQEAYGPYRD
FT                   LADKRLKELLNSDQPEDIVMGLTILKLEKNPQNFPILLDFLNTKNEDILIVTCKALHTS
FT                   VRANHKPYCPELLKRLRQCSHNDEASQYLLKTISIALDISFVKDLLMTTSQLKNTSRKY
FT                   AEAMIGELDKEVAPAFLQVLTDEGTHNRCRILAAKALCKIDNWLLKKHAYKIVKSKASK
FT                   ALFYSYHGHYIQKKYPTYNLSLLANTLNSNYYAEVNFMLSLLGILGSMEHSGVLIRALT
FT                   SKNQKIKAQALESLEKNCDSHLFSLLEPFVNQPGMCYSEKYYFKCGVIPLTLKELLNMM
FT                   ENSPSSLNKLTAQQLKEELSYCDPDFQSVNTIYNQEHEDFRTEESETLISFLSI"
FT   gene            333092..333505
FT                   /locus_tag="CPn_0294"
FT   CDS_pept        333092..333505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0294"
FT                   /product="cAMP-Dependent Protein Kinase Regulatory Subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18443"
FT                   /db_xref="GOA:Q9Z8P4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8P4"
FT                   /protein_id="AAD18443.1"
FT                   /translation="MNLIDRAFLLKKTIIFQSLDMDLLLTIADKTETIIFKPGSNVFSI
FT                   GQPGFSFYIIVEGYITISKEKLESPLNLKPLDCFGEESLFNNKPREYNASANTQVRMLV
FT                   LSKGQILNIVEECPSVALSFLELYAKQIKFREP"
FT   gene            complement(333624..333863)
FT                   /gene="acpP"
FT                   /locus_tag="CPn_0295"
FT   CDS_pept        complement(333624..333863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="CPn_0295"
FT                   /product="Acyl Carrier Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18444"
FT                   /db_xref="GOA:Q9Z8P3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8P3"
FT                   /protein_id="AAD18444.1"
FT                   /translation="MSLEDDVIAIIVEQLGVDPKEVNENSSFIEDLNADSLDLTELIMT
FT                   LEEKFAFEISEEDAEKLRTVGDVFTYIKKRQAEQ"
FT   gene            complement(334019..334765)
FT                   /gene="fabG"
FT                   /locus_tag="CPn_0296"
FT   CDS_pept        complement(334019..334765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="CPn_0296"
FT                   /product="Oxoacyl (Carrier Protein) Reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18445"
FT                   /db_xref="GOA:Q9Z8P2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8P2"
FT                   /protein_id="AAD18445.1"
FT                   /translation="MDITLVGKKVIVTGGSRGIGLGIVKLFLENGADVEIWGLNEERGQ
FT                   AVIESLTGLGGEVSFARVDVSHNGGVKDCVQKFLDKHNKIDILVNNAGITRDNLLMRMS
FT                   EDDWQSVISTNLTSLYYTCSSVIRHMIKARSGSIINVASIVAKIGSAGQTNYAAAKAGI
FT                   IAFTKSLAKEVAARNIRVNCLAPGFIETDMTSVLNDNLKAEWLKSIPLGRAGTPEDVAR
FT                   VALFLASQLSSYMTAQTLVVDGGLTY"
FT   gene            complement(334771..335697)
FT                   /gene="fabD"
FT                   /locus_tag="CPn_0297"
FT   CDS_pept        complement(334771..335697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="CPn_0297"
FT                   /product="Malonyl Acyl Carrier Transcyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18446"
FT                   /db_xref="GOA:Q9Z8P1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8P1"
FT                   /protein_id="AAD18446.1"
FT                   /translation="MKKRYAFLFPGQGSQYVGMGQDLYMEYPEVRELFDFANERLGFSL
FT                   TSIMFEGPEDLLMETVHSQLAIYLHSMAVVKVLSQRSSIQPSLVSGLSLGEYTALVASD
FT                   RISVLDGLELVRKRGQLMNEACNQSPGAMAALLGLPSEVIEENITSLGQGIWIANYNAP
FT                   KQLVVAGIAEKVDQAIELFRDLGCKKAVRLKVSGAFHTPLMQVAQDGLAPDIYALCMKD
FT                   SSLPLVSHVVGKSLVNTEEMRECLARQMTSPTLWYQSCYHIESEVDEFLELGPGKVLAG
FT                   LNRSIGISKPITSLGTFAQIEKFLSEV"
FT   gene            complement(335714..336721)
FT                   /gene="fabH"
FT                   /locus_tag="CPn_0298"
FT   CDS_pept        complement(335714..336721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="CPn_0298"
FT                   /product="Oxoacyl Carrier Protein Synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18447"
FT                   /db_xref="GOA:Q9Z8P0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8P0"
FT                   /protein_id="AAD18447.1"
FT                   /translation="MWFSVNKNKKAAIWATGSYLPEKVLSNADLEKMVDTSDEWIVTRT
FT                   GIKERRIAGPQEYTSLMGAIAAEKAIANAGLSKDQIDCIIFSTAAPDYIFPSSGALAQA
FT                   HLGIEDVPTFDCQAACTGYLYGLSVAKAYVESGTYNHVLLIAADKLSSFVDYTDRNTCV
FT                   LFGDGGAACVIGESRPGSLEINRLSLGADGKLGELLSLPAGGSRCPASKETLQSGKHFI
FT                   AMEGKEVFKHAVRRMETAAKHSIALAGIQEEDIDWFVPHQANERIIDALAKRFEIDESR
FT                   VFKSVHKYGNTAASSVGIALDELVHTESIKLDDYLLLVAFGGGLSWGAVVLKQV"
FT   gene            336816..337418
FT                   /gene="recR"
FT                   /locus_tag="CPn_0299"
FT   CDS_pept        336816..337418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CPn_0299"
FT                   /product="Recombination Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18448"
FT                   /db_xref="GOA:Q9Z8N9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8N9"
FT                   /protein_id="AAD18448.1"
FT                   /translation="MTRYPDYLSKLIFFLRKLPGIGFKTAEKLAFELISWDSEQLKILG
FT                   NAFHNVASERSHCPLCFTLKESKEADCHFCREERDNQSLCIVASPKDVFFLERSKVFKG
FT                   RYHVLGSLLSPITGKHIENERLSILKSRIETLCPKEIILAIDATLEGDATALFLKQELQ
FT                   HFSVNISRLALGLPIGLSFDYVDSGTLARAFSGRHSY"
FT   gene            337783..340155
FT                   /gene="yaeT"
FT                   /locus_tag="CPn_0300"
FT   CDS_pept        337783..340155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="CPn_0300"
FT                   /product="Omp85 Analog"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18449"
FT                   /db_xref="GOA:A0A0F7X3D0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X3D0"
FT                   /protein_id="AAD18449.1"
FT                   /translation="MLIMRNKVILQISILALIQTPLTLFSTEKVKEGHVVVDSITIITE
FT                   GENASNKHPLPKLKTRSGALFSQLDFDEDLRILAKEYDSVEPKVEFSEGKTNIALHLIA
FT                   KPSIRNIHISGNQVVPEHKILKTLQIYRNDLFEREKFLKGLDDLRTYYLKRGYFASSVD
FT                   YSLEHNQEKGHIDVLIKINEGPCGKIKQLTFSGISRSEKSDIQEFIQTKQHSTTTSWFT
FT                   GAGLYHPDIVEQDSLAITNYLHNNGYADAIVNSHYDLDDKGNILLYMDIDRGSRYTLGH
FT                   VHIQGFEVLPKRLIEKQSQVGPNDLYCPDKIWDGAHKIKQTYAKYGYINTNVDVLFIPH
FT                   ATRPIYDVTYEVSEGSPYKVGLIKITGNTHTKSDVILHETSLFPGDTFNRLKLEDTEQR
FT                   LRNTGYFQSVSVYTVRSQLDPMGNADQYRDIFVEVKETTTGNLGLFLGFSSLDNLFGGI
FT                   ELSESNFDLFGARNIFSKGFRCLRGGGEHLFLKANFGDKVTDYTLKWTKPHFLNTPWIL
FT                   GIELDKSINRALSKDYAVQTYGGNVSTTYILNEHLKYGLFYRGSQTSLHEKRKFLLGPN
FT                   IDSNKGFVSAAGVNLNYDSVDSPRTPTTGIRGGVTFEVSGLGGTYHFTKLSLNSSIYRK
FT                   LTRKGILKIKGEAQFIKPYSNTTAEGVPVSERFFLGGETTVRGYKSFIIGPKYSATEPQ
FT                   GGLSSLLISEEFQYPLIRQPNISAFVFLDSGFVGLQEYKISLKDLRSSAGFGLRFDVMN
FT                   NVPVMLGFGWPFRPTETLNGEKIDVSQRFFFALGGMF"
FT   gene            340250..340765
FT                   /locus_tag="CPn_0301"
FT   CDS_pept        340250..340765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0301"
FT                   /product="OmpH-Like Outer Membrane Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18450"
FT                   /db_xref="GOA:Q9Z8N7"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8N7"
FT                   /protein_id="AAD18450.1"
FT                   /translation="MKKLLFSTFLLVLGSTSAAHANLGYVNLKRCLEESDLGKKETEEL
FT                   EAMKQQFVKNAEKIEEELTSIYNKLQDEDYMESLSDSASEELRKKFEDLSGEYNAYQSQ
FT                   YYQSINQSNVKRIQKLIQEVKIAAESVRSKEKLEAILNEEAVLAIAPGTDKTTEIIAIL
FT                   NESFKKQN"
FT   gene            340787..341869
FT                   /gene="lpxD"
FT                   /locus_tag="CPn_0302"
FT   CDS_pept        340787..341869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="CPn_0302"
FT                   /product="UDP Glucosamine N-Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18451"
FT                   /db_xref="GOA:Q9Z8N6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8N6"
FT                   /protein_id="AAD18451.1"
FT                   /translation="MSEAPVYTLKQLAELLQVEVQGNIETPISGVEDISQAQPHHIAFL
FT                   DNEKYSSFLKNTKAGAIILSRSQAMQHAHLKKNFLITNESPSLTFQKCIELFIEPVTSG
FT                   FPGIHPTAVIHPTARIEKNVTIEPYVVISQHAHIGSDTYIGAGSVIGAHSVLGANCLIH
FT                   PKVVIRERVLMGNRVVVQPGAVLGSCGFGYITNAFGHHKPLKHLGYVIVGDDVEIGANT
FT                   TIDRGRFKNTVIHEGTKIDNQVQVAHHVEIGKHSIIVAQAGIAGSTKIGEHVIIGGQTG
FT                   ITGHISIADHVIMIAQTGVTKSITSPGIYGGAPARPYQETHRLIAKIRNLPKTEERLSK
FT                   LEKQVRDLSTPSLAEIPSEI"
FT   gene            complement(341918..342958)
FT                   /locus_tag="CPn_0303"
FT   CDS_pept        complement(341918..342958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0303"
FT                   /product="CT244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X5A5"
FT                   /protein_id="AAD18452.1"
FT                   /translation="MDVSRKINRHTQFYVDSIDGVIKNFDHKPSEDKSRDHEELEEKLL
FT                   TITKRIVASAQEFQNRKTDSKNYYLKKTQWLPFKNEELEQTKELFAMLTSMDKKIAQLF
FT                   FYSPGCSSDWVEFTEVICHLNDSIGLGGVLLCCGLFEQQCEHVVTVNKKLDLPLLLGTT
FT                   VVNSLRYYLTYRNISLLNCQSMSELGKELGDVLKQHGVAFTLIFKEIVDIDLLNYVKLI
FT                   QGLKRSGNIQARIYDNDVPTLPSVSSSPIALRYSLANTIRGLALHVDFSSLKFISPSIL
FT                   SNTEHTAKALNSGGECFIFSNLDEFNLGMKIVMQLLRTGKISPEILNKNIMKILMIKRR
FT                   VRSLYI"
FT   gene            343133..344161
FT                   /gene="pdhA"
FT                   /locus_tag="CPn_0304"
FT   CDS_pept        343133..344161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="CPn_0304"
FT                   /product="Pyruvate Dehydrogenase Alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18453"
FT                   /db_xref="GOA:Q9Z8N4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8N4"
FT                   /protein_id="AAD18453.1"
FT                   /translation="MDSSAPYNIASQGTEKSTVERILDLYGPASCIKFLKQMVLIREFE
FT                   ARGEEAYLEGLVGGFYHSYAGQEAVATAAIANTGLDPWVFSSYRCHALAILLNIPLQEI
FT                   AAELLGKETGCALGRGGSMHMCGPNFPGGFGIVGGQIPLAAGAAFTIKYQEQKNRVSLC
FT                   FIGDGAVAQGVFHETLNFVSLHQLPLMLIIENNGWSMGTSLNRAVAKQPIAESQGSSYD
FT                   IRAVTVNGFDLFNSLLGFREAYRYMVDTESPVLVECLCSRFRGHSISDPNLYRSKEEMQ
FT                   CLFKKDPIVLAKDWLIRLEVLTEEEFQNIRQECKTAVLEAFSNAKLSSDPSVTTLEEGV
FT                   YA"
FT   gene            344154..345140
FT                   /gene="pdhB"
FT                   /locus_tag="CPn_0305"
FT   CDS_pept        344154..345140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="CPn_0305"
FT                   /product="Pyruvate Dehydrogenase Beta"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18454"
FT                   /db_xref="GOA:Q9Z8N3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8N3"
FT                   /protein_id="AAD18454.1"
FT                   /translation="MPKHKTLEIREALREAIDEEMSRDPNVCILGEEVGDYNGAYKVTK
FT                   GLLDKWGPKRVIDAPISEAAFSGIGIGAALSGLRPIIEFMSWNFSFVALDQIISHAAKM
FT                   HFMTGGKFSVPIVFRGPNGAAAQVSCQHSHCVESLYANIPGLIIIAPSNPYDAKGLLKS
FT                   AIRNNNPVLFLENELEYNLKGEVPTEEYLVPIGKAHRVQEGNDLTIITYSRMVSITKEA
FT                   CSLAKKRWGLSIEIIDLRTIKPLDISTILSSVRKTSRCIVIEEGHYFAGISSEIIALIT
FT                   EHVFDSLDAPPLRVCQKETPMPYSKILEQATLPNVNRILDTIEKVMR"
FT   gene            345145..346434
FT                   /gene="pdhC"
FT                   /locus_tag="CPn_0306"
FT   CDS_pept        345145..346434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="CPn_0306"
FT                   /product="Dihydrolipoamide Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18455"
FT                   /db_xref="GOA:Q9Z8N2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8N2"
FT                   /protein_id="AAD18455.1"
FT                   /translation="MISLLKMPKLSPTMEVGTIVKWHKKSNDQVSFGDVIVEISTDKAI
FT                   LEHTANEDGWIREILRHEGEKIVIGTPIAVLSTEANEPFNLEELLPKTEPSNLEASPKG
FT                   SSEEVSPATTPQAASATFTAVTFKPEPPLSSPLVFKHVGTTNNLSPLARQLAKEKNIDV
FT                   SSIQGSGPGGRIVKKDLEKAPPKSIAGFGYPESPEVPPGSYHEENLSPIREVIAARLQA
FT                   AKISIPHFYVRQQVYASPLLNLLKELQAQGIKLSINDCIVRACALALKEFPSINSGFNS
FT                   VDNKIVRFDTIDISIAVAIPDGIITPIIRCADRKNLGMISAEIKSLALKARNQSLQDTE
FT                   YKGGSFCVSNLGMTGITEFTAIVNPPQAAILAVGSVTEQALVLDGEITIGSTCNLTLSV
FT                   DHRVIDGYPAAMFMKRLQKILEAPAVLLLN"
FT   gene            complement(346512..348986)
FT                   /gene="glgP"
FT                   /locus_tag="CPn_0307"
FT   CDS_pept        complement(346512..348986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="CPn_0307"
FT                   /product="Glycogen Phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18456"
FT                   /db_xref="GOA:Q9Z8N1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8N1"
FT                   /protein_id="AAD18456.1"
FT                   /translation="MEDFSSFDKNKVSVDSMKRAILDRLYLSVVQSPESASPRDIFTAV
FT                   AKTVMEWLAKGWLKTQNGYYKNDVKRVYYLSMEFLLGRSLKSNLLNLGILDLVRKALKT
FT                   LNYDFDHLVEMESDAGLGNGGLGRLAACYLDSMATLAVPAYGYGIRYDYGIFDQRIVNG
FT                   YQEEAPDEWLRYGNPWEICRGEYLYPVRFYGRVIHYTDSRGKQVADLVDTQEVLAMAYD
FT                   IPIPGYGNDTVNSLRLWQAQSPRGFEFSYFNHGNYIQAIEDIALIENISRVLYPNDSIT
FT                   EGQELRLKQEYFLVSATIQDIIRRYTKTHICLDNLADKVVVQLNDTHPALGIAEMMHIL
FT                   VDREELPWDKAWEMTTVIFNYTNHTILPEALERWPLDLFSKLLPRHLEIIYEINSRWLE
FT                   KVGSRYPKNDDKRRSLSIVEEGYQKRINMANLAVVGSAKVNGVSSFHSQLIKDTLFKEF
FT                   YEFFPEKFINVTNGVTPRRWIALCNPRLSKLLNETIGDRYIIDLSHLSLIRSFAEDSGF
FT                   RDHWKGVKLKNKQDLTSRIYNEVGEIVDPNSLFDCHIKRIHEYKRQLMNILRVIYVYND
FT                   LKENPNQDVVPTTVIFSGKAAPGYVMAKLIIKLINSVADVVNQDSRVNDKLKVLFLPNY
FT                   RVSMAEHIIPGTDLSEQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKEN
FT                   MFIFGLLEEQIVQLRREYCPQTICDKNPKIRQVLDLLEQGFFNSNDKDLFKPIVHRLLH
FT                   EGDPFFVLADLESYIAAHENVNKLFKEPDSWTKISIYNTAGMGFFSSDRAIQDYARDIW
FT                   HVPTKSCSGEGN"
FT   gene            349234..349599
FT                   /locus_tag="CPn_0308"
FT   CDS_pept        349234..349599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0308"
FT                   /product="similarity to CT249"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18457"
FT                   /db_xref="GOA:Q9Z8N0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8N0"
FT                   /protein_id="AAD18457.1"
FT                   /translation="MATVAQTPQTTQPQPSVSHKATHRYCSWVFFKPILVSLGLLLASL
FT                   TTLGLVIASGVTLSLGIGIVLAIQIVLAGIALVLAFNHIRQFKQARTAELNSMKMISAP
FT                   AAATVQKQKLEDRYSSK"
FT   gene            complement(349592..350974)
FT                   /gene="dnaA_1"
FT                   /locus_tag="CPn_0309"
FT   CDS_pept        complement(349592..350974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA_1"
FT                   /locus_tag="CPn_0309"
FT                   /product="Replication Initiation Factor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18458"
FT                   /db_xref="GOA:Q9Z8M9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M9"
FT                   /protein_id="AAD18458.1"
FT                   /translation="MRAWEEFLLLQEKEIGTNTVDKWLRSLKVLCFDACNLYLEAQDSF
FT                   QITWFEEHIRHKVKSGLVNNNNKPIRVHVTSVDKAAPFYKEKQMQQEKTAYFTMHYGSV
FT                   NPEMTFSNFLVTPENDLPFRVLQEFTKSPDENGGVTFNPIYLFGPEGSGKTHLMQSAIS
FT                   VLRESGGKILYVSSDLFTEHLVSAIRSGEMQKFRSFYRNIDALFIEDIEVFSGKSATQE
FT                   EFFHTFNSLHSEGKLIVVSSSYAPVDLVAVEDRLISRFEWGVAIPIHPLVQEGLRSFLM
FT                   RQVERLSIRIQETALDFLIYALSSNVKTLLHALNLLAKRVMYKKLSHQLLYEDDVKTLL
FT                   KDVLEAAGSVRLTPLKIIRNVAQYYGVSQESILGRSQSREYVLPRQVAMYFCRQKLSLS
FT                   YVRIGDVFSRDHSTVISSIRLIEQKIEENSHDIHMAIQDISKNLNSLHKSLEFFPSEEM
FT                   II"
FT   gene            complement(351046..353433)
FT                   /gene="60IM"
FT                   /locus_tag="CPn_0310"
FT   CDS_pept        complement(351046..353433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="60IM"
FT                   /locus_tag="CPn_0310"
FT                   /product="60 kDa Inner Membrane Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18459"
FT                   /db_xref="GOA:Q7VQ46"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VQ46"
FT                   /protein_id="AAD18459.1"
FT                   /translation="MNKRTLLFVSLIGIAFVGCQIFFGYNEFRSCKNLAEKQRKISEQT
FT                   LAAVESVGLSVASWDTDVNGEEHKNNYAVRVGDKLFLLHNGEAAQSVYSSGESWSFVDH
FT                   KCGFDNIHLALYRQQGSSFNPTNTGKVFLPTNHEGLPVLVVEFRNNKEPLVFLGEYAQG
FT                   RISNKDSTIFGTALVFWRSGSDYIPLGLYDSREEKLVSLDLPITRAVIFGNDQDSAKSS
FT                   DTANHYVLFNDYMQIIVSEESGSIEGINLPFASTNNKSIVNEIGFDRDLASEKSPEALF
FT                   PGLSSKLPDGQQAKNSIGGYYPLLRRGLLSDSKKLLPLEYHALNVVSGRELATPVALRY
FT                   RVLSYTPHSIQLESLDRSVQKVYKLPENPEEKPYVFETAITLTKETEDVWVTSGVPEVE
FT                   IMSNASAPTIKYRVIKKNKGSLDKVKLPKVKEPLAIRRGVYPQWILNSNGYFGIILTPL
FT                   SEIASGYGSLYISGSTAPTRLSAISPKNQLYPVSKYPGYETLLPLPKDAGTHRFLVYAG
FT                   PLAEPTLKVLDKTITQEKGENPEYLDSISFRGVFAFITAPFAALLFIIMKFFKLVTGSW
FT                   GISIILLTVFLKLLLYPLNAWSIRSMRRMQILSPYIQQIQQKYKNEPKRAQMEIMGLYK
FT                   TNKVNPITGCLPLLIQLPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDVLFSWQTSI
FT                   WFIGNEFHLLPILLGIVMFLQQKVTSLHKKGPVTDQQKQQQVMGNMMAILFTAMFYNFP
FT                   SGLNIYWLSSMILGVVQQWITNKILDSKHLKNEVVLNNKKHR"
FT   gene            complement(353572..354438)
FT                   /gene="lgt"
FT                   /locus_tag="CPn_0311"
FT   CDS_pept        complement(353572..354438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="CPn_0311"
FT                   /product="Prolipoprotein Diacylglycerol Transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18460"
FT                   /db_xref="GOA:Q9K266"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K266"
FT                   /protein_id="AAD18460.1"
FT                   /translation="MAVIYWDRSKIVWSFEPWSLRLTWYGVFFTVGIFLACLSARYLAL
FT                   SYYGLKDHLSFSKSQLRVALENFFIYSILFIVPGARLAYVIFYGWSFYLQHPEEIIQIW
FT                   HGGLSSHGGVLGFLLWAAIFSWIYKKKISKLTFLFLTDLCGSVFGIAAFFIRLGNFWNQ
FT                   EIVGTPTSLPWGVVFSDPMQGVQGVPVHPVQLYEGISYLVVSGILYFLSYKRYLHLGKG
FT                   YVTSIACISVAFIRFFAEYVKSHQGKVLAEDCLLTIGQILSIPLFLFGVALLIICSLKA
FT                   RRHRSHI"
FT   gene            354524..354979
FT                   /locus_tag="CPn_0312"
FT   CDS_pept        354524..354979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0312"
FT                   /product="CT101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18461"
FT                   /db_xref="GOA:Q9Z8M6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8M6"
FT                   /protein_id="AAD18461.1"
FT                   /translation="MARNIKYFLILFPGILWISAGMKLLLKATAIALDPLSSFFTYCLL
FT                   SMVSWGLASLKHRYLLSKTIRKQLSLSSEFFSQKITWIAYIKQTFISRRFLIMVIMIAF
FT                   SLVLRRYISNPQALFVIRATVGYALIKTAIAYFSKLQNALMENPEGN"
FT   gene            354990..355358
FT                   /gene="acpS"
FT                   /locus_tag="CPn_0313"
FT   CDS_pept        354990..355358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="CPn_0313"
FT                   /product="Acyl-carrier Protein Synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18462"
FT                   /db_xref="GOA:Q9Z8M5"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M5"
FT                   /protein_id="AAD18462.1"
FT                   /translation="MEIIHIGTDIIEISRIREAIATHGNRLLNRIFTEAEQKYCLEKTD
FT                   PIPSFAGRFAGKEAVAKALGTGIGSVVAWKDIEVFKVSHGPEVLLPSHVYAKIGISKVI
FT                   LSISHCKEYATATAIALA"
FT   gene            complement(355350..356285)
FT                   /gene="trxB"
FT                   /locus_tag="CPn_0314"
FT   CDS_pept        complement(355350..356285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="CPn_0314"
FT                   /product="Thioredoxin Reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18463"
FT                   /db_xref="GOA:Q9Z8M4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M4"
FT                   /protein_id="AAD18463.1"
FT                   /translation="MIHSRLIIIGSGPSGYTAAIYASRALLHPLLFEGFFSGISGGQLM
FT                   TTTEVENFPGFPEGILGPKLMNNMKEQAVRFGTKTLAQDIISVDFSVRPFILKSKEETY
FT                   SCDACIIATGASAKRLEIPGAGNDEFWQKGVTACAVCDGASPIFKNKDLYVIGGGDSAL
FT                   EEALYLTRYGSHVYVVHRRDKLRASKAMEARAQNNEKITFLWNSEIVKISGDSIVRSVD
FT                   IKNVQTQEITTREAAGVFFAIGHKPNTDFLGGQLTLDESGYIVTEKGTSKTSVPGVFAA
FT                   GDVQDKYYRQAVTSAGSGCIAALDAERFLG"
FT   gene            356977..358719
FT                   /gene="rs1"
FT                   /locus_tag="CPn_0315"
FT   CDS_pept        356977..358719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs1"
FT                   /locus_tag="CPn_0315"
FT                   /product="S1 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18464"
FT                   /db_xref="GOA:Q9Z8M3"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M3"
FT                   /protein_id="AAD18464.1"
FT                   /translation="MPKQAEYTWGSKKILDNIECLTEDVAEFKDLLYTAHRITSSEEES
FT                   DNEIQPGAILKGTVVDINKDFVVVDVGLKSEGVIPMSEFIDSSEGLVLGAEVEVYLDQA
FT                   EDEEGKVVLSREKATRQRQWEYILAHCEEGSIVKGQITRKVKGGLIVDIGMEAFLPGSQ
FT                   IDNKKIKNLDDYVGKVCEFKILKINVERRNIVVSRRELLEAERISKKAELIEQISIGEY
FT                   RKGVVKNITDFGVFLDLDGIDGLLHITDMTWKRIRHPSEMVELNQELEVIILSVDKEKG
FT                   RVALGLKQKEHNPWEDIEKKYPPGKRVLGKIVKLLPYGAFIEIEEGIEGLIHISEMSWV
FT                   KNIVDPSEVVNKGDEVEAIVLSIQKDEGKISLGLKQTERNPWDNIEEKYPIGLHVNAEI
FT                   KNLTNYGAFVELEPGIEGLIHISDMSWIKKVSHPSELFKKGNSVEAVILSVDKESKKIT
FT                   LGVKQLSSNPWNEIEAMFPAGTVISGVVTKITAFGAFVELQNGIEGLIHVSELSDKPFA
FT                   KIEDIISIGENVSAKVIKLDPDHKKVSLSVKEYLADNAYDQDSRTELDFKDSQGPKERK
FT                   KKGK"
FT   gene            358820..360124
FT                   /gene="nusA"
FT                   /locus_tag="CPn_0316"
FT   CDS_pept        358820..360124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="CPn_0316"
FT                   /product="N Utilization Protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18465"
FT                   /db_xref="GOA:Q9Z8M2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8M2"
FT                   /protein_id="AAD18465.1"
FT                   /translation="MNKNLVAIFDYMEKEKGIQRSTIIGAIESALKIAAKKTLRDDANI
FT                   SVNINSRTGDIEVFCEKEIVEICQNPSKEIPLDKAREYDPDCQIGQYMDVPFVSDNFGR
FT                   IAAHAARQIIGQKLRHAERDVIYEEYRHRVNETLSGVVKRFAKGSNLIIDLGKVEAILP
FT                   TRFYPKTEKHKIGDKIYALLYEVQESENGGAEVILSRSHAEFVKQLFIQEVPELEEGSV
FT                   EIVKIAREAGYRTKLAVRSSDPKTDPVGAFVGMRGSRVKNIIRELNDEKIDIVNYSPVS
FT                   TELLQNLLYPIEIQKIAILEDDKVIAIVVNDADYATVIGKRGINARLISHILDYELEVQ
FT                   RMSEYNKLLEIQRLQLAEFDSPHLDQPLEMEGISKLVIQNLEHAGYDTIRRVLLASAND
FT                   LASVPGISLELAYKILEQVSKYGESKVDEKPEIED"
FT   gene            360081..362753
FT                   /gene="infB"
FT                   /locus_tag="CPn_0317"
FT   CDS_pept        360081..362753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="CPn_0317"
FT                   /product="Initiation Factor-2"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18466"
FT                   /db_xref="GOA:Q9Z8M1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M1"
FT                   /protein_id="AAD18466.1"
FT                   /translation="MEKVKLTKNLKLKIKNAQLTKAAGLDKLKQKLAQAGSSEAKSSSE
FT                   KPSAKEKSVKVALAATSTPTASAEQASPESTSRRIRAKNRSSFSSSEEESSAHIPVDTS
FT                   EPAPVSIADPEPELEVVDEVCDESPEVHPVAEVLPEQPVLPETPPQEKELEPKPVKPAE
FT                   PKSVVMIKSKFGPTGKHINHLLAKTFKAPAKEEKVVAGSKSTKPVASDKTGKPGTSEGG
FT                   EQNNREKQFNPANRSPASGPKRDAGKKNLTDFRDRSKKSDESLKAFTGRDRYGLNEGGE
FT                   EDRWRKKRVYKPKKHYDEASIQRPTHIKISLPITVKDLAAEMKLKASEVIQKLFIHGMT
FT                   YVVNDILDSETAVQFIGLEFGCTIDIDYSEQDKLCLSNDTVRDEIQSTDPSKLVIRSPI
FT                   VAFMGHVDHGKTTLIDSLRKSNVAATEAGAITQHMGAFCCSTPVGDITILDTPGHEAFS
FT                   AMRARGAEVCDIVVLVVAGDEGIKEQTLEAIEHAKAADIAIVVAINKCDKPNFNSETIY
FT                   RQLSEINLLPEAWGGSTVTVNTSAKTGEGLSELLEMLALQAEVLELKADPSARARGLVI
FT                   ESELHKGLGPVATVLIQNGSLKLGEALVFNDCYGKVKTMHNEHNELMKEAGPSIPVLIT
FT                   GLSDIPKAGDPFFVVKNEKTARDIIEARSAGQQRFALQQKKRPNFDSMLQNKKTLKLMI
FT                   KADVQGSIEALVSSISKIKSEKVDVEILTNSVGEISESDIRLAAASKAVLIGFHTGIES
FT                   HAEPLIKSLGVRVELFTVIYHAIDAIKEIMTSLLDPIAEEKDEGSAEIKEIFRSSQVGS
FT                   IYGCIVTEGIMTRNHKVRVLRNKEILWKGTLSSLKRVKEDVKEVRKGLECGILLEGYQQ
FT                   AQIGDVLQCYEVIYHPQKL"
FT   gene            362767..363129
FT                   /gene="rbfA"
FT                   /locus_tag="CPn_0318"
FT   CDS_pept        362767..363129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="CPn_0318"
FT                   /product="Ribosome Binding Factor A"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18467"
FT                   /db_xref="GOA:Q9Z8M0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M0"
FT                   /protein_id="AAD18467.1"
FT                   /translation="MTENRRIKRVNALLQEAIAKVILKDVKHPKISNLWITVTRVSLSK
FT                   DLHSARVYVSVMPHENTKEEALEALKVSAGFIAHRASKNVVLKYFPELHFYLDDIFSPQ
FT                   DYIENLLWQIQEKEKS"
FT   gene            363175..363882
FT                   /gene="truB"
FT                   /locus_tag="CPn_0319"
FT   CDS_pept        363175..363882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="CPn_0319"
FT                   /product="tRNA Pseudouridine Synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18468"
FT                   /db_xref="GOA:Q9Z8L9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8L9"
FT                   /protein_id="AAD18468.1"
FT                   /translation="MDLAVELKEGILLVDKPQGRTSFSLIRALTKLIGVKKIGHAGTLD
FT                   PFATGVMVMLIGRKFTRLSDILLFEDKEYEAIAHLGTTTDSYDCDGKVVGRSKKIPSLE
FT                   EVLSAAEYFQGEIQQLPPMFSAKKVQGKKLYEYARKGLSIERHHSTVQVHLQITKYEYP
FT                   LLHFVVSCSKGTYIRSIAHELGTMLGCGAYLEQLRRLRSGRFSIDECIDGNLLDHPDFD
FT                   ISPYLRDAHGNSL"
FT   gene            363860..364786
FT                   /gene="ribF"
FT                   /locus_tag="CPn_0320"
FT   CDS_pept        363860..364786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="CPn_0320"
FT                   /product="FAD Synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18469"
FT                   /db_xref="GOA:Q9Z8L8"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8L8"
FT                   /protein_id="AAD18469.1"
FT                   /translation="MPMEIAYSLTSSFSVDSVTVGFFDGCHLGHSNLLSILTSYSGSSG
FT                   VITFDSHPQTVLSLNHTKLINTKEERLQLLQTFPIDWLGVLTFDLNFANQSAEEFLTLL
FT                   HRNLKCKRLILGYDSCIGKEQQSNTEALDTIGKPLGIEVIKIPPYRMDNIVVSSKAIRQ
FT                   FLSAGNLECAHRFLGHPYAISGKITEGSGIGGSLGFATINLPREESLIPLGVYACEIRY
FT                   DSTTCQGVMNLGTAPTFGRESLYAEAHIFSFAENLYGKEVSIIPRKFLREEKKFQSKET
FT                   LIRAIEKDILDAQDWFAKGSFNYEGTA"
FT   gene            complement(364764..365858)
FT                   /gene="ychF"
FT                   /locus_tag="CPn_0321"
FT   CDS_pept        complement(364764..365858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="CPn_0321"
FT                   /product="GTP Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18470"
FT                   /db_xref="GOA:Q9Z8L7"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8L7"
FT                   /protein_id="AAD18470.1"
FT                   /translation="MSHTECGIVGLPNVGKSGLFNALTGAQVASCNYPFCTIDPNVGIV
FT                   PVIDERLEALAKISNSQKIIYADMKFVDIAGLVKGASDGAGLGNRFLSHIRETHAIAHV
FT                   VRCFDDPDVTHVSGKVNPVEDIEVINLELIFSDFSSAKNIHSKLEKLAKGKREVGALLP
FT                   LFDTIIAHLEKGLPLRTLELTPEQIVALKPYPFLTMKPMFYIANVDESSLPDMDNDYVA
FT                   AVREVAAKENSKVVPICVRIEEEIVSLPIEERLEFLMSLGLEKSGLHRLVRAAYDTLGL
FT                   ISYFTTGPQESRAWTVVRGSSAWEAAGEIHTDIQKGFIRAEVITFEDMIECQGRAAARE
FT                   LGKLHIEGRDYIVQDGDTMLFLHN"
FT   gene            366249..367331
FT                   /gene="yscU"
FT                   /locus_tag="CPn_0322"
FT   CDS_pept        366249..367331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yscU"
FT                   /locus_tag="CPn_0322"
FT                   /product="Yop proteins translocation protein U"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18471"
FT                   /db_xref="GOA:Q9Z8L6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8L6"
FT                   /protein_id="AAD18471.1"
FT                   /translation="MGEKTEKATPKRLRDARKKGQVAKSQDFPSAVTFIVSMFTAFSLS
FT                   TFFFKHLGGFLVSMLSQAPTRHDPVITLFYLKNCLMLILTASLPLLGAVAVVGVIVGFL
FT                   IVGPTFSTEVFKPDIKKFNPIENIKQKFKIKTLIELIKSILKIFGAALILYITLKSKVS
FT                   LIIETAGVSPIITAQIFKEIFYKAVTSIGIFFLIVAILDLVYQRHNFAKELKMEKFEVK
FT                   QEFKDTEGNPEIKGRRRQIAQEIAYEDSSSQVKHASTVVSNPKDIAVAIGYMPEKYKAP
FT                   WIIAMGINLRAKRILDEAEKYGIPIMRNVPLAHQLLDEGKELKFIPESTYEAIGEILLY
FT                   ITSLNAQNPNNKNTNQPDHL"
FT   gene            367331..369463
FT                   /gene="lcrD"
FT                   /locus_tag="CPn_0323"
FT   CDS_pept        367331..369463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcrD"
FT                   /locus_tag="CPn_0323"
FT                   /product="Low Calcium Response D"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18472"
FT                   /db_xref="GOA:Q9Z8L5"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8L5"
FT                   /protein_id="AAD18472.1"
FT                   /translation="MNKLLNFVSRTLGGDTALNMINKSSDLILALWMMGVVLMIIIPLP
FT                   PPIVDLMITINLSISVFLLMVALYIPSALQLSVFPSLLLITTMFRLGINISSSRQILLK
FT                   AYAGHVIQAFGDFVVGGNYVVGFIIFLIITIIQFIVVTKGAERVAEVAARFRLDAMPGK
FT                   QMAIDADLRAGMIDATQARDKRAQIQKESELYGAMDGAMKFIKGDVIAGIVISLINIVG
FT                   GLTIGVAMHGMDLAQAAHVYTLLSIGDGLVSQIPSLLIALTAGIVTTRVSSDKNTNLGK
FT                   EISTQLVKEPRALLLAGAATLGVGFFKGFPLWSFSILALIFVALGILLLTKKSAAGKKG
FT                   GGSGASTTVGAAGDGAATVGDNPDDYSLTLPVILELGKDLSKLIQHKTKSGQSFVDDMI
FT                   PKMRQALYQDIGIRYPGIHVRTDSPSLEGYDYMILLNEVPYVRGKIPPHHVLTNEVEDN
FT                   LSRYNLPFITYKNAAGLPSAWVSEDAKAILEKAAIKYWTPLEVIILHLSYFFHKSSQEF
FT                   LGIQEVRSMIEFMERSFPDLVKEVTRLIPLQKLTEIFKRLVQEQISIKDLRTILESLSE
FT                   WAQTEKDTVLLTEYVRSSLKLYISFKFSQGQSAISVYLLDPEIEEMIRGAIKQTSAGSY
FT                   LALDPDSVNLILKSMRNTITPTPAGGQPPVLLTAIDVRRYVRKLIETEFPDIAVISYQE
FT                   ILPEIRIQPLGRIQIF"
FT   gene            369492..370691
FT                   /gene="lcrE"
FT                   /locus_tag="CPn_0324"
FT   CDS_pept        369492..370691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcrE"
FT                   /locus_tag="CPn_0324"
FT                   /product="Low Calcium Response E"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18473"
FT                   /db_xref="GOA:Q9Z8L4"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="PDB:4NRH"
FT                   /db_xref="PDB:4P3Z"
FT                   /db_xref="PDB:4P40"
FT                   /db_xref="PDB:6GX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8L4"
FT                   /protein_id="AAD18473.1"
FT                   /translation="MAASGGTGGLGGTQGVNLAAVEAAAAKADAAEVVASQEGSEMNMI
FT                   QQSQDLTNPAAATRTKKKEEKFQTLESRKKGEAGKAEKKSESTEEKPDTDLADKYASGN
FT                   SEISGQELRGLRDAIGDDASPEDILALVQEKIKDPALQSTALDYLVQTTPPSQGKLKEA
FT                   LIQARNTHTEQFGRTAIGAKNILFASQEYADQLNVSPSGLRSLYLEVTGDTHTCDQLLS
FT                   MLQDRYTYQDMAIVSSFLMKGMATELKRQGPYVPSAQLQVLMTETRNLQAVLTSYDYFE
FT                   SRVPILLDSLKAEGIQTPSDLNFVKVAESYHKIINDKFPTASKVEREVRNLIGDDVDSV
FT                   TGVLNLFFSALRQTSSRLFSSADKRQQLGAMIANALDAVNINNEDYPKASDFPKPYPWS
FT                   "
FT   gene            370708..371151
FT                   /gene="sycE"
FT                   /locus_tag="CPn_0325"
FT   CDS_pept        370708..371151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sycE"
FT                   /locus_tag="CPn_0325"
FT                   /product="Secretion Chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18474"
FT                   /db_xref="GOA:Q9Z8L3"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8L3"
FT                   /protein_id="AAD18474.1"
FT                   /translation="MQNQYEQLLESLAPLLNTTLAPDKNNSCLIRFSDTHVPVQIEEDG
FT                   NSGDLAVSTLLGTLPENVFRERIFKAALSVNGSFQSSIKGILGYGEVTQQLYLSDILSM
FT                   NYLNGEKLFEYLKLFSLHAKIWMESLRTGNLPDLHVLGIYYVA"
FT   gene            371148..372728
FT                   /gene="malQ"
FT                   /locus_tag="CPn_0326"
FT   CDS_pept        371148..372728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="CPn_0326"
FT                   /product="Glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18475"
FT                   /db_xref="GOA:Q9Z8L2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8L2"
FT                   /protein_id="AAD18475.1"
FT                   /translation="MNVLKYTKHSPSAHAWKLIGTSPKHGIYLPLFSIHTKNSCGIGEF
FT                   LDLIPLISWCQKQGFSVIQLLPLNDTGEDTSPYNSISSVALNPLFLSLSSLPNIDTIPE
FT                   VAKKLQDMHELCSTPSVSYTQVKEKKWAFLREYYQKCCKSSLEGNSNFSEFLESERYWL
FT                   YPYGTFRAIKHHMHGEPINNWPKSLTDQENFPDLTKKFHDEVLFFSYLQFLCYQQLCEV
FT                   KAYADQHHVLLKGDLPILISKDSCDVWYFRDYFSSSRSVGAPPDLYNSEGQNWHLPIYN
FT                   FSQLAKDDYIWWKERLRYAQNFYSVYRLDHIIGFFRLWIWDSSGRGRFIPDNPKDYIKQ
FT                   GTEILSTMLGASSMLPIGEDLGIIPQDVKTTLTHLGICGTRIPRWERNWESDSAFIPLK
FT                   DYNPLSVTTLSTHDSDTFAQWWLNSPKEAKQFAKFLHLPFQKTLTTETQIDILKLSHES
FT                   ASIFHINLFNDYLALCPDLVSKNLQRERINTPGTISKKNWSYRVRPSLEELAIHKKFNG
FT                   YIEKILTGL"
FT   gene            372945..373214
FT                   /gene="rl28"
FT                   /locus_tag="CPn_0327"
FT   CDS_pept        372945..373214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl28"
FT                   /locus_tag="CPn_0327"
FT                   /product="L28 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18476"
FT                   /db_xref="GOA:Q9Z8L1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8L1"
FT                   /protein_id="AAD18476.1"
FT                   /translation="MSRKCPLTGKRPRRGYSYTLRGIAKKKKGIGLKVTGKTKRRFFPN
FT                   MLTKRLWSTEENRFLKLKISASALRHIDKLGLEKVLERAKSKNF"
FT   gene            373241..374995
FT                   /locus_tag="CPn_0328"
FT   CDS_pept        373241..374995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0328"
FT                   /product="CT085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18477"
FT                   /db_xref="GOA:Q9Z8L0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8L0"
FT                   /protein_id="AAD18477.1"
FT                   /translation="MSFLRRHISLFRSQKQLIDVFAPVSPNLELAEIHRRVIEDQGPAL
FT                   LFHNVIGSSFPVLTNLFGTKHRVDQLFSQAPDNLIARVAHLISSTPKLSSLWKSRDLLK
FT                   RISSLGLKKARFRRFPFVSMSSVNLDHLPLLTSWPEDGGAFLTLPLVYTESPTLTTPNL
FT                   GMYRVQRFNQNTMGLHFQIQKGGGMHLYEAEQKKQNLPVSVFLSGNPFLTLSAIAPLPE
FT                   NVSELLFATFLQGAKLLYKKTNDHPHPLLYDAEFILVGESPAGKRRPEGPFGDHFGYYS
FT                   LQHDFPEFHCHKIYHRKDAIYPATVVGKPYQEDFYIGNKLQEYLSPLFPLVMPGVRRLK
FT                   SYGESGFHALTAAVVKERYWRESLTTALRILGEGQLSLTKFLMVTDQEVPLDRFSVVLE
FT                   TILERLQPDRDLIIFSETANDTLDYTGPSLNKGSKGIFMGIGKAIRDLPHGYQGGKIHG
FT                   VQDIAPFCRGCLVLETSLEDRCIKSLLHHPDLKSWPLIILADNLRETIQSEKDFLWRTF
FT                   TRCAPANDLHALHSHFATHRPNYNFPFVIDALMKPSYPKEVEVDPSTKQKVSERWHAYF
FT                   PNKETFYI"
FT   gene            375088..376149
FT                   /locus_tag="CPn_0329"
FT   CDS_pept        375088..376149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0329"
FT                   /product="Phopholipase D Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18478"
FT                   /db_xref="GOA:A0A0F7XE33"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XE33"
FT                   /protein_id="AAD18478.1"
FT                   /translation="MNKRQKDKLKICVIISTLILVGIFARAPRGDTFKTFLKSEEAIIY
FT                   SNQCNEDMRKILCDAIEHADEEIFLRIYNLSEPKIQQSLTRQAQAKNKVTIYYQKFKIP
FT                   QILKQASNVTLVEQPPAGRKLMHQKALSIDKKDAWLGSANYTNLSLRLDNNLILGMHSS
FT                   ELCDLIITNTSGDFSIKDQTGKYFVLPQDRKIAIQAVLEKIQTAQKTIQVAMFALTHSE
FT                   IIQALHQAKQRGIHVDIIIDRSHSKLTFKQLRQLNINKDFVSINTAPCTLHHKFAVIDN
FT                   KTLLAGSINWSKGRFSLNDESLIILENLTKQQNQKLRMIWKDLAKHSEHPTVDDEEKEI
FT                   IEKSLPVEEQEAA"
FT   gene            complement(376199..376675)
FT                   /locus_tag="CPn_0330"
FT   CDS_pept        complement(376199..376675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0330"
FT                   /product="CT083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8K8"
FT                   /protein_id="AAD18479.1"
FT                   /translation="MRIIRFDPYGALSAQSIAKDSRQNSPLVEKISEEIATNEAIRLAL
FT                   LAIGDREQEEKKQRHRYKLLGQKQAKVLLSQLRHVHLDFKKLYCDSKKKEDQEKDEKNK
FT                   QKRSIKVTKKKKGISLGAAASQAIAAAAEAWVIARNKGVLETASTLFYQKDEEA"
FT   gene            complement(376698..378437)
FT                   /locus_tag="CPn_0331"
FT   CDS_pept        complement(376698..378437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0331"
FT                   /product="CT082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18480"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8K7"
FT                   /protein_id="AAD18480.1"
FT                   /translation="MAVSGGGGVQPSSDPGKWNPALQGEQAEGPSPLKESIFSETKQAS
FT                   SAAKQESLVRSGSTGMYATESQINKAKYRKAQDRSSTSPKSKLKGTFSKMRASVQGFMS
FT                   GFGSRASRVSAKRASDSGEGTSLLPTEMDVALKKGNRISPEMQGFFLDASGMGGSSSDI
FT                   SQLSLEALKSSAFSGARSLSLSSSESSSVASFGSFQKAIEPMSEEKVNAWTVARLGGEM
FT                   VSSLLDPNVETSSLVRRAMATGNEGMIDLSDLGQEEVSTAMTSPRAVEGKVKVSSSDSP
FT                   EANPTGIPNSNTLERAEKEAEKQESREQLSEDQMMLARAMAGLLTGAAPQEVLSNSVWS
FT                   GPSTVFPPPKFSGTLPTQRSGDKSKHKSPGIEKSTNHTNFSPLREGTVKSAEVKSLPHP
FT                   ESMYRFPKDSIVSREEPEAVVKESTAFKNPENSSQNFLPIAVESVFPKESGTGGALGSD
FT                   AVSSSYHFLAQRGVSLLAPLPRATDDYKEKLEAHKGPGGPPDPLIYQYRNVAVEPPIVL
FT                   RSPQPFSGSSRLSVQGKPEAASVHDDGGGGNSGGFSGDQRRGSSGQKASRQEKKGKKLS
FT                   TDI"
FT   gene            complement(378533..378655)
FT                   /locus_tag="CPn_0332"
FT   CDS_pept        complement(378533..378655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0332"
FT                   /product="CHLTR T2 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18481"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULI8"
FT                   /protein_id="AAD18481.1"
FT                   /translation="MIPLARQRCTLLHLLAVLCPPISFFTQGVSPCVFFCFLDF"
FT   gene            complement(378797..379090)
FT                   /locus_tag="CPn_0333"
FT   CDS_pept        complement(378797..379090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0333"
FT                   /product="LtuB Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18482"
FT                   /db_xref="InterPro:IPR020502"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K5"
FT                   /protein_id="AAD18482.1"
FT                   /translation="MGKPKKSRTDRALAQEIQKKSTEVLKKPARIKAKNRRKFLIAKEQ
FT                   KTLKHRAQEYDQLVRSLLDSQKKDTDKVLIFNYENGFVFTDKDHFSKYSIRL"
FT   gene            379311..379826
FT                   /locus_tag="CPn_0334"
FT   CDS_pept        379311..379826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0334"
FT                   /product="CT079 similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18483"
FT                   /db_xref="GOA:A0A0F7WSE7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WSE7"
FT                   /protein_id="AAD18483.1"
FT                   /translation="MSVHITPRKCFILCILSMFTLPTLFPKAHLILFSPYIVLCFYCFS
FT                   KDKGLVLALGCGVLSDLALGSRGVFLLLYPLTALITHKAHLIFSKESKAALVIVNMIFY
FT                   GVFLLLTIPMCALFGHEVRWSIDVLMIPLKCSFLDNLIFTSVIYILPCAINSGIHKMIS
FT                   FFRRLVCY"
FT   gene            379817..380677
FT                   /gene="folD"
FT                   /locus_tag="CPn_0335"
FT   CDS_pept        379817..380677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="CPn_0335"
FT                   /product="Methylene Tetrahydrofolate Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18484"
FT                   /db_xref="GOA:Q9Z8K3"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K3"
FT                   /protein_id="AAD18484.1"
FT                   /translation="MLLRGIPAAEKILQRLKEEISQSPTSPGLAVVLIGNDPASEVYVG
FT                   MKVKKATEIGIISKAHKLPSDSTLSSVLKLIERLNQDPSIHGILVQLPLPKHLDSEVIL
FT                   QAISPDKDVDGLHPVNMGKLLLGNFDGLLPCTPAGIIELLNYYEIPLRGRHAAIVGRSN
FT                   IVGKPLAALMMQKHPQTNCTVTVLHSQSENLPEILKTADIIIAALGAPLFIKETMVAPH
FT                   AVIVDVGTTRVPADNAKGYTLLGDVDFNNVVTKCAAITPVPGGVGPMTVAMLMSNTWRC
FT                   YQNFS"
FT   gene            380650..381594
FT                   /gene="yojL"
FT                   /locus_tag="CPn_0336"
FT   CDS_pept        380650..381594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojL"
FT                   /locus_tag="CPn_0336"
FT                   /product="YojL hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18485"
FT                   /db_xref="GOA:Q9Z8K2"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K2"
FT                   /protein_id="AAD18485.1"
FT                   /translation="MAMLPKFFLVLLCLGLCSCSQKTTTIEGEQMTIFYRIVLGTSLSA
FT                   KEKASLSQQIDRCFHKIDSIYNNWNPYSELSIINRAPADVPITLSVELSEFLDQVDTLY
FT                   KLSEGRFDPTVGPLKTLWLLHLKSQTLPPKDVWEQHYKDMGWQHLEFQSNTKTLIKKNP
FT                   HVQIDLCGVVKGYAVDCLNEICNTFCPNNYVEWGGEIKTSGHHPSGRPWRIFSEAAGTI
FT                   LDIDDMAIATSGNHIQKWCVEGKIYTHILDTRTGKPLELSSYPIQSVSVVHPSCAYADA
FT                   IATVLMTFDSKIEAKQWAEEHHILTYINDGASS"
FT   gene            complement(381572..382027)
FT                   /gene="smpB"
FT                   /locus_tag="CPn_0337"
FT   CDS_pept        complement(381572..382027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="CPn_0337"
FT                   /product="Small Protein B"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18486"
FT                   /db_xref="GOA:Q9Z8K1"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K1"
FT                   /protein_id="AAD18486.1"
FT                   /translation="MAQKEIVSNRKALRNYEVIETLEAGIVLTGTEIKSLRDHGGNLGD
FT                   AYVIVSKGEGWLLNASIAPYRFGNIYNHEERRKRKLLLHRYELRKLEGKIAQKGMTLIP
FT                   LGMFLSRGYVKVRLGCCRGKKAYDKRRTIIEREKEREVAAAMKRRHH"
FT   gene            382278..383378
FT                   /gene="dnaN"
FT                   /locus_tag="CPn_0338"
FT   CDS_pept        382278..383378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CPn_0338"
FT                   /product="DNA Polymerase III (beta chain)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18487"
FT                   /db_xref="GOA:Q9Z8K0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K0"
FT                   /protein_id="AAD18487.1"
FT                   /translation="MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETYNDELVFT
FT                   ATDLTVSTRCVTKAKVYEKGAISIPSKRFFQLVKELTEANLEISSSAGEMAQITSGSSC
FT                   FRLLSMEKEDFPMLPDIQNALRFSLPAEQLKTMLQRTSFAVSREESRYVLTGVLLAIAN
FT                   GVATIVGTDGKRLAKIDAEVTLDKSFSGEYIIPIKAVEEIIKMCSDEGEAAIFLDQDKI
FT                   AVECDNTLLITKLLSGEFPDFSPVISTESNVKLDLHREELITLLKQVALFTNESSHSVK
FT                   FSFLPGELTLTANCTKVGEGKVSMAVNYSGELLEIAFNPFFFLDILKHSKDELVSLGIS
FT                   DSYNPGIITDSASGLFVIMPMRLHDD"
FT   misc_feature    383420..384498
FT                   /note="ABC superfamily ATPase; contains frame shifts"
FT   gene            383420..384037
FT                   /gene="recF"
FT                   /locus_tag="CPn_0339"
FT   gene            383842..384159
FT                   /locus_tag="CPn_0340"
FT   gene            384160..384498
FT                   /locus_tag="CPn_0341"
FT   misc_feature    384622..385598
FT                   /note="predicted OMP; contains frame shift"
FT   gene            384622..385065
FT                   /locus_tag="CPn_0342"
FT   gene            384999..385598
FT                   /locus_tag="CPn_0343"
FT   gene            complement(385555..387420)
FT                   /gene="yaeL"
FT                   /locus_tag="CPn_0344"
FT   CDS_pept        complement(385555..387420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="CPn_0344"
FT                   /product="Metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18488"
FT                   /db_xref="GOA:Q9K275"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K275"
FT                   /protein_id="AAD18488.1"
FT                   /translation="MTIIYFILAALALGILVLIHELGHLVVAKAVGMAVESFSIGFGPA
FT                   LFKKRIGGIEYRIGCIPFGGYVRIRGMERTKEKGEKGKIDSVYDIPQGFFSKSPWKRIL
FT                   VLVAGPLANILLAVLAFSILYMNGGRSKNYSDCSKVVGWVHPVLQAEGLLPGDEILTCN
FT                   GKPYVGDKDMLTTSLLEGHLNLEIKRPGYLTVPSKEFAIDVEFDPTKFGVPCSGASYLL
FT                   YSNQVPLTKNSPMENSELRPNDRFVWMDGTLLFSMAQISQILNESYAFVKVARNDKIFF
FT                   SRQPRVLASVLHYTPYLRNELIDTQYEAGLKGKWSSLYTLPYVINSYGYIEGELTAIDP
FT                   ESPLPQPQERLQLGDRILAIDGTPVSGSVDILRLVQNHRVSIIVQQMSPQELEEVNSRD
FT                   ADKRFIASYHSEDLLQILNHLGESHPVEVAGPYRLLDPVQPRPWIDVYSSESLDKQLEV
FT                   AKKIKNKDKQRYYLERLDAEKQKPSLGISLKDLKVRYNPSPVVMLSNITKESLITLKAL
FT                   VTGHLSPQWLSGPVGIVQVLHTGWSVGFSEVLFWIGLISMNLAVLNLLPIPVLDGGYIL
FT                   LCLWEIVKRRRLNMKIVERILVPFTFLLIIFFIFLTFQDLFRFFG"
FT   gene            complement(387433..388572)
FT                   /gene="yaeM"
FT                   /locus_tag="CPn_0345"
FT   CDS_pept        complement(387433..388572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeM"
FT                   /locus_tag="CPn_0345"
FT                   /product="CT071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18489"
FT                   /db_xref="GOA:Q9Z8J8"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J8"
FT                   /protein_id="AAD18489.1"
FT                   /translation="MKHLAVLGSTGSIGRQTLEIVRRYPSEFKIISMASYGNNLRLFFQ
FT                   QLEEFAPLAAAVYNEEVYNEACQRFPHMQFFLGQEGLTQLCIMDTVTTVVAASSGIEAL
FT                   PAILESMKKGKALALANKEILVCAGELVSKTAKENGIKVLPIDSEHNALYQCLEGRTIE
FT                   GIKKLILTASGGPLLNKSLEELSCVTKQDVLNHPIWNMGSKVTVDSSTLVNKGLEIIEA
FT                   YWLFGLENVEILAVIHPQSLIHGMVEFLDGSVISIMNPPDMLFPIQYALTAPERFASPR
FT                   DGMDFSKKQTLEFFPVDEERFPSIRLAQQVLEKQGSSGSFFNAANEVLVRRFLCEEISW
FT                   CDILRKLTTLMECHKVYACHSLEDILEVDGEARALAQEI"
FT   gene            complement(388701..389675)
FT                   /gene="ytgD"
FT                   /locus_tag="CPn_0346"
FT   CDS_pept        complement(388701..389675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytgD"
FT                   /locus_tag="CPn_0346"
FT                   /product="Integral Membrane Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18490"
FT                   /db_xref="GOA:Q9Z8J7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J7"
FT                   /protein_id="AAD18490.1"
FT                   /translation="MALGPSPYYGVSFFQFFSVFFSRLFSGSLFTGSLYIDDIQIIVFL
FT                   AISCSGAFAGTFLVLRKMAMYANAVSHTVLFGLVCVCLFTHQLTTLSLGTLTLAAMATA
FT                   MLTGFLIYFIRNTFKVSEESSTALVFSLLFSLSLVLLVFMTKNAHIGTELVLGNADSLT
FT                   KEDIFPVTIVILANAVITIFAFRSLVCSSFDSVFASSLGIPIRLVDYLIIFQLSACLVG
FT                   AFKAVGVLMALAFLIIPSLIAKVIAKSIRSLMAWSLVFSIGTAFLAPASSRAILSAYDL
FT                   GLSTSGISVVFLTMMYIVVKFISYFRGYFSKNFEKISEKSSQY"
FT   gene            complement(389675..391021)
FT                   /gene="ytgC"
FT                   /locus_tag="CPn_0347"
FT   CDS_pept        complement(389675..391021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytgC"
FT                   /locus_tag="CPn_0347"
FT                   /product="Integral Membrane Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18491"
FT                   /db_xref="GOA:Q9Z8J6"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J6"
FT                   /protein_id="AAD18491.1"
FT                   /translation="MLSCVFSDTIFLSSFLAVTLICMTTALWGTILLISKQPLLSESLS
FT                   HASYPGLLVGALMAQYVFSLQASIFWIVLFGCAASVFGYGIIVFLGKVCKLHKDSALCF
FT                   VLVVFFAIGVILASYVKESSPTLYNRINAYLYGQAATLGFLEATLAAIVFCASLFALWW
FT                   WYRQIVVTTFDKDFAVTCGLKTVLYEALSLIFISLVIVSGVRSVGIVLISAMFVAPSLG
FT                   ARQLSDRLSTILILSAFFGGISGALGSYISVAFTCRAIIGQQAVPVTLPTGPLVVICAG
FT                   LLAGLCLLFSPKSGWVIRFVRRKHFSFSKDQEHLLKVFWHISHNRLENISVRDFVCSYK
FT                   YQEYFGPKPFPRWRVQILEWRGYVKKEQDYYRLTKKGRSEALRLVRAHRLWESYLVNSL
FT                   DFSKESVHELAEEIEHVLTEELDHTLTEILNDPCYDPHRQIIPNKKKEV"
FT   gene            complement(391024..391803)
FT                   /gene="ytgB_1"
FT                   /locus_tag="CPn_0348"
FT   CDS_pept        complement(391024..391803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytgB_1"
FT                   /locus_tag="CPn_0348"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18492"
FT                   /db_xref="GOA:Q9Z8J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J5"
FT                   /protein_id="AAD18492.1"
FT                   /translation="MNVKDETFWSVHNLCVNYEHAAVLYHISFSLGKGSLTAILGPNGA
FT                   GKSTLLKASLGLIKPSSGTVYFFNQKFKKVRQRIAYMPQRASVDWDFPMTVLDLALMGC
FT                   YSYKGMWGRISSDDRREAFHILERVGLESVADRQIGQLSGGQQQRAFLARALMQKADLY
FT                   LMDELFSAIDMASFKTSVGVLQELRDQGKTIVVVHHDLSHVRQLFDHVVLLNKRLICCG
FT                   PTDECLNGDTIFQTYGCEIELLEQTLKLSRGKQFGSC"
FT   gene            complement(391787..392770)
FT                   /gene="ytgA"
FT                   /locus_tag="CPn_0349"
FT   CDS_pept        complement(391787..392770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytgA"
FT                   /locus_tag="CPn_0349"
FT                   /product="Solute Protein Binding Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18493"
FT                   /db_xref="GOA:Q9Z8J4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J4"
FT                   /protein_id="AAD18493.1"
FT                   /translation="MDAKMGYIFKVMRWIFCFVACGITFGCTNSGFQNANSRPCILSMN
FT                   RMIHDCVERVVGNRLATAVLIKGSLDPHAYEMVKGDKDKIAGSAVIFCNGLGLEHTLSL
FT                   RKHLENNPNSVKLGERLIARGAFVPLEEDGICDPHIWMDLSIWKEAVIEITEVLIEKFP
FT                   EWSAEFKANSEELVCEMSILDSWAKQCLSTIPENLRYLVSGHNAFSYFTRRYLATPEEV
FT                   ASGAWRSRCISPEGLSPEAQISVRDIMAVVDYINEHDVSVVFPEDTLNQDALKKIVSSL
FT                   KKSHLVRLAQKPLYSDNVDDNYFSTFKHNVCLITEELGGVALECQR"
FT   gene            393181..393687
FT                   /locus_tag="CPn_0350"
FT   CDS_pept        393181..393687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0350"
FT                   /product="CT066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X8N0"
FT                   /protein_id="AAD18494.1"
FT                   /translation="MAVEQSHIKEEIEKLIGKAIKRVCGNKENDLCRYLPGPSGGYMHH
FT                   FTLKKMKSAAPEQLLKMLKTFILESETPRTINPKPRAPRGSKKRRDFINFTKTDIERVL
FT                   ELARQVGDKDLLARFSPKKPLTSLKRELIRSIRNGIVSVELWNAYVEAVKAVSSPNLEV
FT                   TSPFV"
FT   gene            393888..395435
FT                   /gene="adt_1"
FT                   /locus_tag="CPn_0351"
FT   CDS_pept        393888..395435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adt_1"
FT                   /locus_tag="CPn_0351"
FT                   /product="ADP/ATP Translocase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18495"
FT                   /db_xref="GOA:Q9Z8J2"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J2"
FT                   /protein_id="AAD18495.1"
FT                   /translation="MTKTEEKPFGKLRSFLWPIHTHELKKVLPMFLMFFCITFNYTVLR
FT                   DTKDTLIVGAPGSGAEAIPFIKFWLVVPCAIIFMLIYAKLSNILSKQALFYAVGTPFLI
FT                   FFALFPTVIYPLRDVLHPTEFADRLQAILPPGLLGLVAILRNWTFAAFYVLAELWGSVM
FT                   LSLMFWGFANEITKIHEAKRFYALFGIGANISLLASGRAIVWASKLRASVSEGVDPWGI
FT                   SLRLLMAMTIVSGLVLMASYWWINKNVLTDPRFYNPEEMQKGKKGAKPKMNMKDSFLYL
FT                   ARSPYILLLALLVIAYGICINLIEVTWKSQLKLQYPNMNDYSEFMGNFSFWTGVVSVLI
FT                   MLFVGGNVIRKFGWLTGALVTPVMVLLTGIVFFALVIFRNQASGLVAMFGTTPLMLAVV
FT                   VGAIQNILSKSTKYALFDSTKEMAYIPLDQEQKVKGKAAIDVVAARFGKSGGALIQQGL
FT                   LVICGSIGAMTPYLAVILLFIIAIWLVSATKLNKLFLAQSALKEQEVAQEDSAPASS"
FT   gene            395574..396833
FT                   /locus_tag="CPn_0352"
FT   CDS_pept        395574..396833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18496"
FT                   /db_xref="GOA:A0A0F7WI43"
FT                   /db_xref="InterPro:IPR010792"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WI43"
FT                   /protein_id="AAD18496.1"
FT                   /translation="MKCSPLTLVPHIFLKNDCECHRSCSLKIRTIARLILGLVLALVSA
FT                   LSFVFLAAPISYAIGGTLALAAIVILIITLVVALLAKSKVLPIPNELQKIIYNRYPKEV
FT                   FYFVKTHSLTVNELKIFINCWKSGTDLPPNLHKKAEAFGIDILKSIDLTLFPEFEEILL
FT                   QNCPLYWLSHFIDKTESVAGEIGLNKTQKVYGLLGPLAFHKGYTTIFHSYTRPLLTLIS
FT                   ESQYKFLYSKASKNQWDSPSVKKTCEEIFKELPHNMIFRKDVQGISQFLFLFFSHGITW
FT                   EQAQMIQLINPDNWKMLCQFDKAGGHCSMATFGGFLNTETNMFDPVSSNYEPTVNFMTW
FT                   KELKVLLEKVKESPMHPASALVQKICVNTTHHQNLLKRWQFVRNTSSQWTSSLPQYAFH
FT                   AQTYKLEKKIESSLPIRSSL"
FT   gene            396893..397138
FT                   /locus_tag="CPn_0353"
FT   CDS_pept        396893..397138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18497"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8J0"
FT                   /protein_id="AAD18497.1"
FT                   /translation="MRFRNIKKSLIFIKRIRYSQSGKEQKGARPFFKKSITSSLVILLL
FT                   EAIFNENFSSIIQNNFNKNFKNKNISINRIFVKFTI"
FT   gene            397167..398510
FT                   /locus_tag="CPn_0354"
FT   CDS_pept        397167..398510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18498"
FT                   /db_xref="GOA:A0A0F7WDZ9"
FT                   /db_xref="InterPro:IPR010792"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WDZ9"
FT                   /protein_id="AAD18498.1"
FT                   /translation="MSNITSPVIQNNRSCNYYFELKNSTTIHIVISAILLCGALIAFLC
FT                   VAAPVSYILSGALLGLGLLIALIGVILGIKKITPMISSKEQVFPQELVNRIRAHYPKFV
FT                   SDFVSEAKPNLKDLISFIDLLNQLHSEVGSSTNYNVSEELQQKIDTFEGIARLKNEVRT
FT                   ASLKRLESAASSRPLFPSLPKILQKVFPFFWLGEFISAGSKVVELHRVKKIGGSLEEDL
FT                   SDYIKPEMLPTYWLIPLDFRPTNSSILNLHTLVLARVLTRDVFQHLKYAALNGEWNLNH
FT                   SDLNTMKQQLFAKYHAAYQSYKHLSQPSLQEDEFYNLLLCIFKHRYSWKQMSLIKTVPA
FT                   DLWENLCCLTLDHTGRPQDMEFASLIGTLYTQGLIHKESEAFLSSLTLLSLDQFKTIRR
FT                   QSTNIAMFLENLATHNSTFRSLPPITVHPLKRSVFSQPEEDESSLLIG"
FT   gene            complement(398588..399889)
FT                   /locus_tag="CPn_0355"
FT   CDS_pept        complement(398588..399889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18499"
FT                   /db_xref="GOA:A0A0F7WNQ2"
FT                   /db_xref="InterPro:IPR010792"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WNQ2"
FT                   /protein_id="AAD18499.1"
FT                   /translation="MSMTIVPHALFKNHCECHSTFPLSSRTIVRIAIASLFCIGALAAL
FT                   GCLAPPVSYIVGSVLAFIAFVILSLVILALIFGEKKLPPTPRIIPDRFTHVIDEAYGLS
FT                   ISAFVREQQVTLAEFRQFSTALLCNISPEEKIKQLPSELRSKVESFGISRLAGDLEKNN
FT                   WPIFEDLLSQTCPLYWLQKFISAGDPQVCRDLGVPRECYGYYWLGPLGYSTAKATIFCK
FT                   ETHHILQQLTKEDVLLLKNKALQEKWDTDEVKAIVERIYTTYTARGTLKTEAGGLTKET
FT                   ISKELLLLSLHGYSFDQLQLITQLPRDAWDWLCFVDNSTAYNLQLCALVGALSSQNLLD
FT                   ESSIDFDVNLGLYVIQDLKEAVQAFSASDEPKKELGKFLLRHLSSVSKRLESVLRQGLH
FT                   RIALEHGNARARVYDVNFVTGARIHRKTSIFFKD"
FT   gene            complement(400106..400459)
FT                   /locus_tag="CPn_0356"
FT   CDS_pept        complement(400106..400459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18500"
FT                   /db_xref="InterPro:IPR010792"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8I7"
FT                   /protein_id="AAD18500.1"
FT                   /translation="MQLFQYMNESGWDWLCDFDSQGEGFQLSRLVGLLHSSWALYEAKE
FT                   QFYLPEVSLLTWEELIEMQLLSKPTKHGVAKDLCNVFEKHFQRFRQYLGSLDLNQRFEN
FT                   TFLNYPKYHLDRE"
FT   gene            complement(400466..401317)
FT                   /locus_tag="CPn_0357"
FT   CDS_pept        complement(400466..401317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18501"
FT                   /db_xref="GOA:Q9Z8I6"
FT                   /db_xref="InterPro:IPR010792"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8I6"
FT                   /protein_id="AAD18501.1"
FT                   /translation="MVNIQPVYRNTQVNYSQATQFSVCQPALSLIIVSVVAAVLAIVAL
FT                   VCSQSLLSIELGTALVLVSLILFASAMFMIYKMRQEPKELLIPKKIMELIQEHYPSIVV
FT                   DFIRDQEVSIYEIHHLISILNKTNVFDKAPVYLQEKLLQFGIEKFKDVHPSKLPNFEEI
FT                   LLQHCPLHWLGRLVYPMVSDVTPGTYGYYWCGPLGLYENAPSLFERRSLLLLKKISFGE
FT                   FALLEDGLKKNTWSSSELVQIRQNLFTRYYADKEEVDEAELNADYEQFDSLLHLIFSHK
FT                   LS"
FT   gene            complement(401575..401751)
FT                   /locus_tag="CPn_0358"
FT   CDS_pept        complement(401575..401751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18502"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8I5"
FT                   /protein_id="AAD18502.1"
FT                   /translation="MLSVSMKLIPTQDSIERETDSKRDKKIFTIYICSSKVLAGHFFSH
FT                   LDKHNKIHESIGV"
FT   gene            402012..403820
FT                   /gene="lepA"
FT                   /locus_tag="CPn_0359"
FT   CDS_pept        402012..403820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="CPn_0359"
FT                   /product="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18503"
FT                   /db_xref="GOA:Q9Z8I4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8I4"
FT                   /protein_id="AAD18503.1"
FT                   /translation="MKEYKIENIRNFSIIAHIDHGKSTIADRLLESTSTVEEREMREQL
FT                   LDSMDLERERGITIKAHPVTMTYLYEGEVYQLNLIDTPGHVDFSYEVSRSLSACEGALL
FT                   IVDAAQGVQAQSLANVYLALERDLEIIPVLNKIDLPAADPVRIAQQIEDYIGLDTTNII
FT                   ACSAKTGQGIPAILKAIIDLVPPPKAPAETELKALVFDSHYDPYVGIMVYVRIISGELK
FT                   KGDRITFMAAKGSSFEVLGIGAFLPKATFIEGSLRPGQVGFFIANLKKVKDVKIGDTVT
FT                   KTKHPAKTPLEGFKEINPVVFAGIYPIDSSDFDTLKDALGRLQLNDSALTIEQESSHSL
FT                   GFGFRCGFLGLLHLEIIFERIIREFDLDIIATAPSVIYKVVLKNGKVLDIDNPSGYPDP
FT                   AIIEHVEEPWVHVNIITPQEYLSNIMNLCLDKRGICVKTEMLDQHRLVLAYELPLNEIV
FT                   SDFNDKLKSVTKGYGSFDYRLGDYRKGSIIKLEVLINEEPIDAFSCLVHRDKAESRGRS
FT                   ICEKLVDVIPQQLFKIPIQAAINKKVIARETIRALSKNVTAKCYGGDITRKRKLWEKQK
FT                   KGKKRMKEFGKVSIPNTAFIEVLKLD"
FT   gene            complement(403919..405358)
FT                   /gene="gnd"
FT                   /locus_tag="CPn_0360"
FT   CDS_pept        complement(403919..405358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="CPn_0360"
FT                   /product="6-Phosphogluconate Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18504"
FT                   /db_xref="GOA:Q9Z8I3"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8I3"
FT                   /protein_id="AAD18504.1"
FT                   /translation="MQTNIGLIGLAVMGKNLVLNMIDHGFSVSVYNRTPEKTRDFLKEY
FT                   PNHRELVGFESLEDFVNSLERPRKIMLMIQAGKPVDQSIHALLPFLEPGDVIIDGGNSY
FT                   FKDSERRCKELQEKGILFLGVGISGGEEGARHGPSIMPGGNPEAWPLVAPIFQSIAAKV
FT                   QGRPCCSWVGTGGAGHYVKAVHNGIEYGDIQLICEAYGILRDFLKLSATAVATILKEWN
FT                   TLELESYLIRIASEVLALKDPEGIPVIDTILDVVGQKGTGKWTAIDALNSGVPLSLIIG
FT                   AVLARFLSSWKEIREQAARNYPGTPLIFEMPHDPSVFIQDVFHALYASKIISYAQGFML
FT                   LGEASKEYNWGLDLGEIALMWRGGCIIQSAFLDVIHKGFAANPENTSLIFQEYFRGALR
FT                   HAEMGWRRTVVTAIGAGLPIPCLAAAITFYDGYRTASSSMSLAQGLRDYFGAHTYERND
FT                   RPRGEFYHTDWVHTKTTERVK"
FT   gene            complement(405379..406647)
FT                   /gene="tyrS"
FT                   /locus_tag="CPn_0361"
FT   CDS_pept        complement(405379..406647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="CPn_0361"
FT                   /product="tyrosyl tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18505"
FT                   /db_xref="GOA:Q9Z8I2"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8I2"
FT                   /protein_id="AAD18505.1"
FT                   /translation="MAILNYVRSLMQSWLQSLQERNILENFTAGLESVEGPIAAYLGFD
FT                   PTAPALHIGHWIGICFLKRLAALGITPIALVGGATGMVGDPSGKQSERSLLQTSEVFDN
FT                   SQKITACLQRYLPGVTLVNNADWLQEISLIDFLGDIGKHFRLGQMLVKDTIKQRVHSDE
FT                   GISYTEFSYLILQSYDFYHLFKNYGTILQCGGSDQWGNITSGIDFIRRKGLGQAYGLTY
FT                   PLLTNAQGKKIGKTESGTVWLDSDLTSPFELYQYLLRLPDDTIPKIARTLTLLSNEEIQ
FT                   DIDRRVQTDPVAVKEFVAQDILSAIHGDLGLEEALSVTRSMHPGNLSSLSEKDFHELFA
FT                   GGMGASLDKSEVLGKRWLDLFLVLGLCKSKGEIRRLIEQKGVYINNVPIANEHSVCEEQ
FT                   DICYGHYVLLAQGKKRKLVLYLN"
FT   gene            complement(407052..407825)
FT                   /gene="rpsD"
FT                   /locus_tag="CPn_0362"
FT   CDS_pept        complement(407052..407825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="CPn_0362"
FT                   /product="Sigma-28/WhiG Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18506"
FT                   /db_xref="GOA:Q9Z8I1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8I1"
FT                   /protein_id="AAD18506.1"
FT                   /translation="MKTQQTQNIIEVWNFYWETQEIEYRDSLIEFYLPLVKSVVHRLIS
FT                   GMPSHVKTEDLYASGVEGLVRAVERYNPERSRRFEGYAVFLIKAAIIDDLRKQDWVPRS
FT                   VHQKANKLSGAMDSLRQSLGKEPTDLELCEYLNISQQELSGWFVSARPALIVSLNEEWP
FT                   SQSDEGAGMALEERIPDERAETGYDVVDKQEFSLCLANAIQELEEKERKVMALYYYEEL
FT                   VLKEIGKVLGVSESRVSQIHSKALLKLRAALSAFR"
FT   gene            complement(407940..409688)
FT                   /gene="flhA"
FT                   /locus_tag="CPn_0363"
FT   CDS_pept        complement(407940..409688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="CPn_0363"
FT                   /product="Flagellar Secretion Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18507"
FT                   /db_xref="GOA:Q9Z8I0"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8I0"
FT                   /protein_id="AAD18507.1"
FT                   /translation="MSGKKDGVRGMIFVPLSILVLIFLPLPQILLDFGLCISFALSLLT
FT                   VCWVFTLNSSNSAKLFPPFFLYLCLLRLGLNLASTRWIVSSGTASSLIVSLGSFFSLGS
FT                   LWAATFACLLLFFVNFLMVSKGSERIAEVRSRFFLEALPAKQMALDSDLVSGRASYKAV
FT                   KKQKNALIEEGDFFSAMEGVFRFVKGDAIISCILLLVNVVSVTCLYYTSGYALEQMWFT
FT                   VLGDALVSQVPALLTSCAAATLISKIDKEESLLNYLFEYYKQLRQHFRVVSLLIFSLCC
FT                   IPSSPKFPIVLLASLLWLAYRKEEPASEDSCIERAFSYVEGACPKEQESQFYQVYRAAS
FT                   EEVFEDLGVRLPVLTSLRIEERPWLRVFGQNVYLDEMTPEAVLPFLRNIAHEALNAEVV
FT                   QKYLEESERVFGIAVEDIVPKKISLSSLVVLSRLLVRERVSLKLFPKILEAVAVYQNSG
FT                   DSLEILAEKVRKSLGYWIGRSLWDQKQTLEVITIDFHVEELINSSYSKSNPVMQENVIR
FT                   RVDSLLERSVFKDFRAIVTSCETRFEMKKMLDPHFPDLLVLSHDELPKEIPISFLGIVS
FT                   DEVLVP"
FT   gene            complement(409848..409922)
FT                   /locus_tag="CPn_t13"
FT   tRNA            complement(409848..409922)
FT                   /locus_tag="CPn_t13"
FT                   /product="tRNA-Pro"
FT   gene            409966..410241
FT                   /gene="fer4"
FT                   /locus_tag="CPn_0364"
FT   CDS_pept        409966..410241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fer4"
FT                   /locus_tag="CPn_0364"
FT                   /product="Ferredoxin IV"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18508"
FT                   /db_xref="GOA:Q9Z8H9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8H9"
FT                   /protein_id="AAD18508.1"
FT                   /translation="MAKLVITSDDEQQEFELEDNSEIAEPCESMGIPFACTEGVCGTCV
FT                   IEVLEGRENLSEFTEPEYDFLGEPEDSNERLACQCRIKGGCVKVTF"
FT   gene            410528..411547
FT                   /locus_tag="CPn_0365"
FT   CDS_pept        410528..411547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18509"
FT                   /db_xref="GOA:A0A0F7WYJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WYJ6"
FT                   /protein_id="AAD18509.1"
FT                   /translation="MATISPISLTVDHPLVDTKKKSCSNFDKIQSRILLITAIFAVLVT
FT                   IGTLLIGLLLNIPVIYFLTGISFIAVVLSNFILYKRATTLLKPRACGKHKEIKPKRVST
FT                   NLQYSSISIAINRSKENWEHQPKDLQNLPAPSALLTDNPYEIWKAKHSLFSLVSLLPGG
FT                   NPEHLLISASENLGKTLLIEETSQNAPISSYVDTTPSPKSLLNEAIQETRVEINTELPA
FT                   GDSGERLYWQPDFRGRVFLPQIPTTPEAIYQYYYALYVTYIQTAINTNTQIIQIPLYSL
FT                   REHLYSRELPPQSRMQQSLAMITAVKYMAELHPEYPLTIACVERSLAQLPQESIEDLS"
FT   gene            411976..412443
FT                   /locus_tag="CPn_0366"
FT   CDS_pept        411976..412443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18510"
FT                   /db_xref="GOA:Q9Z8H7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8H7"
FT                   /protein_id="AAD18510.1"
FT                   /translation="MGYLPVSATDVLFESPAAPLINSANTQNQKLIELKGKQQAESSPR
FT                   TITSVILEVLLVIGCCLIVLSLLAIRPALQFTLETGHPAAIAVLAVSGTILLVAVIILF
FT                   CFLAAVPFAAKKTYKYVKTVDDYASWHSHQQTPTLGTIFSGIVYAESQAQL"
FT   gene            413102..413839
FT                   /locus_tag="CPn_0367"
FT   CDS_pept        413102..413839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18511"
FT                   /db_xref="GOA:A0A0F7XD47"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XD47"
FT                   /protein_id="AAD18511.1"
FT                   /translation="MTKTTSIPDVHENQSHLSVDERLISESPVLTKKEVIAKIIKLTAL
FT                   ILALAIAVGTAVVAGVLGMPLMAIATGAALLAAVVLSCLLLRRREPSKPTEELLGPQKH
FT                   VPKDIAAQVQPSVPLDYQKLLRNEWTLVNTLSEINISWTLQDPNQRYYVWEHQGAPITL
FT                   VATTGDIAKPRLKTSGRVMIVNAANSNMQSGGAGTNAALSAATHPTCWNNTRTSGGKIN
FT                   TGKGLSVGECRSAPWINRDWTNK"
FT   gene            413790..414110
FT                   /locus_tag="CPn_0368"
FT   CDS_pept        413790..414110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18512"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8H5"
FT                   /protein_id="AAD18512.1"
FT                   /translation="MNAAQHPGSIETGRINDTNPGEAHFLAQLLGPKYEGELKAHPEKL
FT                   SNVIKKAYLNCFDEALNNQATVVQVPLISSSIYSPGGKLELEPVNQTKPNSSAYKLYHI
FT                   RT"
FT   gene            414351..415565
FT                   /locus_tag="CPn_0369"
FT   CDS_pept        414351..415565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0369"
FT                   /product="CT058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18513"
FT                   /db_xref="GOA:Q9Z8H4"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8H4"
FT                   /protein_id="AAD18513.1"
FT                   /translation="MTDSNPLPSYTDASLYRTPAKHSYPIRLPLNRTDRIEKILKIVTL
FT                   TLALACALGFSIAAGILAMPIFSAVVVITLAIAAVSLYSLLKKPKLYEILPQIEPESEQ
FT                   SSLSPSPQPPEQQDLPLQIDPLPDPESLPEVSLADLTTPPEELTAITVTPGYEALLEQN
FT                   WDLLPSLAAVDPSFTTETPQQPCFIWKLKDSKLIFISTSGDIAVPRIKTQGRVMIVNAA
FT                   NENISREGGGTNKALSLATSLQCWNASRLPRAHSRSGSQLQPGECRSAKWENSDHTSND
FT                   HVPGKAHFLAQLLGPEAAKCNNDPKQAFEVSKKAFHNLFQEAEIIGVDVIQLPLIGCNL
FT                   FAPSRLLNLGKTRAEWIEAIKLALITSLQDFGWEQDNQEEQKIIILTDKDQPPIIPPRF
FT                   DLTTP"
FT   gene            415800..416915
FT                   /locus_tag="CPn_0370"
FT   CDS_pept        415800..416915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0370"
FT                   /product="CT058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18514"
FT                   /db_xref="GOA:Q9Z8H3"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8H3"
FT                   /protein_id="AAD18514.1"
FT                   /translation="MSTTEPNLTNVNLTMLISSESMPTQLASHKLKGLDLVAFILIIGI
FT                   AVSSGTAAIILGIPLLFILTALAVLAFSILLYFLLREPKSPISVTHQPTPIIKDTDLPP
FT                   VPPLALTPVPTEAVLEEPPLPSPRTHQTLLQENWDRIPDLQANTDMPFIAADNQTGYAW
FT                   HLKNSNLTLISTLGPIEKPRYKTQGIVMIVNAATPNMANNVKGTSLALAKATSVRCWEN
FT                   SKKSPDPLRSKQPLQLGECRSAKWENLNGTTNAGKAGLPQFLGQLLGPKASDYNYNPND
FT                   AFTFCRQAYLNCLNEAKRRKTTVVQLPLLSSHFPGSPKDEETTSLRLQWIDGVKLALID
FT                   ALQTFGSEAENQNQPWVIILTTLARHPLITP"
FT   gene            417147..417506
FT                   /locus_tag="CPn_0371"
FT   CDS_pept        417147..417506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18515"
FT                   /db_xref="GOA:Q9Z8H2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8H2"
FT                   /protein_id="AAD18515.1"
FT                   /translation="MPVSSAPLPTSHRPSSGNLGLMEPNSKALKAKHQDKTTKTIKLLV
FT                   KILVAILVIEVLGIIAAFFIPGTPPICLIILGGLILTTVLCVLLLVIKLALVNKTEGTT
FT                   AEQQIKRKLSSKSIS"
FT   gene            417687..418004
FT                   /locus_tag="CPn_0372"
FT   CDS_pept        417687..418004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18516"
FT                   /db_xref="GOA:Q9Z8H1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8H1"
FT                   /protein_id="AAD18516.1"
FT                   /translation="MSSPVVTGTSSASPVEQTKLGEFLERLSGSGRCIKIAFAASTALL
FT                   LLNTFVSGIVAIAMIFVATSVGAYFTVIGPLFLLSLILLAIMLISMYKITHPSQNTPIS
FT                   N"
FT   gene            418380..420221
FT                   /gene="gcpE"
FT                   /locus_tag="CPn_0373"
FT   CDS_pept        418380..420221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcpE"
FT                   /locus_tag="CPn_0373"
FT                   /product="GcpE Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18517"
FT                   /db_xref="GOA:Q9Z8H0"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8H0"
FT                   /protein_id="AAD18517.1"
FT                   /translation="MTLITPAINSSRRKTHTVRIGNLYIGSDHSIKTQSMTTTLTTDID
FT                   STVEQIYALAEHNCDIVRVTVQGIKEAQACEKIKERLIALGLNIPLVADIHFFPQAAML
FT                   VADFADKVRINPGNYIDKRNMFKGTKIYTEASYAQSLLRLEEKFAPLVEKCKRLGKAMR
FT                   IGVNHGSLSERIMQKYGDTIEGMVASAIEYIAVCEKLNYRDVVFSMKSSNPKIMVTAYR
FT                   QLAKDLDARGWLYPLHLGVTEAGMGVDGIIKSAVGIGTLLAEGLGDTIRCSLTGCPTTE
FT                   IPVCDSLLRHTKIYLDLPEKKNPFSLQHSENFVSAAEKPAKTTLWGDVYGVFLKLYPHH
FT                   LTDFTPEELLEHLGVNPVTKEKAFTTPEGVVVPPELKDAPITDVLREHFLVFHHHQVPC
FT                   LYEHNEEIWDSPAVHQAPFVHFHASDPFIHTSRDFFEKQGHQGKPTKLVFSRDFDNKEE
FT                   AAISIATEFGALLLDGLGEAVVLDLPNLPLQDVLKIAFGTLQNAGVRLVKTEYISCPMC
FT                   GRTLFDLEEVTTRIRKRTQHLPGLKIAIMGCIVNGPGEMADADFGFVGSKTGMIDLYVK
FT                   HTCVKAHIPMEDAEEELIRLLQEHGVWKDPEETKLTV"
FT   gene            420218..420964
FT                   /locus_tag="CPn_0374"
FT   CDS_pept        420218..420964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0374"
FT                   /product="CT056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18518"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8G9"
FT                   /protein_id="AAD18518.1"
FT                   /translation="MTLSFHTHPLNYWTFEEFDGLPIRHGVFSKQKDAEGTVFAAKNPE
FT                   IASALQSPKYCDLHQRHGTSVRCVTPTSPTYQPADGLCTQSPLLSLHIRHSDCQAAIFY
FT                   DREHHAIANVHSGWRGLLGNIYAVTVGTMKKLFHTKPQDLFVAIGPSIGPDYAIYPDYA
FT                   TLFPRSFLPFMNPKNHFDLRAIARKQLTNLGISKDRIFISDLCTYTEHDAFFSSRYLAH
FT                   HPDPNLTGQHSKNRNNVTAVLLLPRD"
FT   gene            421121..421618
FT                   /locus_tag="CPn_0375"
FT   CDS_pept        421121..421618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18519"
FT                   /db_xref="GOA:Q9Z8G8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8G8"
FT                   /protein_id="AAD18519.1"
FT                   /translation="MKLGASTNHKVHEPVKPKKAQLAEIEANKTQATEGTLRSKSLALQ
FT                   IARAVLYILFAALMLAAGITFVTFLALGFPLIQAYSIAGIITLVGLAIGLVLLILSLLP
FT                   KEDEEADALSRNALLPLTIIVIEQQPITPKPEIPYSYLTKLALLTSLFLTLRRSSSQRK
FT                   TH"
FT   gene            421854..422297
FT                   /locus_tag="CPn_0376"
FT   CDS_pept        421854..422297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18520"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8G7"
FT                   /protein_id="AAD18520.1"
FT                   /translation="MKTKMNSRKKAGQWAIFNSPTPGVSSTLVLAWTPWGYYDKDVQDI
FT                   LERKDPMSSSLSEKDSKEFLKNLFVDLLENGFTSVHIHAEEAFTPLDHTGKPHFKRDNV
FT                   YLPGKLLGALNEAAVQANVSADTQFTLFLTQDECNPFHDKKRG"
FT   gene            complement(422344..423438)
FT                   /gene="sucB_1"
FT                   /locus_tag="CPn_0377"
FT   CDS_pept        complement(422344..423438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB_1"
FT                   /locus_tag="CPn_0377"
FT                   /product="Dihydrolipoamide Succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18521"
FT                   /db_xref="GOA:Q9Z8G6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8G6"
FT                   /protein_id="AAD18521.1"
FT                   /translation="MTTEVRIPNIAESISEVTVASLLVTEGALIQENQGLLEIESDKVN
FT                   QLIYAPVSGRIFWEVSEGDVVPVGGVVGKIEPAGEGEELGDSQSKETIEAEIICFPQSG
FT                   VRQSPPENKTFIPLRDQMDQGSQGLSAGDRGETRERMTSIRKTISRRLLSALHESAMLT
FT                   TFNEVYMTPLFHLRKEKQEEFLSRYGVKLGFMSFFVKAVLEALKAYPRVNAYIDGEEIV
FT                   YRHYYDISIAVGIDRGLVVPVIRDCDKLSNGEIEQKLADLALRAREGLLAIAELEGGGF
FT                   TITNGGVYGSLLSTPIINPPQVGILGMHKIEKRPVVLDNEIVIADMMYVALSYDHRLID
FT                   GKEAVGFLVKVKEGLENPASLLDL"
FT   gene            complement(423442..426168)
FT                   /gene="sucA"
FT                   /locus_tag="CPn_0378"
FT   CDS_pept        complement(423442..426168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="CPn_0378"
FT                   /product="Oxoglutarate Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18522"
FT                   /db_xref="GOA:Q9Z8G5"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8G5"
FT                   /protein_id="AAD18522.1"
FT                   /translation="MDSEFVGQVYSSDMDWIESMYQRFMNHETLDPSWKYFFEGYQLGQ
FT                   AASPSEASTKISGNETIAMLQEQKSQFLCTIYRYYGYLQSQISTLAPTTDSRFIQEKIA
FT                   KIDLDEQVPSAGLLPKAQVSVRELIEALKKCYCGSLTLETLTCTPELQEFVWNLMEKRQ
FT                   VERFAEQLLRSYKDLCKATFFEEFLQIKFTGQKRFSLEGGETLVPMLEHLVHYGSALGI
FT                   SNYVLGMAHRGRLNVLTNVLGKPYRYVFMEFEDDPAARGLESVGDVKYHKGYVLKSHQK
FT                   DRETTFVMLPNASHLESVDPIVEGVVAALQHQGHAGKEQSSLAILVHGDAAFSGQGVVY
FT                   ETLQLSRVPGYSTEGTLHIVVNNYIGFTAVPRESRSTPYCTDIAKMLGIPVFRVNSEDV
FT                   VACIEAIEYALQVRERFSCDVIIDLCCYRKYGHNESDDPSVTAPLLYDQIKRKKSIREL
FT                   FRQYLLEGQFADISEETLASIEKEIQESLNREFQVLKGTDPEPFPKKECHHCDRLNNGE
FT                   LILHDCDVSLDRETLFHMSSRLCGFPDNFHPHPKIKTLLEKRMKMAEGGVGYDWAMAEE
FT                   LAFASLLIEGYNLRLSGQDSIRGTFSQRHLVWSDTVTGDTYSPLYHLSAEQGSVEMYNS
FT                   PLSEYAILGFEYGYAQQALKTLVLWEAQFGDFANGAQIIFDQYISSGIQKWDLHSDIVL
FT                   LLPHGYEGQGPEHSSSRIERYLQLAANWNFQVVLPSTPVQYFRILREHAKRDLSLPLVI
FT                   FTPKLLLRYPQCVSSIEEFTEPGGFRAILEDADPNYDASILVLCSGKIYYDYAEMLPQD
FT                   RRKDFSCLRIESLYPLALEDLVSLIDKYSHLKHFVWLQEESKNMGAYDYMFMALQDILP
FT                   EKLLYIGRPRSSSTASGSAKLSRQELVTCMETLFSLR"
FT   gene            426322..426768
FT                   /locus_tag="CPn_0379"
FT   CDS_pept        426322..426768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0379"
FT                   /product="CT053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8G4"
FT                   /protein_id="AAD18523.1"
FT                   /translation="MKSERLKKLESELHDLTQWMQLGLVPKKEISRHQEEIRILEHKIY
FT                   EEKERLQLLKENGEIEEYVTPRRSPAKTVYPDGPSMSDIEFVEPTETEIDIDPGETVEL
FT                   ELTDEGREDGAVEVDYSHEDDEDPFSDRNRWRRGGIIDPDANEW"
FT   gene            426758..427879
FT                   /gene="hemN_1"
FT                   /locus_tag="CPn_0380"
FT   CDS_pept        426758..427879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN_1"
FT                   /locus_tag="CPn_0380"
FT                   /product="Coproporphyrinogen III Oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18524"
FT                   /db_xref="GOA:A0A0H2ULW5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULW5"
FT                   /protein_id="AAD18524.1"
FT                   /translation="MNGKAPLALYIHIPFCTKKCRYCSFYTIPYKSESVSLYCNAVIQE
FT                   GLRKLAPIQETHFIETVFFGGGTPSLVSPLDLKRILKELAPHAREITLEANPENLTVSY
FT                   LRQLQETPINRISVGVQTFDDSILQLLGRTHSSSAAITALQECQNHGFSNLSIDLIYGL
FT                   PTQSLEIFLSDLHQALTLPITHISLYNLTIDPHTSFYKHRKILVPTIAQEEILAEMSLL
FT                   AENLLLSQGFQRYELASYAKPDYPAKHNLYYWTDRPFLGLGVSASQYLHGERSKNYSHI
FT                   SHYLRAVRKNLPTQETSEILPKKERIKEALALRLRLLEGADLAEFPSTLISMLTQDVKL
FT                   QNLFSVHGQCLALNRQGRLFHDTIAEEIMGYSF"
FT   gene            complement(428034..429809)
FT                   /locus_tag="CPn_0381"
FT   CDS_pept        complement(428034..429809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0381"
FT                   /product="CT326 similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18525"
FT                   /db_xref="GOA:A0A0F7X8R8"
FT                   /db_xref="InterPro:IPR007787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X8R8"
FT                   /protein_id="AAD18525.1"
FT                   /translation="MTAPTESRSSPPTLLEETEPLSPNPIPADIQIPRITISPPSLDVS
FT                   TVASSAEDISVFIAGGPRSSSSASVASDVYELVCLCGGDEDPEPPDSEVRTLYVNGSWQ
FT                   THQEAVQELLYISEVRGEAVRLLYNDGSGMSPWPISPCRTLPTLDHPLCQALLTVWEQF
FT                   FSAPENQNREFLVIFYGDASPYIQQALTQSRHSPRIVVVGISPTVFIQGDFRVHNYRVS
FT                   GDFFSSLDCRGTRAENTTILPYSSGLEGVFLPSIRCPSFTWAVRFGEQCLVANRGEDVE
FT                   DRGGLSQDAERSQLPHSERDLAVVIDSTDPSSMSRLVEWLNQGSPSSDMEINPYPQRCP
FT                   DVALSALYAISRVSGLAQEWILASVHEGLDLQICYSLILMHTTFAVRYFFLLFTNYPQS
FT                   RERFRTARIVAQSLYLPSILVLVFDCGNVLRKLWMPQEILRAIFISASTISGSIVFVEC
FT                   TRWMGRGLRHRVQQFVQQRVIGSGLPVGTVRASYRDRAGFIIGFLQTVHGGLYLPVSIM
FT                   VLNQIAIQVPRILVRPNNTAVYDLHNKSAEENWSSGDVLAVGQTLNFILCAFVLFVNLW
FT                   FFVKSVLRHSRRRRR"
FT   gene            complement(430033..430749)
FT                   /gene="yabC_1"
FT                   /locus_tag="CPn_0382"
FT   CDS_pept        complement(430033..430749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC_1"
FT                   /locus_tag="CPn_0382"
FT                   /product="SAM-Dependent Methytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18526"
FT                   /db_xref="GOA:A0A0F7WRR5"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WRR5"
FT                   /protein_id="AAD18526.1"
FT                   /translation="MTLYLLPNTLGTRAVETLPSVIGELVHRLDGLIVESDRGGRAFLS
FT                   LWKIPEVHKFPLAILSKHARLPKAWDFYLEPIVKHGENWGLISDAGLPCIADPGASLVR
FT                   RARALGIPVQAFSGPCSITLALMLSGLPSQSFTFLGYLPQSPKERVKSIKKAATSKEVS
FT                   TSVCIETSYRNVYTFESLLDTLPSYAELCVASDLSGPSELVLTRQVQSWRTTEDLGSVK
FT                   QSITKVPTIFLFHIPN"
FT   gene            complement(430746..431693)
FT                   /locus_tag="CPn_0383"
FT   CDS_pept        complement(430746..431693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0383"
FT                   /product="CT047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18527"
FT                   /db_xref="GOA:Q9Z8G0"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8G0"
FT                   /protein_id="AAD18527.1"
FT                   /translation="MTLPMQKSLTSFDDFSQAYAEKVPAIALIGSALEDDKDALIELLV
FT                   SESFKELGGQGLMPATLMSWTETFALFQEHETLGIIHAEKFPLATKEFLSRYARNPQPH
FT                   LTILIFTTKQECFRELSKALPSALSLSLFGEWPADRQKRIIRLLLQRAERVGISCSQSL
FT                   ASLFLRALASTSLPDILSEFDKLLCSVGKKTSLDHSDIKELVVKKEKASLWKFRDSLLK
FT                   RDPVEGHQQLHFLLEDGEDPLGIITFLRTQCLYGLRSIEEGSKENKHRMFVLYGKERLH
FT                   QALNSLFYAETLIKNNVQDPIVAVETLVIRMVNL"
FT   gene            complement(431859..432377)
FT                   /gene="hctB"
FT                   /locus_tag="CPn_0384"
FT   CDS_pept        complement(431859..432377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hctB"
FT                   /locus_tag="CPn_0384"
FT                   /product="Histone-like Protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18528"
FT                   /db_xref="GOA:Q9Z8F9"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F9"
FT                   /protein_id="AAD18528.1"
FT                   /translation="MIGAQKKQSGKKTASRAVRKPAKKVAAKRTVKKATVRKTAVKKPA
FT                   VRKTAAKKTVAKKTTAKRTVRKTVAKKPAVKKVAAKRVVKKTVAKKTTAKRAVRKTVAK
FT                   KPVARKTTVAKGSPKKAAACALACHKNHKHTSSCKRVCSSTATRKHGSKSRVRTAHGWR
FT                   HQLIKMMSR"
FT   gene            complement(432519..434018)
FT                   /gene="pepA"
FT                   /locus_tag="CPn_0385"
FT   CDS_pept        complement(432519..434018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="CPn_0385"
FT                   /product="Leucyl Aminopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18529"
FT                   /db_xref="GOA:Q9Z8F8"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F8"
FT                   /protein_id="AAD18529.1"
FT                   /translation="MVLFHAQASGRNRVKADAIVLPFWHFKDAKNAASFEAEFEPSYLP
FT                   ALENFQGKTGEIELLYSSPKAKEKRIVLLGLGKNEELTSDVVFQTYATLTRVLRKAKCS
FT                   TVNIILPTISELRLSAEEFLVGLSSGILSLNYDYPRYNKVDRNLETPLSKVTVIGIVPK
FT                   MADAIFRKEAAIFEGVYLTRDLVNRNADEITPKKLAEVALNLGKEFPSIDTKVLGKDAI
FT                   AKEKMGLLLAVSKGSCVDPHFIVVRYQGRPKSKDHTVLIGKGVTFDSGGLDLKPGKSML
FT                   TMKEDMAGGATVLGILSALAVLELPINVTGIIPATENAIDGASYKMGDVYVGMSGLSVE
FT                   ICSTDAEGRLILADAITYALKYCKPTRIIDFATLTGAMVVSLGEEVAGFFSNNDVLAED
FT                   LLEASAETSEPLWRLPLVKKYDKTLHSDIADMKNLGSNRAGAITAALFLQRFLEESSVA
FT                   WAHLDIAGTAYHEKEEDRYPKYASGFGVRSILYYLENSLSK"
FT   gene            complement(434043..434525)
FT                   /gene="ssb"
FT                   /locus_tag="CPn_0386"
FT   CDS_pept        complement(434043..434525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="CPn_0386"
FT                   /product="SS DNA Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18530"
FT                   /db_xref="GOA:Q9Z8F7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F7"
FT                   /protein_id="AAD18530.1"
FT                   /translation="MMFGHFAGYLGADPEERMTSKGKRVITLRLGVKTRVGMKDETVWC
FT                   KCNIWHNRYDKMLPYLKKGSGVIVAGDISVESYMSKDGSPQSSLVISVDSLKFSPFGRN
FT                   EGSRSPSLEDNHQQVGYESVSVGFEGEALDAEAIKDKDMYAGYGQEQQYVCEDVPF"
FT   gene            complement(434696..435196)
FT                   /locus_tag="CPn_0387"
FT   CDS_pept        complement(434696..435196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0387"
FT                   /product="CT043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18531"
FT                   /db_xref="GOA:Q9Z8F6"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8F6"
FT                   /protein_id="AAD18531.1"
FT                   /translation="MSRQNAEENLKNFAKELKLPDVAFDQNNTCILFVDGEFSLHLTYE
FT                   EHSDRLYVYAPLLDGLPDNTQRKLALYEKLLEGSMLGGQMAGGGVGVATKEQLILMHCV
FT                   LDMKYAETNLLKAFAQLFIETVVKWRTVCADICAGREPSVDTMPQMPQGGGGMQPPPTG
FT                   IRA"
FT   gene            435329..437323
FT                   /gene="glgX"
FT                   /locus_tag="CPn_0388"
FT   CDS_pept        435329..437323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="CPn_0388"
FT                   /product="Glycogen Hydrolase (debranching)"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18532"
FT                   /db_xref="GOA:Q9Z8F5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8F5"
FT                   /protein_id="AAD18532.1"
FT                   /translation="MEKVSSYPSVPLPLGASKISPNRYRFALYASQATEVILALTDENS
FT                   EVIEVPLYPDTHRTGAIWHIEIEGISDQSSYAFRVHGPKKHGMQYSFKEYLADPYAKNI
FT                   HSPQSFGSRKKQGDYAFCYLKEEPFPWDGDQPLHLPKEEMIIYEMHVRSFTQSSSSRVH
FT                   APGTFLGIIEKIDHLHKLGINAVELLPIFEFDETAHPFRNSKFPYLCNYWGYAPLNFFS
FT                   PCRRYAYASDPCAPSREFKTLVKTLHQEGIEVILDVVFNHTGLQGTTCSLPWIDTPSYY
FT                   ILDAQGHFTNYSGCGNTLNTNRAPTTQWILDILRYWVEEMHVDGFRFDLASVFSRGPSG
FT                   SPLQFAPVLEAISFDPLLASTKIIAEPWDAGGLYQVGYFPTLSPRWSEWNGPYRDNVKA
FT                   FLNGDQNLIGTFASRISGSQDIYPHGSPTNSINYVSCHDGFTLCDTVTYNHKHNEANGE
FT                   DNRDGTDANYSYNFGTEGKTEDPGILEVRERQLRNFFLTLMVSQGIPMIQSGDEYAHTA
FT                   EGNNNRWALDSNANYFLWDQLTAKPTLMHFLCDLIAFRKKYKTLFNRGFLSNKEISWVD
FT                   AMGNPMTWRPGNFLAFKIKSPKAHVYVAFHVGAQDQLATLPKASSNFLPYQIVAESQQG
FT                   FVPQNVATPTVSLQPHTTLIAISHAKEVT"
FT   gene            complement(437316..438134)
FT                   /locus_tag="CPn_0389"
FT   CDS_pept        complement(437316..438134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0389"
FT                   /product="CT041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18541"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F4"
FT                   /protein_id="AAD18541.1"
FT                   /translation="MKLLKNVLLGLFFSMSISGFSEVKVSDTFVKQDTVVEPKIRVLLS
FT                   NESTTALIEAKGPYRIYGDNVLLDTAIQGQRCVVHALYEGIRWGEFYPGLQCLKIEPVD
FT                   DTASLFFNGIQYQGSLYVHRKDNHCIMVSNEVTIEDYLKSVLSIKYLEELDKEALSACI
FT                   ILERTALYEKLLARNPQNFWHVKAEEEGYAGFGVTKQFYGVEEAIDWTARLVVDSPQGL
FT                   IIDAQGLLQSNVDRLAIEGFNARQILEKFYKDVDFVVIESWNEELDGEIR"
FT   gene            complement(438131..439144)
FT                   /gene="ruvB"
FT                   /locus_tag="CPn_0390"
FT   CDS_pept        complement(438131..439144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="CPn_0390"
FT                   /product="Holliday Junction Helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18533"
FT                   /db_xref="GOA:Q9Z8F3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F3"
FT                   /protein_id="AAD18533.1"
FT                   /translation="MTHQVAVLHQDKKFDVSLRPKGLEEFYGQHHLKERLDLFLCAALQ
FT                   RGEVPGHCLFFGPPGLGKTSLAHIVAYTVGKGLVLASGPQLIKPSDLLGLLTSLQEGDV
FT                   FFIDEIHRMGKVAEEYLYSAMEDFKVDITIDSGPGARSVRVDLAPFTLVGATTRSGMLS
FT                   EPLRARFAFSARLSYYSDQDLKEILVRSSHLLGIEADSSALLEIAKRSRGTPRLANHLL
FT                   RWVRDFAQIREGNCINGDVAEKALAMLLIDDWGLNEIDIKLLTTIIDYYQGGPVGIKTL
FT                   SVAVGEDIKTLEDVYEPFLILKGFIKKTPRGRMVTQLAYDHLKRHAKNLLSLGEGQ"
FT   gene            complement(439507..439692)
FT                   /locus_tag="CPn_0391"
FT   CDS_pept        complement(439507..439692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18534"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8F2"
FT                   /protein_id="AAD18534.1"
FT                   /translation="MYKQEKPIPKATILSRNLEVMLDNPKGKRQTLFLGRTSGRSALYS
FT                   YSRRILVLLNAFMRGP"
FT   gene            439814..440386
FT                   /gene="dcd"
FT                   /locus_tag="CPn_0392"
FT   CDS_pept        439814..440386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="CPn_0392"
FT                   /product="dCTP Deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18535"
FT                   /db_xref="GOA:Q9Z8F1"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F1"
FT                   /protein_id="AAD18535.1"
FT                   /translation="MSIKEDKWIREMALNADMIHPFVNGQVNVNEETGEKLISYGLSSY
FT                   GYDLRLSREFKVFTNVYNSVVDPKCFTEDIFISITDDVCIVPPNSFALARSVEYFRIPR
FT                   NVLTMCIGKSTYARCGIIVNVTPFEPEWEGHVTIEISNTTPLPAKIYANEGIAQVLFFE
FT                   SSTTCEVSYADRKGKYQKQQGITVPCV"
FT   gene            440379..440726
FT                   /locus_tag="CPn_0393"
FT   CDS_pept        440379..440726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0393"
FT                   /product="CT038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18536"
FT                   /db_xref="GOA:Q9Z8F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8F0"
FT                   /protein_id="AAD18536.1"
FT                   /translation="MSKVSVRKKNWGFRLLEEVMIKSWWVIFSILIGGFVYDRAIQELR
FT                   TEELRLQSKVSSLCQDILSAQEKQRQLQLHLQHWQDSAAIEAALIQRLGLIPKGYKKLC
FT                   VSPKQQSENKD"
FT   gene            440736..441971
FT                   /gene="tlyC_1"
FT                   /locus_tag="CPn_0394"
FT   CDS_pept        440736..441971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyC_1"
FT                   /locus_tag="CPn_0394"
FT                   /product="Hemolysin-like protein"
FT                   /note="CBS Domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18537"
FT                   /db_xref="GOA:Q9Z8E9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8E9"
FT                   /protein_id="AAD18537.1"
FT                   /translation="MIPTMLMFFIICFTLCSGFISLSQIALFSLPTSLISHYKRSKSKK
FT                   QQRVATLLLHPHHLLITLIFCDIGLNIAIQNCFAILFGDAASWWFTVGLPLAITLILGE
FT                   ILPKAVALPFNTQIASSVAPLILCVTKIFKPLLHWGIVGINYVVQWILSKQQIDIIQPQ
FT                   ELKEVLQSCKDFGVVNQEESRLLYGYLSLSDCSVKERMQPRQDILFYDIQTPLENLYLL
FT                   FSKQHCSRVPICNDNLQNLLGICTARSLLLHDKPLQSSDDLLPLLKKPYYMPETISAKM
FT                   ALCQMAAEDETLGMIIDEYGSIEGLITQEDLFEIVAGEIVDQRDNKILYTTSGADVIIA
FT                   SGTLELREFSEIFDINLPTNNNIATIGGWLIEQIGTIPTTGMKLSWNNLLFQVLDAAPN
FT                   RIRRVYIRKLYD"
FT   gene            441964..443178
FT                   /locus_tag="CPn_0395"
FT   CDS_pept        441964..443178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0395"
FT                   /product="CT257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18538"
FT                   /db_xref="GOA:Q9Z8E8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8E8"
FT                   /protein_id="AAD18538.1"
FT                   /translation="MTNSALFWIGVNIICIVLQGFYSMMEMACVSFNRVRLQYYLTKDH
FT                   KKARYINFLIRRPYRLFGTVMLGVNIALQVGSESSRNCYRALGITPDYAPFTQIFIVVI
FT                   FAELLPLTISRKIPEKLALWGAPILYYSHYIFYPLIQLIGSLTEGLYYLLNIRKEKLNS
FT                   TLSRDEFQKALETHHEEQDFNTIATNIFSLSATCADQVCQPLEQVTMLPSSANVKDFCR
FT                   TIKNTDINFIPVYHKARKNVIGIAHPKDFVNKALDEPLINNLHSPWFITAKSKLIRILK
FT                   EFRDNRSSVAVVLNASGEPIGILSLNAIFKILFNTTNIAHLKPKTISVIERTFPGNSRI
FT                   KDLQKELDIQFPQYPVETLAQLVLQLLDSPAEVGTSVIINNLLLEVKEMSLSGIKTVSI
FT                   KNLLS"
FT   gene            complement(443238..444353)
FT                   /gene="yhfO"
FT                   /locus_tag="CPn_0396"
FT   CDS_pept        complement(443238..444353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfO"
FT                   /locus_tag="CPn_0396"
FT                   /product="NifS-related aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18539"
FT                   /db_xref="GOA:Q9Z8E7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8E7"
FT                   /protein_id="AAD18539.1"
FT                   /translation="MIYLDNNAMTPPERGLLEFLQKTFLIEGTYANPSSVHQLGKKSRQ
FT                   LVLEASHWMQKVLSFQGRVLYTSGATESLNLAIASLPKDSHVITSGSEHPAILEPLKHS
FT                   SLSVSYLNPEEGRCVLTIEQIERAVTPKTSAIILGWVNSETGAKADIAAIAHFAQERQL
FT                   QFIVDATANVGKERIVLPSGVTMAAFSGHKFHALSGIGALLVSPGVKLHPQLWGGGQQG
FT                   GLRAGTENLWGIASLLYIFKYLDLHQERISQEILTHRNGFEKAIKARIPDVHIHCADQP
FT                   RANNVSAIAFPPLEGEVLQIALDIEGVACGYGSACSSGATAPFKSLVSMGVDEELTLAT
FT                   LRFSFSHLLLQEDVERAVGIIEKVVERLKNS"
FT   gene            complement(444378..445115)
FT                   /locus_tag="CPn_0397"
FT   CDS_pept        complement(444378..445115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0397"
FT                   /product="PP2C phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18540"
FT                   /db_xref="GOA:A0A0F7X5J0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X5J0"
FT                   /protein_id="AAD18540.1"
FT                   /translation="MDFDYFGLSDIGRVRARNEDFWQVNLMSQVVAIADGVGGRLGGDI
FT                   ASQEAVTSLMELIDEQQSKLMGYGDDQYKETLKKILLEVNGVVYEHGQMEEHLQGMGTT
FT                   LSFIQFRKDRAWLFHVGDSRIYRIREGELRRLTEDHSLENQLKNRYGLPKQSDKVYSYR
FT                   HILTNVLGSRPYVMPDIRNLPCEKEDLYCLCSDGLTNMVPDIDIRDILNQPATLEERGN
FT                   ALISLANTRGGDDNATVVLVRIQ"
FT   gene            445533..445703
FT                   /locus_tag="CPn_0398"
FT   CDS_pept        445533..445703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18542"
FT                   /db_xref="GOA:Q9Z8E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8E5"
FT                   /protein_id="AAD18542.1"
FT                   /translation="MQIENSSILFAEVVMKWFIFSVISAPVVFLPGCTLIPKEKVTKVP
FT                   SQLWSESLSQP"
FT   gene            445879..446526
FT                   /locus_tag="CPn_0399"
FT   CDS_pept        445879..446526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0399"
FT                   /product="CT253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18543"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8E4"
FT                   /protein_id="AAD18543.1"
FT                   /translation="MRKMLVLLASLGLLSPTLSSCTHLGSSGSYHPKLYTSGSKTKGVI
FT                   AMLPVFHRPGKSLEPLPWNLQGEFTEEISKRFYASEKVFLIKHNASPQTVSQFYAPIAN
FT                   RLPETIIEQFLPAEFIVATELLEQKTGKEAGVDSVTASVRVRVFDIRHHKIALIYQEII
FT                   ECSQPLTTLVNDYHRYGWNSKHFDSTPMGLMHSRLFREVVARVEGYVCANYS"
FT   gene            446536..447309
FT                   /locus_tag="CPn_0400"
FT   CDS_pept        446536..447309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0400"
FT                   /product="CT254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18544"
FT                   /db_xref="GOA:Q9Z8E3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8E3"
FT                   /protein_id="AAD18544.1"
FT                   /translation="MSKFILLLSLGVAALASKNFFIWPAPSGKTPLKLRQVLFGGALLV
FT                   FSSLVALSVSSQTAELLSTMTGISLAFAFLFYLLFLPKDITRAILFSGERPVKTSWRAL
FT                   GSAIRMWIIIIPVTQLIGIMMSKFLTLVLPTQEIHTQEVTQEVQNSLPITGHYISMILN
FT                   LGVLTPFGEEVFFRGILQTFLKNKMTRIAAVLCSSIIFSFIHIEHSLGSWVFVPVLFVF
FT                   SLSAGFLYEKDRHILSPIALHGLFNLTSLLFLGIK"
FT   gene            complement(447492..447884)
FT                   /locus_tag="CPn_0401"
FT   CDS_pept        complement(447492..447884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0401"
FT                   /product="CT255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18545"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8E2"
FT                   /protein_id="AAD18545.1"
FT                   /translation="MRDHAFSKLIGTVRAMVVEGRCPWSLQQSLVSMVEHILGECQEFH
FT                   EAVLQGKTVQEVGSEAGDVLTLVLILCFLLEREGVLASEDVANEAMEKLRRRAPYIFAE
FT                   DYKPVSIEEADRLWELAKHREKNEST"
FT   gene            complement(447885..448994)
FT                   /gene="mutY"
FT                   /locus_tag="CPn_0402"
FT   CDS_pept        complement(447885..448994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="CPn_0402"
FT                   /product="Adenine Glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18546"
FT                   /db_xref="GOA:Q9Z8E1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8E1"
FT                   /protein_id="AAD18546.1"
FT                   /translation="MTKIAFSEKAKNFPVEALKKWFEKNKRSLPWRDNPTPYSVWVSEV
FT                   MLQQTRAEVVIDYFNQWMERFPTIESLAAAKEEDVIKLWEGLGYYSRARHLLEGARMVM
FT                   EEFHGKIPDDAISLAQIRGVGPYTVHAILAFAFKRRAAAVDGNVLRVLSRIFLIETSID
FT                   LESTRTWVSRIAQALLPHKSPEVIAEALIELGACICKKVPQCHRCPVRQACGAWRENKQ
FT                   FVLPVRHARKKVIFLHRLVAIVLYDGSLVVEKRRPKEMMAGLYEFPYIEVEPEEGLQDI
FT                   EGFTKKMELSLESPLEFLGNLKEQRHAFTNHKVHLCPIIFKATSLPQFGELHLLSDIDH
FT                   LAFSSGHKKIKDALLIYLGDVRSRESIGV"
FT   gene            449015..449713
FT                   /gene="yceC"
FT                   /locus_tag="CPn_0403"
FT   CDS_pept        449015..449713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceC"
FT                   /locus_tag="CPn_0403"
FT                   /product="predicted pseudouridine synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18547"
FT                   /db_xref="GOA:A0A0F7WPJ6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WPJ6"
FT                   /protein_id="AAD18547.1"
FT                   /translation="MQLSNDKRAALQYFMENFSWLATQVSRLSSFLRSQLPNHSKQEIL
FT                   ASIRQHRCRVNGFIERFESYKVQPGDRVSLSLIPSTKQQPSILWEDDYSIIYEKPPHLT
FT                   TEQMAHMTRFFTVHRLDKGTSGCLLMGKSKQAATELMKLFKQRKIHKQYIAFVFGHPKK
FT                   KFGTVKSYTAPVYRRCGAVIFGAAGPSQGEPIKSAYKWDCWVILLSEMSTTDLKNSLPR
FT                   SSALSSMLTP"
FT   gene            complement(449868..450887)
FT                   /locus_tag="CPn_0404"
FT   CDS_pept        complement(449868..450887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18548"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D9"
FT                   /protein_id="AAD18548.1"
FT                   /translation="MSLLSGHRLEGFPPIAEVMAACDRCSMDFCEILKSQSMDLWADAA
FT                   SCVDGLLQDPFWSTAIASGIAKSSLQETEFECESKVMVLSSWGEQGAQVCSPFNLERIC
FT                   MSFPSLKVFSLKKNGCENMGIQLSASCMNLLMSIFFVATNGGSTPIWITKENLMALVAL
FT                   VLSHYQCYFVPATGDPQRGNILGNPEVNAILARGMGMRVDLERKRGGESSSSRYLELAA
FT                   RCFENSLTKTSLLSDANNVQERDKCLLQMSTSLMHTAGLNLQRPPVPTPSGVTAHPQPQ
FT                   PDPVVTSQPSLLGARERSPVSSRGRFPVVLPLSVISPRSHPGRVERRDLEDEEEEVMF"
FT   gene            complement(450963..451739)
FT                   /locus_tag="CPn_0405"
FT   CDS_pept        complement(450963..451739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0405"
FT                   /product="CT105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18549"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D8"
FT                   /protein_id="AAD18549.1"
FT                   /translation="MGFTDYLGGCLTNPLGKFPSPQNPQVVTIAPSSTTPQAVSSAVQG
FT                   FLQTGGAASSTATTTTASGASALGLSPDQVQALLTNLLNVGQPSVGQPSTSAGTSGASS
FT                   SSASMQQQLLQLILDKTTGSGGSSVSSEQLQQLLSLVSQMTTSQGGSGGTQAGQAASVL
FT                   LNLLSATGSAAANPLGTAASLAQIIYAAVTSPGAKKTSEFCYNYCGETCQGNCGCPTCG
FT                   CPDGQCGCGGFGRFFCGVWKNCCGIGEGSQEPAIPL"
FT   gene            451969..452868
FT                   /gene="fabI"
FT                   /locus_tag="CPn_0406"
FT   CDS_pept        451969..452868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="CPn_0406"
FT                   /product="Enoyl-Acyl-Carrier Protein Reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18550"
FT                   /db_xref="GOA:Q9Z8D7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D7"
FT                   /protein_id="AAD18550.1"
FT                   /translation="MLKIDLTGKVAFVAGIGDDQGYGWGIAKLLAEAGATIIVGTWVPI
FT                   YKIFSQSWELGKFNESRKLSNGTLLEIAKIYPMDASFDSPEDVPEDIAENKRYKGITGF
FT                   TISEVAEQVKKDFGHIDILVHSLANSPEISKSLLETSRKGYLAALSASSYSFVSLLSHF
FT                   GSIMNRGGSTISLTYLASMRAVPGYGGGMSSAKAALESDTKTLAWEAGRRWGIRVNTIS
FT                   AGPLASRAGKAIGFIERMVDYYQEWAPIPEAMNAEQVGAVAAFLASPLASAITGETLYV
FT                   DHGANVMGIGPEMFPKDS"
FT   gene            complement(452855..453742)
FT                   /locus_tag="CPn_0407"
FT   CDS_pept        complement(452855..453742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0407"
FT                   /product="HAD superfamily hydrolase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18551"
FT                   /db_xref="GOA:Q9Z8D6"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D6"
FT                   /protein_id="AAD18551.1"
FT                   /translation="MEKLLVTDIDGTITHQSHHLDKKVYERLYALHQAGWKLFFLTGRY
FT                   YKYAARLFSDFDAPYLLGCQNGASVWSSTSSNLLYSKSLPSDLLCILQDCMEGATALFS
FT                   VESGAPYGDHYYRFSPTPIAQDLHEYVDPRYFPNAKEREILFETRSLKDDYAFPSFAAA
FT                   KVFGLRDEVIRIQKELERQEALTSVATMTLMRWPFDFRYAILFLTDKSVSKGKALDRVV
FT                   NILYDGKKPFVMASGDDANDLDLIERGDFKIVMSSAPEEMHVHADFLAPPADKNGILSA
FT                   WEAGVRYYDDLMSL"
FT   gene            454105..454584
FT                   /locus_tag="CPn_0408"
FT   CDS_pept        454105..454584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0408"
FT                   /product="CT102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18552"
FT                   /db_xref="GOA:Q9Z8D5"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D5"
FT                   /protein_id="AAD18552.1"
FT                   /translation="MFFNLFSLVFKLSDELALAETIQEPISVHEMFPGSMKLEMFKMLG
FT                   SLILLLTIFGFGVWAFKKFVRSRSHGFGGSSQIKILERRSLTPKTSIYLIRVVNKTLVI
FT                   AETPEKITLLTEFPPDTDINHLLQENNKQSSSSATSDFLSKAIQKIQKKQQTNQD"
FT   gene            454645..455130
FT                   /locus_tag="CPn_0409"
FT   CDS_pept        454645..455130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0409"
FT                   /product="CT260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18553"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D4"
FT                   /protein_id="AAD18553.1"
FT                   /translation="MTTWTLNQNNLTKFLKSSDEEPFLERESGLTYINIQANGNELPLF
FT                   FVIRSEGEILQLICYLPYQLHESHKASTARLLHLLNRDIDIPGFGMDEEQGLIFYRLVL
FT                   PCLNGEIHDTLLRIYIDTIKLVCDSFSHAIGLISSGNMNLDELRRQALQEQQEKRNE"
FT   gene            455123..455836
FT                   /gene="dnaQ_1"
FT                   /locus_tag="CPn_0410"
FT   CDS_pept        455123..455836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ_1"
FT                   /locus_tag="CPn_0410"
FT                   /product="DNA Polymerase III Epsilon Chain"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18554"
FT                   /db_xref="GOA:Q9Z8D3"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D3"
FT                   /protein_id="AAD18554.1"
FT                   /translation="MSSQTMDVLIFYDTETTGTQIERDRIIEIAAYNSVTDESFLTYVN
FT                   PEIPIPDEASKIHGITTDAVLSAPKFPEAYEGFRKFCGEDSILVAHNNDGFDFPLLGKE
FT                   CRRHSLEPLTNRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVVILHKV
FT                   FTSLIGDLPPQQVLDLLQQSYHPKVFKMPFGKYKGQPLVDIPKSYFEWLENQGALDKPE
FT                   NKDIKAAIALLHQPT"
FT   gene            455833..456612
FT                   /locus_tag="CPn_0411"
FT   CDS_pept        455833..456612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0411"
FT                   /product="CT262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18555"
FT                   /db_xref="GOA:Q9Z8D2"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D2"
FT                   /protein_id="AAD18555.1"
FT                   /translation="MILTAAFSPCPNDIFLFRSFLKDPQFRPLLNQVTIADIETLNTLA
FT                   LQRRLSLMKMSAALFPLVSDYYNLMDVGNTLGYNSGPIVLSLDPECSLDTLATPGEMTT
FT                   AHALCKLYYPKAKLIPMPYDKILSAILQGKVDGGALIHEERFSYDLQLTLRADFGELWR
FT                   RKTIFPLPLGCLAIAKYVPMATVDALTAALRKSLICSLKDPITAGAKAVEYSKNKNVTV
FT                   IHRFIGTYINKETFQLSKTGKKALHMLWKANECCQYT"
FT   gene            456590..457249
FT                   /locus_tag="CPn_0412"
FT   CDS_pept        456590..457249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0412"
FT                   /product="CT263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18556"
FT                   /db_xref="GOA:Q9Z8D1"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8D1"
FT                   /protein_id="AAD18556.1"
FT                   /translation="MNAVNTPKKILCIVADYREISPLIEQLDFTQINEHLYSYRCTDYH
FT                   LDLYIVHVWGSTAVLNALQSYCQAYTDYDLWINPGFVGACSPEIPLGQCYTIEKIANLT
FT                   TDTPPVLSEDPPYIFDALPDSLPKSSLVTSPVLYHYGFHKTFKLLDMEGYAIASQAAEH
FT                   HIPCSFLKITSDYTVPGDCPFSRLEEVSQKLTQTLVELLPELMERAIPPKLLLPCP"
FT   gene            complement(457224..459203)
FT                   /gene="msbA"
FT                   /locus_tag="CPn_0413"
FT   CDS_pept        complement(457224..459203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="CPn_0413"
FT                   /product="Transport ATP Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18557"
FT                   /db_xref="GOA:A0A0F7X0I2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X0I2"
FT                   /protein_id="AAD18557.1"
FT                   /translation="MKLLLKAVLRHKNHLVILGCSLLAILGLTFSSQMEIFSLGMIAKT
FT                   GPDAFLLFGRKESGKLVKVSELSQKDILENWQAISKDSETLTVSDATTYIAEHGKSTAS
FT                   LTSKLSKFVRNYIDVSRFRGLAIFLICVAIFKAVTLFFQRFLGQVVAIRVSRDLRQDYF
FT                   KALQQLPMTFFHDHDIGNLSNRVMTDSASIALAVNSLMINYIQAPITFILTLGVCLSIS
FT                   WKFSILICVAFPIFILPIVVIARKIKNLAKRIQKSQDSFSSVLYDFLAGVMTVKVFRTE
FT                   KFAFTKYCEHNNKISALEEKSAAYGLLPRPLLHTIASLFFAFVVVIGIYKFAIPPEELI
FT                   VFCGLLYLIYDPIKKFGDENTSIMRGCAAAERFYEVLNHPDLHSQKEREIEFLGLSNTI
FT                   TFENVSFGYQEDKHILKNLSFTLHKGEALGIVGPTGSGKTTLVKLLPRLYEVSQGKILI
FT                   DSLPITEYNKGSLRNHIACVLQNPFLFYDTVWNNLTCGKDMEEEAVLEALKRAYADEFI
FT                   LKLPKGVHSVLEESGKNLSGGQQQRLAIARALLKNASILILDEATSALDAISENYIKNI
FT                   IGELKGQCTQIIIAHKLTTLEHVDRVLYIENGQKIAEGTKEELLQTCPEFLKMWELSGT
FT                   KEYNRVFVPDHKLVANPTDMAITT"
FT   gene            complement(459169..460143)
FT                   /gene="accA"
FT                   /locus_tag="CPn_0414"
FT   CDS_pept        complement(459169..460143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="CPn_0414"
FT                   /product="AcCoA Carboxylase/Transferase Alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18558"
FT                   /db_xref="GOA:Q9Z8C9"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C9"
FT                   /protein_id="AAD18558.1"
FT                   /translation="MELLPHEKQVVEYEKAIAEFKEKNKKNSLLSSSEIQKLEKRLDKL
FT                   KEKIYSDLTPWERVQICRHPSRPRTVNYIEGMCEEFVELCGDRTFRDDPAVVGGFVKIQ
FT                   GQRFVLIGQEKGCDTASRLHRNFGMLCPEGFRKALRLGKLAEKFGLPVVFLVDTPGAYP
FT                   GLTAEERGQGWAIAKNLFELSRLATPVIIVVIGEGCSGGALGMAVGDSVAMLEHSYYSV
FT                   ISPEGCASILWKDPKKNSEAASMLKMHGENLKQFGIIDTVIKEPIGGAHHDPALVYSNV
FT                   REFIIQEWLRLKDLAIEELLEKRYEKFRSIGLYETTSESGPEA"
FT   gene            complement(460218..461498)
FT                   /locus_tag="CPn_0415"
FT   CDS_pept        complement(460218..461498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0415"
FT                   /product="CT266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULN4"
FT                   /protein_id="AAD18559.1"
FT                   /translation="MTLIFVIIIVWCNAFLIKLCVIMGLQSRLQHCIEVSQNSNFDSQV
FT                   KQFIYACQDKTLRQSVLKIFRYHPLLKIHDIARAVYLLMALEEGEDLGLSFLNVQQYPS
FT                   GAVELFSCGGFPWKGLPYPAEHAEFGLLLLQIAEFYEESQAYVSKMSHFQQALFDHQGS
FT                   VFPSLWSQENSRLLKEKTTLSQSFLFQLGMQIHPEYSLEDPALGFWMQRTRSSSAFVAA
FT                   SGCQSSLGAYSSGDVGVIAYGPCSGDISDCYYFGCCGIAKEFVCQKSHQTTEISFLTST
FT                   GKPHPRNTGFSYLRDSYVHLPIRCKITISDKQYRVHAALAEATSAMTFSIFCKGKNCQV
FT                   VDGPRLRSCSLDSYKGPGNDIMILGENDAINIVSASPYMEIFALQGKEKFWNADFLINI
FT                   PYKEEGVMLIFEKKVTSEKGRFFTKMN"
FT   gene            complement(461554..461856)
FT                   /gene="himD"
FT                   /locus_tag="CPn_0416"
FT   CDS_pept        complement(461554..461856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="himD"
FT                   /locus_tag="CPn_0416"
FT                   /product="Integration Host Factor Alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18560"
FT                   /db_xref="GOA:Q9Z8C7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C7"
FT                   /protein_id="AAD18560.1"
FT                   /translation="MATMTKKKLISTISQDHKIHPNHVRTVIQNFLDKMTDALVKGDRL
FT                   EFRDFGVLQVVERKPKVGRNPKNAAVPIHIPARRAVKFTPGKRMKRLIETPNKHS"
FT   gene            462141..462214
FT                   /locus_tag="CPn_t14"
FT   tRNA            462141..462214
FT                   /locus_tag="CPn_t14"
FT                   /product="tRNA-Arg"
FT   gene            complement(462241..463035)
FT                   /gene="amiA"
FT                   /locus_tag="CPn_0417"
FT   CDS_pept        complement(462241..463035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiA"
FT                   /locus_tag="CPn_0417"
FT                   /product="N-Acetylmuramoyl Alanine Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18561"
FT                   /db_xref="GOA:Q9Z8C6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8C6"
FT                   /protein_id="AAD18561.1"
FT                   /translation="MKLTKYLNTKQLRSMISRLFVRYSLPMSKQLSFFALCVLGSHPIF
FT                   AQTPNPPQRVRRSEVIFIDPGHGGKDQGTASKELHYEEKSLTLSLALTVQSYLKRMGYK
FT                   PQLTRSSDVYVDLGKRVALSNRGQGDVFISIHCNHSSNAAAFGTEVYFYNGKVGSPTRN
FT                   RMSEVLGKNILAAMEKNGILKSRGLKTANFVVIRDTSMPAVLVETGFLSNSRERAALQD
FT                   ARYRMHVAKGIAEGVHNFLSGPSFQKPKQNIAKIRKPQIQAN"
FT   gene            complement(462950..464401)
FT                   /gene="murE"
FT                   /locus_tag="CPn_0418"
FT   CDS_pept        complement(462950..464401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="CPn_0418"
FT                   /product="N-Acetylmuramoylalanylglutamyl DAP Ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18562"
FT                   /db_xref="GOA:Q9Z8C5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C5"
FT                   /protein_id="AAD18562.1"
FT                   /translation="MDLKELLHGVQAKIYGKVRPLEVRNLTRDSRCVSVGDIFIAHKGQ
FT                   RYDGNDFAVDALANGAIAIASSLYNPFLSVVQIITPNLEELEAELSAKYYEYPSSKLHT
FT                   IGVTGTNGKTTVTCLIKALLDSYQKPSGLLGTIEHILGEGVIKDGFTTPTPALLQKYLA
FT                   TMVRQNRDAVVMEVSSIGLASGRVAYTNFDTAVLTNITLDHLDFHGTFETYVAAKAKLF
FT                   SLVPPSGMVVINTDSPYASQCIESAKAPVITYGIESAADYRATDIQLSSSGTKYTLVYG
FT                   DQKIACSSSFIGKYNVYNLLAAISTVHASLRCDLEDLLEKIGLCQPPPGRLDPVLMGPC
FT                   PVYIDYAHTPDALDNVLTGLHELLPEGGRLIVVFGCGGDRDRSKRKLMAQVVERYGFAV
FT                   VTSDNPRSEPPEDIVNEICDGFYSKNYFIEIDRKQAITYALSIASDRDIVLIAGKGHEA
FT                   YQIFKHQTVAFDDKQTVCEVLASYV"
FT   gene            complement(464873..466834)
FT                   /gene="pbp3"
FT                   /locus_tag="CPn_0419"
FT   CDS_pept        complement(464873..466834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp3"
FT                   /locus_tag="CPn_0419"
FT                   /product="transglycolase/transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18563"
FT                   /db_xref="GOA:Q9Z8C4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8C4"
FT                   /protein_id="AAD18563.1"
FT                   /translation="MSYRKRSTLIVLGVFALYALLVLRYYKIQICEGDHWAAEALGQHE
FT                   FCVRDPFRRGTFFANTTVRKGDKDLQQPFAVDITKFHLCADPLAIPECHRDEIIQGILQ
FT                   FIEGQTYDDLSLKLDKKSRYCKLYPLLDVSVHDRLSLWWKGYATKHRLPTNALFFITDY
FT                   QRSYPFGKLLGQVLHTLREIKDEKTGKAFPTGGMEAYFNHILEGDVGERKLLRSPLNRL
FT                   DTNRVIKLPKDGSDIYLTINPVIQTIAEEELERGVLEAKAQGGRLILMNSQTGEILALA
FT                   QYPFFDPTNYKEYFNNKERIEHTKVSFVSDVFEPGSIMKPLTVAIALQANEEASLKSQK
FT                   KIFDPEEPIDVTRTLFPGRKGSPLKDISRNSQLNMYMAIQKSSNVYVAQLADRIIQSLG
FT                   VAWYQQKLLALGFGRKTGIELPSEASGLVPSPHRFHINGSLEWSLSTPYSLAMGYNILA
FT                   TGIQMVQAYAILANGGYAVRPTLVKKIVSASGEEYHLPTKEKTRLFSEEITREVVRAMR
FT                   FTTLPGGSGFRASPKHHSSAGKTGTTEKMIHGKYDKRRHIASFIGFTPVESSEGNFPPL
FT                   VMLVSIDDPEYGLRADGTKNYMGGRCAAPIFSRVADRTLLYLGILPDKKLRNCDEEAAA
FT                   LKRLYEEWNRSPKQGGTR"
FT   gene            complement(466821..467108)
FT                   /locus_tag="CPn_0420"
FT   CDS_pept        complement(466821..467108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0420"
FT                   /product="CT271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18564"
FT                   /db_xref="GOA:Q9Z8C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8C3"
FT                   /protein_id="AAD18564.1"
FT                   /translation="MNKSRFLRLCCCLCFCGSLFYFYINKQNSLTKLRLEIPCLSVRLR
FT                   QLEQQNISLRFLIDKIERPDHLMEIAALPEYQYLEYPSEESISLLSYELP"
FT   gene            complement(467105..467998)
FT                   /gene="yabC_2"
FT                   /locus_tag="CPn_0421"
FT   CDS_pept        complement(467105..467998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC_2"
FT                   /locus_tag="CPn_0421"
FT                   /product="SAM-Dependent Methytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18565"
FT                   /db_xref="GOA:Q9Z8C2"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C2"
FT                   /protein_id="AAD18565.1"
FT                   /translation="MSERAHIPVLVEECLALFAQRPPQTFRDVTLGAGGHAYAFLEAYP
FT                   SLTCYDGSDRDLQALAIAEKRLETFQDRVSFSHASFEDLANQPTPRLYDGVLADLGVSS
FT                   MQLDTLSRGFSFQGEKEELDMRMDQTQELSASDVLNSLKEEELGRIFREYGEEPQWKSA
FT                   AKAVVHFRKHKKILSIQDVKEALLGVFPHYRFHRKIHPLTLIFQALRVYVNGEDRQLKS
FT                   LLTSAISWLAPQGRLVIISFCSSEDRPVKWFFKEAEASGLGKVITKKVIQPTYQEVRRN
FT                   PRSRSAKLRCFEKASQ"
FT   gene            468242..468787
FT                   /locus_tag="CPn_0422"
FT   CDS_pept        468242..468787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0422"
FT                   /product="CT273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18566"
FT                   /db_xref="InterPro:IPR035407"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C1"
FT                   /protein_id="AAD18566.1"
FT                   /translation="MVEIFNYSTSIYEQHASNNRIVSDFRKEIQMEGISIRDVAKHAQI
FT                   LDMNPKPSALTSLLQTNQKSHWACFSPPNNFYKQRFSTPYLAPSLGSPDQQDEDIEKIS
FT                   SFLKVLTRGKFSYRSQITPFLSYKDKEEEEDEDPEEDDDDPRVQQGKVLLKALDLGVKS
FT                   TNVMIDYVISRIFQFVQG"
FT   gene            468791..469219
FT                   /locus_tag="CPn_0423"
FT   CDS_pept        468791..469219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0423"
FT                   /product="CT274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18567"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8C0"
FT                   /protein_id="AAD18567.1"
FT                   /translation="MLDNEWKAILGWGDDELEELRISGYSFLRQGHYSKAILFFEALVI
FT                   LDPLSIYDHQTLGGLYLQIGENSQALAVLDQALRMQGDHLPTLLNKTKALFCLGRIEEA
FT                   TAIATYLSSCPIPAIANDAEALLMSYSKATKKNAALVR"
FT   gene            469612..470964
FT                   /gene="dnaA_2"
FT                   /locus_tag="CPn_0424"
FT   CDS_pept        469612..470964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA_2"
FT                   /locus_tag="CPn_0424"
FT                   /product="Replication Initiation Factor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18568"
FT                   /db_xref="GOA:Q9Z8B9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B9"
FT                   /protein_id="AAD18568.1"
FT                   /translation="MLTCNECTTWEQFLNYVKTRCSKTAFENWISPIQVLEETQEKIRL
FT                   EVPNIFVQNYLLDNYKRDLCSFVPLDVHGEPALEFVVAEHKKPSAPVASQKESNEGISE
FT                   VFEETKDFELKLNLSYRFDNFIEGPSNQFVKSAAVGIAGKPGRSYNPLFIHGGVGLGKT
FT                   HLLHAVGHYVREHHKNLRIHCITTEAFINDLVYHLKSKSVDKMKNFYRSLDLLLVDDIQ
FT                   FLQNRQNFEEEFCNTFETLINLSKQIVITSDKPPSQLKLSERIIARMEWGLVAHVGIPD
FT                   LETRVAILQHKAEQKGLLIPNEMAFYIADHIYGNVRQLEGAINKLTAYCRLFGKSLTET
FT                   TVRETLKELFRSPTKQKISVETILKSVATVFQVKLNDLKGNSRSKDLVLARQIAMYLAK
FT                   TLITDSLVAIGAAFGKTHSTVLYACKTIEHKLQNDETLKRQVNLCKNHIVG"
FT   gene            470980..471567
FT                   /locus_tag="CPn_0425"
FT   CDS_pept        470980..471567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0425"
FT                   /product="CT276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18569"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8B8"
FT                   /protein_id="AAD18569.1"
FT                   /translation="MFRRTGKGPFEDVQTLYEEETSSPSSYSPYSRSERPETPPSLFDN
FT                   PKASEARPLNHNLTEESSLPQWSSTPRTESLLPLEEPETTLGEGVTFKGELAFERLLRI
FT                   DGTFEGILVSKGKIIIGPKGVVKADIQLQEAIIEGVVEGNITVSGKVELRGGAIIKGDI
FT                   QANTLCVDEGVRILGYLAIAGITDHSERERDL"
FT   gene            complement(471533..472111)
FT                   /locus_tag="CPn_0426"
FT   CDS_pept        complement(471533..472111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0426"
FT                   /product="CT277 similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18570"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8B7"
FT                   /protein_id="AAD18570.1"
FT                   /translation="MVLFSLLFPKLCYGCQAPGAYFCSNCLEKLLVEDREGRCLHCFRY
FT                   LGSSETRLCSQCSPSSQLQAFSLYLPSQTALSVYARACEGKRPALQFFSKSIAFELASL
FT                   DETPSCIAYITSTISRKIVVEVAKLEKLLRIPLWPWLPKKRQIEKLPKGEGICFLSAYP
FT                   LSQKWMQTIVGGSASPLVSISLFLSQNDQ"
FT   gene            472207..473718
FT                   /gene="nqr2"
FT                   /locus_tag="CPn_0427"
FT   CDS_pept        472207..473718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqr2"
FT                   /locus_tag="CPn_0427"
FT                   /product="NADH (Ubiquinone) Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18571"
FT                   /db_xref="GOA:Q9Z8B6"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B6"
FT                   /protein_id="AAD18571.1"
FT                   /translation="MLKKFINSLWKLCQQDKYQRFTPIVDAIDTFCYEPIETPSKPPFI
FT                   RDSVDVKRWMMLVVIALFPATFVAIWNSGLQSIVYSSGNPVLMEQFLHISGFGSYLSFV
FT                   YKEIHIVPILWEGLKIFIPLLTISYVVGGTCEVLFAVVRGHKIAEGLLVTGILYPLTLP
FT                   PTIPYWMAALGIAFGIVVSKELFGGTGMNILNPALSGRAFLFFTFPAKMSGDVWVGSNP
FT                   GVIKDSLMKMNSSTGKVLIDGFSQSTCLQTLNSTPPSVKRLHVDAIAANMLHIPHVPTQ
FT                   DVIHSQFSLWTETHPGWVLDNLTLTQLQTFVTAPVAEGGLGLLPTQFDSAYAITDVIYG
FT                   IGKFSAGNLFWGNIIGSLGETSTFACLLGAIFLIVTGIASWRTMAAFGIGAFLTGWLFK
FT                   FISVLIVGQNGAWAPARFFIPAYRQLFLGGLAFGLVFMATDPVSSPTMKLGKWIYGFFI
FT                   GFMTIVIRLINPAYPEGVMLAILLGNVFAPLIDYFAVRKYRKRGV"
FT   gene            473722..474684
FT                   /gene="nqr3"
FT                   /locus_tag="CPn_0428"
FT   CDS_pept        473722..474684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqr3"
FT                   /locus_tag="CPn_0428"
FT                   /product="NADH (Ubiquinone) Oxidoreductase, Gamma"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18572"
FT                   /db_xref="GOA:Q9Z8B5"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B5"
FT                   /protein_id="AAD18572.1"
FT                   /translation="MSKGSSKHTVRINQTWYIVSFILGLSLFAGVLLSTIYYVLSPIQE
FT                   QAATFDRNKQMLLAAHILDFKGRFQIQEKKEWVPATFDKKTQLLEVATKKVSEVSYPEL
FT                   ELYAERFVRPLLTDAQGKVFSFEEKNLNPIEFFEKYQESPPCQQSPLPFYVILENTSRT
FT                   ENMSGADVAKDLSTVQALIFPISGFGLWGPIHGYLGVKNDGDTVLGTAWYQQGETPGLG
FT                   ANITNPEWQEQFYGKKIFLQDSSGTTNFATTDLGLEVVKGSVRTTLGDSPKALSAIDGI
FT                   SGATLTCNGVTEAYVQSLACYRQLLINFSNLTHEKKTGE"
FT   gene            474681..475322
FT                   /gene="nqr4"
FT                   /locus_tag="CPn_0429"
FT   CDS_pept        474681..475322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqr4"
FT                   /locus_tag="CPn_0429"
FT                   /product="NADH (Ubiquinone) Reductase 4"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18573"
FT                   /db_xref="GOA:Q9Z8B4"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B4"
FT                   /protein_id="AAD18573.1"
FT                   /translation="MTSKKSYKSYFFDPLWSNNQILIAILGICSALAVTTTVQTAITMG
FT                   IAVSIVTGCSSFFVSLLRKFTPDSVRMITQLIIISLFVIVIDQFLKAFFFDISKTLSVF
FT                   VGLIITNCIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIGVIRELFGFGTLMGF
FT                   RIIPQFVYASETHPDGYQNLSLMVLAPSAFFLLGIMIWLVNIRDSKKRKR"
FT   gene            475326..476096
FT                   /gene="nqr5"
FT                   /locus_tag="CPn_0430"
FT   CDS_pept        475326..476096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqr5"
FT                   /locus_tag="CPn_0430"
FT                   /product="NADH (Ubiquinone) Reductase 5"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18574"
FT                   /db_xref="GOA:Q9Z8B3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B3"
FT                   /protein_id="AAD18574.1"
FT                   /translation="MWLGAYTWLNVFGILLQAAFIQNILLANFLGMCSYLACSTRVSTA
FT                   NGLGMSVALVLTVTGSINWFVHAFITGPKALTWISPSLASVNLGFLELIIFIVVIAAFT
FT                   QILELLLEKVSRNLYLSLGIFLPLIAVNCAILGGVLFGITRSYPFIPMMIFSLGAGCGW
FT                   WLAIVILATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSAKIQRAP
FT                   LETEVVENTTNPLKESSSKHQPSISKARTQRRSL"
FT   gene            complement(476148..476483)
FT                   /locus_tag="CPn_0431"
FT   CDS_pept        complement(476148..476483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18575"
FT                   /db_xref="GOA:Q9Z8B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8B2"
FT                   /protein_id="AAD18575.1"
FT                   /translation="MTTLPKYVPRSRQNPDTLTFLKRYSSVLLHSENSLSYRIFAKVLA
FT                   ILLTSLAVAFAVTLFSCEGSQLRLCALYIGIALAICVLLTIVVYCIASKIATACKKPPS
FT                   ISRIEIV"
FT   gene            complement(476511..476816)
FT                   /locus_tag="CPn_0432"
FT   CDS_pept        complement(476511..476816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18576"
FT                   /db_xref="GOA:Q9Z8B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8B1"
FT                   /protein_id="AAD18576.1"
FT                   /translation="MDPASPVAPHVLQDHVQLSSEELSALSSGVSRVKKLTIAIMVLSL
FT                   IAISLVACGLFLTGSAPLQLSIWIAASCITLSMLVCACWRYKISNALEKTKVAHES"
FT   gene            complement(476926..477273)
FT                   /gene="gcsH"
FT                   /locus_tag="CPn_0433"
FT   CDS_pept        complement(476926..477273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsH"
FT                   /locus_tag="CPn_0433"
FT                   /product="Glycine Cleavage System H Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18577"
FT                   /db_xref="GOA:Q9Z8B0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017514"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B0"
FT                   /protein_id="AAD18577.1"
FT                   /translation="MWYSDYHVWILPVHERVVRLGLTEKMQKNLGAILHVDLPSVGSLC
FT                   KEGEVLVILESSKSAIEVLSPVSGEVIDINLDLVDNPQKINEAPEGEGWLAVVRLDQDW
FT                   DPSNLSLMDEE"
FT   gene            complement(477273..479462)
FT                   /locus_tag="CPn_0434"
FT   CDS_pept        complement(477273..479462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0434"
FT                   /product="CT283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18578"
FT                   /db_xref="GOA:Q9Z8A9"
FT                   /db_xref="InterPro:IPR017513"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8A9"
FT                   /protein_id="AAD18578.1"
FT                   /translation="MRIYQQDLFCRLCRDPAWFFSLLSFTLRFYCLGRGWTLLSFFYKH
FT                   QKKFIGIVIAVVCVSGIGVGWGRFSRKGSAESTSRRTVFTTASGKRYVEKDFMAMKKFF
FT                   AHEAYPFTGNPRAWNFINEGLLTDYFLTTRVGEKLFLKVYHPGEKIFSKEKAYQPYRRF
FT                   DAPFISSEEVWKSSAPQLLEILKVFQQIENPISKEGFLARAKLFLEERRFPHYVLRQML
FT                   EYRRQMFALPPDEALSRGKDLRLFGYQTIQDWFGDAYLSAAVELLIRFIDEQKKVLPRP
FT                   SKQEARDDFYDKAKHAYTKISKNKEFSLGFEEFVNSYFQFLEISESEFFNMYRDILLCK
FT                   RALLLLQGGVSFDFQPLTTFFVQGKDSIQVEFFRLPKEYSFKTKQELKAFEVYLKLVSL
FT                   PKSDSLDVPNEILPIATIKAKEPRLVGRRFSIDYKRVALQDLAATVPMVEVLHWQQNSE
FT                   HFQEILQQFPDVETCQSYKDFQHLKPALRDKISLFTRKEILRARPERILQSLQQVPKQS
FT                   QEVLLSAGKNSALPGISDGQQLAKVLLENEVLDLYSQDAETYYTIIVNSSFEKEEVLPY
FT                   REVLKRDLASQLLTSHGHLVDMERLESALRTRYPGEEGASLWQRRLWKVVENHRLGRHL
FT                   EGSFSWSLDRSLKTFSRGDKELPQEFDRIFSMKVGDYSSVFMSPNEGPCYYQCLSHLLY
FT                   DRPASVDKLFLAKSQLDEELLGSYMERFIEQGVVR"
FT   gene            complement(479472..480902)
FT                   /locus_tag="CPn_0435"
FT   CDS_pept        complement(479472..480902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0435"
FT                   /product="Phospholipase D superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18579"
FT                   /db_xref="GOA:Q9Z8A8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8A8"
FT                   /protein_id="AAD18579.1"
FT                   /translation="MMSRLRFRLAALGIFFILLVPNSVSAKTIVASDKEKVGVLVYDNS
FT                   VEAFQQILDCIDHANFYVELCPCMTGGRTLKEMVDHLEARMDLVPELCSYIIIQPTFTD
FT                   AEDQKLLKALKERHPNRFFYVFTGCPPSTSILAPNVIEMHIKLSIIDGKYCILGGTNFE
FT                   EFMCTPGDEVPEKVDNPRLFVSGVRRPLAFRDQDIMLRSTAFGLQLREEYHKQFAMWDY
FT                   YAHHMWFIDNPEQFAGACPPLTLEQAEETVFPGFDKHEDLVLVDSSKIRIVLGGPHDKQ
FT                   PNPVTQEYLKLIQGARSSVKLAHMYFIPKDELLNALVDVSHNHGVHLSLITNGCHELSP
FT                   AITGPYAWGNRINYFALLYGKRYPLWKKWFCEKLKPYERVSIYEFAIWETQLHKKCMII
FT                   DDEIFVIGSYNFGKKSDAFDYESIVVIESPEVAAKANKVFNKDIGLSIPVSHGDIFSWY
FT                   FHSVHHTLGHLQLTYMPA"
FT   gene            complement(480899..481618)
FT                   /gene="lplA_1"
FT                   /locus_tag="CPn_0436"
FT   CDS_pept        complement(480899..481618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA_1"
FT                   /locus_tag="CPn_0436"
FT                   /product="Lipoate Protein Ligase-Like Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18580"
FT                   /db_xref="GOA:Q9Z8A7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8A7"
FT                   /protein_id="AAD18580.1"
FT                   /translation="MKVRIVDSGKSSAASHMAKDRDLLESLQDGELILHLYEWENPCSL
FT                   TYGHFMRPEKFLLSNYADLGLDAAVRPTGGGFVFHKGDYAFSVLMSATHPSYSSSVLEN
FT                   YHTVNSFVAKVLEKVFRIQGMLAPEDENSSSRDSGNFCMAKTSKYDVLFGDKKIGGAAQ
FT                   RKVQQGFLHQGSLFLSGSSSEFYQRFLKPEVLEEIIEQIQIHAFFPLGLEAADEVLQEA
FT                   RQQVKEAFIKLFCGEGL"
FT   gene            481816..484353
FT                   /gene="clpC"
FT                   /locus_tag="CPn_0437"
FT   CDS_pept        481816..484353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="CPn_0437"
FT                   /product="ClpC Protease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18581"
FT                   /db_xref="GOA:Q9Z8A6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A6"
FT                   /protein_id="AAD18581.1"
FT                   /translation="MFEKFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVA
FT                   VNVLRNLGIDFDTARQEVERLIGYGPEIQVYGDPALTGRVKKSFESANEEASLLEHNYV
FT                   GTEHLLLGILHQSDSVALQVLENLHIDPREVRKEILRELETFNLQLPPSSSSSSSSSRS
FT                   NPSSSKSPLGHSLGSDKNEKLSALKAYGYDLTEMVRESKLDPVIGRSSEVERLILILCR
FT                   RRKNNPVLIGEAGVGKTAIVEGLAQKIILNEVPDALRKKRLITLDLALMIAGTKYRGQF
FT                   EERIKAVMDEVRKHGNILLFIDELHTIVGAGAAEGAIDASNILKPALARGEIQCIGATT
FT                   IDEYRKHIEKDAALERRFQKIVVHPPSVDETIEILRGLKKKYEEHHNVFITEEALKAAA
FT                   TLSDQYVHGRFLPDKAIDLLDEAGARVRVNTMGQPTDLMKLEAEIENTKLAKEQAIGTQ
FT                   EYEKAAGLRDEEKKLRERLQSMKQEWENHKEEHQVPVDEEAVAQVVSLQTGIPSARLTE
FT                   AESEKLLKLEDTLRRKVIGQNDAVTSICRAIRRSRTGIKDPNRPTGSFLFLGPTGVGKS
FT                   LLAQQIAIEMFGGEDALIQVDMSEYMEKFAATKMMGSPPGYVGHEEGGHLTEQVRRRPY
FT                   CVVLFDEIEKAHPDIMDLMLQILEQGRLTDSFGRKVDFRHAIIIMTSNLGADLIRKSGE
FT                   IGFGLKSHMDYKVIQEKIEHAMKKHLKPEFINRLDESVIFRPLEKESLSEIIHLEINKL
FT                   DSRLKNYQMALNIPDSVISFLVTKGHSPEMGARPLRRVIEQYLEDPLAELLLKESCRQE
FT                   ARKLRATLVENRVAFEREEEEQEAALPSPHLES"
FT   gene            complement(484331..485416)
FT                   /gene="ycbF"
FT                   /locus_tag="CPn_0438"
FT   CDS_pept        complement(484331..485416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbF"
FT                   /locus_tag="CPn_0438"
FT                   /product="PP-loop superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18582"
FT                   /db_xref="GOA:Q9Z8A5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A5"
FT                   /protein_id="AAD18582.1"
FT                   /translation="MQQTVIVAMSGGVDSSVVAYLFKKFTNYKVIGLFMKNWEEDSEGG
FT                   LCSSTKDYEDVERVCLQLDIPYYTVSFAKEYRERVFARFLKEYSLGYTPNPDILCNREI
FT                   KFDLLQKKVQELGGDYLATGHYCRLNTELQETQLLRGCDPQKDQSYFLSGTPKSALHNV
FT                   LFPLGEMNKTEVRAIAAQAALPTAEKKDSTGICFIGKRPFKEFLEKFLPNKTGNVIDWD
FT                   TKEIVGQHQGAHYYTIGQRRGLDLGGSEKPCYVVGKNIEENSIYIVRGEDHPQLYLREL
FT                   TARELNWFTPPKSGCHCSAKVRYRSPDEACTIDYSSGDEVKVRFSQPVKAVTPGQTIAF
FT                   YQGDTCLGSGVIDVPMIPSEG"
FT   gene            485553..486080
FT                   /locus_tag="CPn_0439"
FT   CDS_pept        485553..486080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18583"
FT                   /db_xref="GOA:Q9Z8A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z8A4"
FT                   /protein_id="AAD18583.1"
FT                   /translation="MSSTLNGVFPSSLPEESADLFITNKEIVALGEKGNVFLTHSIPMH
FT                   IAAITILVIVALAGIAIICLGCYSQSILLIAVGIVLTILTLLCLQALVGFIKFIRQLPQ
FT                   QLHTTVQFIREKIRPESSLQLVTNAQRKTTQDTLKLYEELCDLSQKEFKLQSTLYQKRF
FT                   ELSHKNEKTNQN"
FT   gene            486105..486743
FT                   /locus_tag="CPn_0440"
FT   CDS_pept        486105..486743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18584"
FT                   /db_xref="GOA:Q9Z8A3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A3"
FT                   /protein_id="AAD18584.1"
FT                   /translation="MATSVAPSPVPESSPLSHATEVLNLPNAYITQPHPIPAAPWETFR
FT                   SKLSTKHTLCFALTLLLTLGGTISAGYAGYTGNWIICGIGLGIIVLTLILALLLAIPLK
FT                   NKQTGTKLIDEISQDISSIGSGFVQRYGLMFSTIKSVHLPELTTQNQEKTRILNEIEAK
FT                   KESIQNLELKITECQNKLAQKQPKRKSSQKSFMRSIKHLSKNPVILFDC"
FT   gene            486891..487841
FT                   /locus_tag="CPn_0441"
FT   CDS_pept        486891..487841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0441"
FT                   /product="CT007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18585"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A2"
FT                   /protein_id="AAD18585.1"
FT                   /translation="MFKLLFHIAAFAGHVLSTPIFIVQDACGIDEEACKNPPPRPFSAQ
FT                   VQYLKVNDAKFKKLPHQTIGYRQYDGTFLCTLPITEHSGLLFSTGYIGADIQWKSSLPI
FT                   SETDPNGLGWATFQDTSFYNYVLLSLGAYTLSLKNWQWSIILSGLVDPKNIEMGYGLYQ
FT                   GVLSGKYQATEKLSAIFGVINETGLHQEKAWPLVGVSYKATDQLTLNCIYPVNFSIDYR
FT                   STSVCNLGLAYRLTRFRKKLHKNHLISSRGIFEYQGREIEANVKLTPWPGSFIKGFYGW
FT                   SIGNDISIADDHNNNKTSHTFKTSAFFGGSAVMNF"
FT   gene            488013..488531
FT                   /locus_tag="CPn_0442"
FT   CDS_pept        488013..488531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0442"
FT                   /product="CT006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18586"
FT                   /db_xref="GOA:Q9Z8A1"
FT                   /db_xref="InterPro:IPR035358"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A1"
FT                   /protein_id="AAD18586.1"
FT                   /translation="MGFKNICKQGSQLYLNGIFPERILARKLKNCAKSYPRTALTIEVL
FT                   VSSVLGALKVILIPCASTYAALTLPLRALFNAIKTKSCQHLASYAMAWLLHILTIAVII
FT                   GLVFSLVFIPPPVVFISLGLLMSVTTSVTLFQVHKNLFPPYEPPPSRPHTPPPFADEYV
FT                   PLISESYFD"
FT   gene            488729..489982
FT                   /locus_tag="CPn_0443"
FT   CDS_pept        488729..489982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0443"
FT                   /product="CT005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18587"
FT                   /db_xref="GOA:Q9Z8A0"
FT                   /db_xref="InterPro:IPR035355"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A0"
FT                   /protein_id="AAD18587.1"
FT                   /translation="MSQPPINPLGQPQVPAAASPSGQPSVVKRLKTSSTGLFKRFITIP
FT                   DKYPKMRYVYDTGIIALAAIAILSILLTASGNSLMLYALAPALALGALGVTLLISDILD
FT                   SPKAKKIGEAITAIVVPIIVLAIAAGLIAGAFVASSGTMLVFANPMFVMGLITVGLYFM
FT                   SLNKLTLDYFRREHLLRMEKKTQETAEPILVTPSADDAKKIAVEKKKDLSASARMEEHE
FT                   ASQRQDARHRRIGREAQGSFFYSSRNPEHRRSFGSLSRFKTKPSDAASTRPASISPPFK
FT                   DDFQPYHFKDLRSSSFGSGASSAFTPIMPASSRSPNFSTGTVLHPEPVYPKGGKEPSIP
FT                   RVSSSSRRSPRDRQDKQQQQQNQDEEQKQQSKKKSGKSNQSLKTPPPDGKSTANLSPSN
FT                   PFSDGYDEREKRKHRKNK"
FT   gene            490287..494510
FT                   /gene="pmp_6"
FT                   /locus_tag="CPn_0444"
FT   CDS_pept        490287..494510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_6"
FT                   /locus_tag="CPn_0444"
FT                   /product="Polymorphic Outer Membrane Protein G/I Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18588"
FT                   /db_xref="GOA:Q9Z899"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z899"
FT                   /protein_id="AAD18588.1"
FT                   /translation="MKYSLPWLLTSSALVFSLHPLMAANTDLSSSDNYENGSSGSAAFT
FT                   AKETSDASGTTYTLTSDVSITNVSAITPADKSCFTNTGGALSFVGADHSLVLQTIALTH
FT                   DGAAINNTNTALSFSGFSSLLIDSAPATGTSGGKGAICVTNTEGGTATFTDNASVTLQK
FT                   NTSEKDGAAVSAYSIDLAKTTTAALLDQNTSTKNGGALCSTANTTVQGNSGTVTFSSNT
FT                   ATDKGGGIYSKEKDSTLDANTGVVTFKSNTAKTGGAWSSDDNLALTGNTQVLFQENKTT
FT                   GSAAQANNPEGCGGAICCYLATATDKTGLAISQNQEMSFTSNTTTANGGAIYATKCTLD
FT                   GNTTLTFDQNTATAGCGGAIYTETEDFSLKGSTGTVTFSTNTAKTGGALYSKGNSSLTG
FT                   NTNLLFSGNKATGPSNSSANQEGCGGAILAFIDSGSVSDKTGLSIANNQEVSLTSNAAT
FT                   VSGGAIYATKCTLTGNGSLTFDGNTAGTSGGAIYTETEDFTLTGSTGTVTFSTNTAKTG
FT                   GALYSKGNNSLSGNTNLLFSGNKATGPSNSSANQEGCGGAILSFLESASVSTKKGLWIE
FT                   DNENVSLSGNTATVSGGAIYATKCALHGNTTLTFDGNTAETAGGAIYTETEDFTLTGST
FT                   GTVTFSTNTAKTAGALHTKGNTSFTKNKALVFSGNSATATATTTTDQEGCGGAILCNIS
FT                   ESDIATKSLTLTENESLSFINNTAKRSGGGIYAPKCVISGSESINFDGNTAETSGGAIY
FT                   SKNLSITANGPVSFTNNSGGKGGAIYIADSGELSLEAIDGDITFSGNRATEGTSTPNSI
FT                   HLGAGAKITKLAAAPGHTIYFYDPITMEAPASGGTIEELVINPVVKAIVPPPQPKNGPI
FT                   ASVPVVPVAPANPNTGTIVFSSGKLPSQDASIPANTTTILNQKINLAGGNVVLKEGATL
FT                   QVYSFTQQPDSTVFMDAGTTLETTTTNNTDGSIDLKNLSVNLDALDGKRMITIAVNSTS
FT                   GGLKISGDLKFHNNEGSFYDNPGLKANLNLPFLDLSSTSGTVNLDDFNPIPSSMAAPDY
FT                   GYQGSWTLVPKVGAGGKVTLVAEWQALGYTPKPELRATLVPNSLWNAYVNIHSIQQEIA
FT                   TAMSDAPSHPGIWIGGIGNAFHQDKQKENAGFRLISRGYIVGGSMTTPQEYTFAVAFSQ
FT                   LFGKSKDYVVSDIKSQVYAGSLCAQSSYVIPLHSSLRRHVLSKVLPELPGETPLVLHGQ
FT                   VSYGRNHHNMTTKLANNTQGKSDWDSHSFAVEVGGSLPVDLNYRYLTSYSPYVKLQVVS
FT                   VNQKGFQEVAADPRIFDASHLVNVSIPMGLTFKHESAKPPSALLLTLGYAVDAYRDHPH
FT                   CLTSLTNGTSWSTFATNLSRQAFFAEASGHLKLLHGLDCFASGSCELRSSSRSYNANCG
FT                   TRYSF"
FT   gene            494772..497582
FT                   /gene="pmp_7"
FT                   /locus_tag="CPn_0445"
FT   CDS_pept        494772..497582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_7"
FT                   /locus_tag="CPn_0445"
FT                   /product="Polymorphic Outer Membrane Protein G Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18589"
FT                   /db_xref="GOA:Q9Z898"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z898"
FT                   /protein_id="AAD18589.1"
FT                   /translation="MKSSVSWLFFSSIPLFSSLSIVAAEVTLDSSNNSYDGSNGTTFTV
FT                   FSTTDAAAGTTYSLLSDVSFQNAGALGIPLASGCFLEAGGDLTFQGNQHALKFAFINAG
FT                   SSAGTVASTSAADKNLLFNDFSRLSIISCPSLLLSPTGQCALKSVGNLSLTGNSQIIFT
FT                   QNFSSDNGGVINTKNFLLSGTSQFASFSRNQAFTGKQGGVVYATGTITIENSPGIVSFS
FT                   QNLAKGSGGALYSTDNCSITDNFQVIFDGNSAWEAAQAQGGAICCTTTDKTVTLTGNKN
FT                   LSFTNNTALTYGGAISGLKVSISAGGPTLFQSNISGSSAGQGGGGAINIASAGELALSA
FT                   TSGDITFNNNQVTNGSTSTRNAINIIDTAKVTSIRAATGQSIYFYDPITNPGTAASTDT
FT                   LNLNLADANSEIEYGGAIVFSGEKLSPTEKAIAANVTSTIRQPAVLARGDLVLRDGVTV
FT                   TFKDLTQSPGSRILMDGGTTLSAKEANLSLNGLAVNLSSLDGTNKAALKTEAADKNISL
FT                   SGTIALIDTEGSFYENHNLKSASTYPLLELTTAGANGTITLGALSTLTLQEPETHYGYQ
FT                   GNWQLSWANATSSKIGSINWTRTGYIPSPERKSNLPLNSLWGNFIDIRSINQLIETKSS
FT                   GEPFERELWLSGIANFFYRDSMPTRHGFRHISGGYALGITATTPAEDQLTFAFCQLFAR
FT                   DRNHITGKNHGDTYGASLYFHHTEGLFDIANFLWGKATRAPWVLSEISQIIPLSFDAKF
FT                   SYLHTDNHMKTYYTDNSIIKGSWRNDAFCADLGASLPFVISVPYLLKEVEPFVKVQYIY
FT                   AHQQDFYERHAEGRAFNKSELINVEIPIGVTFERDSKSEKGTYDLTLMYILDAYRRNPK
FT                   CQTSLIASDANWMAYGTNLARQGFSVRAANHFQVNPHMEIFGQFAFEVRSSSRNYNTNL
FT                   GSKFCF"
FT   gene            497626..500418
FT                   /gene="pmp_8"
FT                   /locus_tag="CPn_0446"
FT   CDS_pept        497626..500418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_8"
FT                   /locus_tag="CPn_0446"
FT                   /product="Polymorphic Outer Membrane Protein G Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18590"
FT                   /db_xref="GOA:Q9Z393"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z393"
FT                   /protein_id="AAD18590.1"
FT                   /translation="MKIPLHKLLISSTLVTPILLSIATYGADASLSPTDSFDGAGGSTF
FT                   TPKSTADANGTNYVLSGNVYINDAGKGTALTGCCFTETTGDLTFTGKGYSFSFNTVDAG
FT                   SNAGAAASTTADKALTFTGFSNLSFIAAPGTTVASGKSTLSSAGALNLTDNGTILFSQN
FT                   VSNEANNNGGAITTKTLSISGNTSSITFTSNSAKKLGGAIYSSAAASISGNTGQLVFMN
FT                   NKGETGGGALGFEASSSITQNSSLFFSGNTATDAAGKGGAIYCEKTGETPTLTISGNKS
FT                   LTFAENSSVTQGGAICAHGLDLSAAGPTLFSNNRCGNTAAGKGGAIAIADSGSLSLSAN
FT                   QGDITFLGNTLTSTSAPTSTRNAIYLGSSAKITNLRAAQGQSIYFYDPIASNTTGASDV
FT                   LTINQPDSNSPLDYSGTIVFSGEKLSADEAKAADNFTSILKQPLALASGTLALKGNVEL
FT                   DVNGFTQTEGSTLLMQPGTKLKADTEAISLTKLVVDLSALEGNKSVSIETAGANKTITL
FT                   TSPLVFQDSSGNFYESHTINQAFTQPLVVFTAATAASDIYIDALLTSPVQTPEPHYGYQ
FT                   GHWEATWADTSTAKSGTMTWVTTGYNPNPERRASVVPDSLWASFTDIRTLQQIMTSQAN
FT                   SIYQQRGLWASGTANFFHKDKSGTNQAFRHKSYGYIVGGSAEDFSENIFSVAFCQLFGK
FT                   DKDLFIVENTSHNYLASLYLQHRAFLGGLPMPSFGSITDMLKDIPLILNAQLSYSYTKN
FT                   DMDTRYTSYPEAQGSWTNNSGALELGGSLALYLPKEAPFFQGYFPFLKFQAVYSRQQNF
FT                   KESGAEARAFDDGDLVNCSIPVGIRLEKISEDEKNNFEISLAYIGDVYRKNPRSRTSLM
FT                   VSGASWTSLCKNLARQAFLASAGSHLTLSPHVELSGEAAYELRGSAHIYNVDCGLRYSF
FT                   "
FT   gene            500568..503354
FT                   /gene="pmp_9"
FT                   /locus_tag="CPn_0447"
FT   CDS_pept        500568..503354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_9"
FT                   /locus_tag="CPn_0447"
FT                   /product="Polymorphic Outer Membrane Protein G/I Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18591"
FT                   /db_xref="GOA:Q9Z398"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z398"
FT                   /protein_id="AAD18591.1"
FT                   /translation="MKSSLHWFLISSSLALPLSLNFSAFAAVVEINLGPTNSFSGPGTY
FT                   TPPAQTTNADGTIYNLTGDVSITNAGSPTALTASCFKETTGNLSFQGHGYQFLLQNIDA
FT                   GANCTFTNTAANKLLSFSGFSYLSLIQTTNATTGTGAIKSTGACSIQSNYSCYFGQNFS
FT                   NDNGGALQGSSISLSLNPNLTFAKNKATQKGGALYSTGGITINNTLNSASFSENTAANN
FT                   GGAIYTEASSFISSNKAISFINNSVTATSATGGAIYCSSTSAPKPVLTLSDNGELNFIG
FT                   NTAITSGGAIYTDNLVLSSGGPTLFKNNSAIDTAAPLGGAIAIADSGSLSLSALGGDIT
FT                   FEGNTVVKGASSSQTTTRNSINIGNTNAKIVQLRASQGNTIYFYDPITTSITAALSDAL
FT                   NLNGPDLAGNPAYQGTIVFSGEKLSEAEAAEADNLKSTIQQPLTLAGGQLSLKSGVTLV
FT                   AKSFSQSPGSTLLMDAGTTLETADGITINNLVLNVDSLKETKKATLKATQASQTVTLSG
FT                   SLSLVDPSGNVYEDVSWNNPQVFSCLTLTADDPANIHITDLAADPLEKNPIHWGYQGNW
FT                   ALSWQEDTATKSKAATLTWTKTGYNPNPERRGTLVANTLWGSFVDVRSIQQLVATKVRQ
FT                   SQETRGIWCEGISNFFHKDSTKINKGFRHISAGYVVGATTTLASDNLITAAFCQLFGKD
FT                   RDHFINKNRASAYAASLHLQHLATLSSPSLLRYLPGSESEQPVLFDAQISYIYSKNTMK
FT                   TYYTQAPKGESSWYNDGCALELASSLPHTALSHEGLFHAYFPFIKVEASYIHQDSFKER
FT                   NTTLVRSFDSGDLINVSVPIGITFERFSRNERASYEATVIYVADVYRKNPDCTTALLIN
FT                   NTSWKTTGTNLSRQAGIGRAGIFYAFSPNLEVTSNLSMEIRGSSRSYNADLGGKFQF"
FT   gene            complement(503695..504810)
FT                   /gene="yxjG_2"
FT                   /locus_tag="CPn_0448"
FT   CDS_pept        complement(503695..504810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxjG_2"
FT                   /locus_tag="CPn_0448"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18592"
FT                   /db_xref="GOA:Q9Z897"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z897"
FT                   /protein_id="AAD18592.1"
FT                   /translation="MEMMSPFQQPEQCHFDVVGSFLRPESLTRARSDFEEGRIVYEQMR
FT                   VVEDAAIRNLIKKQTEAGLIFFTDGEFRRYSWDFDFMWGFHGVDRRRDSNDPEIGVYLK
FT                   DKISVSKHPFIEHFEFVKTFEKGNAKAKQTIPSPSQFFHEMIFAPNLKNTRKFYPTNQE
FT                   LIDDIVFYYRQVIQDLYAAGCRNLQLDDCAWCRLLDIRAPSWYGVDSHDRLQEILEQFL
FT                   WIHNLVMKDRPEDLFVSLHVCRGDYQAEFFSRRAYDSIEEPLFAKTDVDSYHYYWALDD
FT                   KYSGGAEPLAYVSGEKHVCLGLISSNHSCIEDRDAVVSRIYEAASYIPLERLSLSPQCG
FT                   FASCEGDHRMTEEEQWKKIAFVKEIAKEIWG"
FT   misc_feature    complement(505327..508112)
FT                   /note="Polymorphic Outer Membrane Protein G Family;
FT                   contains frame shift"
FT   gene            complement(505327..507231)
FT                   /gene="pmp_10.1"
FT                   /locus_tag="CPn_0449"
FT   gene            complement(507177..508112)
FT                   /gene="pmp_10.2"
FT                   /locus_tag="CPn_0450"
FT   gene            508275..511061
FT                   /gene="pmp_11"
FT                   /locus_tag="CPn_0451"
FT   CDS_pept        508275..511061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_11"
FT                   /locus_tag="CPn_0451"
FT                   /product="Polymorphic Outer Membrane Protein G Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18593"
FT                   /db_xref="GOA:O86164"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:O86164"
FT                   /protein_id="AAD18593.1"
FT                   /translation="MKTSIPWVLVSSVLAFSCHLQSLANEELLSPDDSFNGNIDSGTFT
FT                   PKTSATTYSLTGDVFFYEPGKGTPLSDSCFKQTTDNLTFLGNGHSLTFGFIDAGTHAGA
FT                   AASTTANKNLTFSGFSLLSFDSSPSTTVTTGQGTLSSAGGVNLENIRKLVVAGNFSTAD
FT                   GGAIKGASFLLTGTSGDALFSNNSSSTKGGAIATTAGARIANNTGYVRFLSNIASTSGG
FT                   AIDDEGTSILSNNKFLYFEGNAAKTTGGAICNTKASGSPELIISNNKTLIFASNVAETS
FT                   GGAIHAKKLALSSGGFTEFLRNNVSSATPKGGAISIDASGELSLSAETGNITFVRNTLT
FT                   TTGSTDTPKRNAINIGSNGKFTELRAAKNHTIFFYDPITSEGTSSDVLKINNGSAGALN
FT                   PYQGTILFSGETLTADELKVADNLKSSFTQPVSLSGGKLLLQKGVTLESTSFSQEAGSL
FT                   LGMDSGTTLSTTAGSITITNLGINVDSLGLKQPVSLTAKGASNKVIVSGKLNLIDIEGN
FT                   IYESHMFSHDQLFSLLKITVDADVDTNVDISSLIPVPAEDPNSEYGFQGQWNVNWTTDT
FT                   ATNTKEATATWTKTGFVPSPERKSALVCNTLWGVFTDIRSLQQLVEIGATGMEHKQGFW
FT                   VSSMTNFLHKTGDENRKGFRHTSGGYVIGGSAHTPKDDLFTFAFCHLFARDKDCFIAHN
FT                   NSRTYGGTLFFKHSHTLQPQNYLRLGRAKFSESAIEKFPREIPLALDVQVSFSHSDNRM
FT                   ETHYTSLPESEGSWSNECIAGGIGLDLPFVLSNPHPLFKTFIPQMKVEMVYVSQNSFFE
FT                   SSSDGRGFSIGRLLNLSIPVGAKFVQGDIGDSYTYDLSGFFVSDVYRNNPQSTATLVMS
FT                   PDSWKIRGGNLSRQAFLLRGSNNYVYNSNCELFGHYAMELRGSSRNYNVDVGTKLRF"
FT   gene            511319..512863
FT                   /gene="pmp_12"
FT                   /locus_tag="CPn_0452"
FT   CDS_pept        511319..512863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_12"
FT                   /locus_tag="CPn_0452"
FT                   /product="Polymorphic Outer Membrane Protein (truncated)
FT                   A/I Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18594"
FT                   /db_xref="GOA:Q9Z3D6"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z3D6"
FT                   /protein_id="AAD18594.1"
FT                   /translation="MTILRNFLTCSALFLALPAAAQVVYLHESDGYNGAINNKSLEPKI
FT                   TCYPEGTSYIFLDDVRISNVKHDQEDAGVFINRSGNLFFMGNRCNFTFHNLMTEGFGAA
FT                   ISNRVGDTTLTLSNFSYLAFTSAPLLPQGQGAIYSLGSVMIENSEEVTFCGNYSSWSGA
FT                   AIYTPYLLGSKASRPSVNLSGNRYLVFRDNVSQGYGGAISTHNLTLTTRGPSCFENNHA
FT                   YHDVNSNGGAIAIAPGGSISISVKSGDLIFKGNTASQDGNTIHNSIHLQSGAQFKNLRA
FT                   VSESGVYFYDPISHSESHKITDLVINAPEGKETYEGTISFSGLCLDDHEVCAENLTSTI
FT                   LQDVTLAGGTLSLSDGVTLQLHSFKQEASSTLTMSPGTTLLCSGDARVQNLHILIEDTD
FT                   NFVPVRIRAEDKDALVSLEKLKVAFEAYWSVYDFPQFKEAFTIPLLELLGPSFDSLLLG
FT                   ETTLERTQVTTENDAVRGFWSLSWEEYPPSLDKDRRITPTKKTVFLTWNPEITSTP"
FT   gene            513234..516155
FT                   /gene="pmp_13"
FT                   /locus_tag="CPn_0453"
FT   CDS_pept        513234..516155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_13"
FT                   /locus_tag="CPn_0453"
FT                   /product="Polymorphic Outer Membrane Protein G Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18595"
FT                   /db_xref="GOA:Q9Z896"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z896"
FT                   /protein_id="AAD18595.1"
FT                   /translation="MKTSIRKFLISTTLAPCFASTAFTVEVIMPSENFDGSSGKIFPYT
FT                   TLSDPRGTLCIFSGDLYIANLDNAISRTSSSCFSNRAGALQILGKGGVFSFLNIRSSAD
FT                   GAAISSVITQNPELCPLSFSGFSQMIFDNCESLTSDTSASNVIPHASAIYATTPMLFTN
FT                   NDSILFQYNRSAGFGAAIRGTSITIENTKKSLLFNGNGSISNGGALTGSAAINLINNSA
FT                   PVIFSTNATGIYGGAIYLTGGSMLTSGNLSGVLFVNNSSRSGGAIYANGNVTFSNNSDL
FT                   TFQNNTASPQNSLPAPTPPPTPPAVTPLLGYGGAIFCTPPATPPPTGVSLTISGENSVT
FT                   FLENIASEQGGALYGKKISIDSNKSTIFLGNTAGKGGAIAIPESGELSLSANQGDILFN
FT                   KNLSITSGTPTRNSIHFGKDAKFATLGATQGYTLYFYDPITSDDLSAASAAATVVVNPK
FT                   ASADGAYSGTIVFSGETLTATEAATPANATSTLNQKLELEGGTLALRNGATLNVHNFTQ
FT                   DEKSVVIMDAGTTLATTNGANNTDGAITLNKLVINLDSLDGTKAAVVNVQSTNGALTIS
FT                   GTLGLVKNSQDCCDNHGMFNKDLQQVPILELKATSNTVTTTDFSLGTNGYQQSPYGYQG
FT                   TWEFTIDTTTHTVTGNWKKTGYLPHPERLAPLIPNSLWANVIDLRAVSQASAADGEDVP
FT                   GKQLSITGITNFFHANHTGDARSYRHMGGGYLINTYTRITPDAALSLGFGQLFTKSKDY
FT                   LVGHGHSNVYFATVYSNITKSLFGSSRFFSGGTSRVTYSRSNEKVKTSYTKLPKGRCSW
FT                   SNNCWLGELEGNLPITLSSRILNLKQIIPFVKAEVAYATHGGIQENTPEGRIFGHGHLL
FT                   NVAVPVGVRFGKNSHNRPDFYTIIVAYAPDVYRHNPDCDTTLPINGATWTSIGNNLTRS
FT                   TLLVQASSHTSVNDVLEIFGHCGCDIRRTSRQYTLDIGSKLRF"
FT   gene            516182..519118
FT                   /gene="pmp_14"
FT                   /locus_tag="CPn_0454"
FT   CDS_pept        516182..519118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_14"
FT                   /locus_tag="CPn_0454"
FT                   /product="Polymorphic Outer Membrane Protein H Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18596"
FT                   /db_xref="GOA:Q9Z895"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z895"
FT                   /protein_id="AAD18596.1"
FT                   /translation="MPLSFKSSSFCLLACLCSASCAFAETRLGGNFVPPITNQGEEILL
FT                   TSDFVCSNFLGASFSSSFINSSSNLSLLGKGLSLTFTSCQAPTNSNYALLSAAETLTFK
FT                   NFSSINFTGNQSTGLGGLIYGKDIVFQSIKDLIFTTNRVAYSPASVTTSATPAITTVTT
FT                   GASALQPTDSLTVENISQSIKFFGNLANFGSAISSSPTAVVKFINNTATMSFSHNFTSS
FT                   GGGVIYGGSSLLFENNSGCIIFTANSCVNSLKGVTPSSGTYALGSGGAICIPTGTFELK
FT                   NNQGKCTFSYNGTPNDAGAIYAETCNIVGNQGALLLDSNTAARNGGAICAKVLNIQGRG
FT                   PIEFSRNRAEKGGAIFIGPSVGDPAKQTSTLTILASEGDIAFQGNMLNTKPGIRNAITV
FT                   EAGGEIVSLSAQGGSRLVFYDPITHSLPTTSPSNKDITINANGASGSVVFTSKGLSSTE
FT                   LLLPANTTTILLGTVKIASGELKITDNAVVNVLGFATQGSGQLTLGSGGTLGLATPTGA
FT                   PAAVDFTIGKLAFDPFSFLKRDFVSASVNAGTKNVTLTGALVLDEHDVTDLYDMVSLQS
FT                   PVAIPIAVFKGATVTKTGFPDGEIATPSHYGYQGKWSYTWSRPLLIPAPDGGFPGGPSP
FT                   SANTLYAVWNSDTLVRSTYILDPERYGEIVSNSLWISFLGNQAFSDILQDVLLIDHPGL
FT                   SITAKALGAYVEHTPRQGHEGFSGRYGGYQAALSMNYTDHTTLGLSFGQLYGKTNANPY
FT                   DSRCSEQMYLLSFFGQFPIVTQKSEALISWKAAYGYSKNHLNTTYLRPDKAPKSQGQWH
FT                   NNSYYVLISAEHPFLNWCLLTRPLAQAWDLSGFISAEFLGGWQSKFTETGDLQRSFSRG
FT                   KGYNVSLPIGCSSQWFTPFKKAPSTLTIKLAYKPDIYRVNPHNIVTVVSNQESTSISGA
FT                   NLRRHGLFVQIHDVVDLTEDTQAFLNYTFDGKNGFTNHRVSTGLKSTF"
FT   gene            complement(519455..520348)
FT                   /locus_tag="CPn_0455"
FT   CDS_pept        complement(519455..520348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18597"
FT                   /db_xref="InterPro:IPR006850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WJ64"
FT                   /protein_id="AAD18597.1"
FT                   /translation="MWLRFLLLVSYDEKEKDVVVVCNHSEPNILGLPPEAVSQLIEELS
FT                   DEGYSYLNVVRCDLSGETTVQQRLLLNADEGRSMTVVISELPEGHPDIRNLQLASERIF
FT                   VSREKEAADAYASGCKVVAFDDEHLPWVSSHIAYAEEIREKQEQTMQGSLTEEQLGALL
FT                   CNTVSTEKNLAFALDAVIKQSVWRFRNPDLFAYEREALEASVTDALVSYVSNLDMIPYT
FT                   SSQGIVIEDSSIVRTSQEHTLIVNCAAFDKLASQIEFLCPSDVLPISGKDPLISDDEDE
FT                   ELNPKVSSAADSKDKT"
FT   gene            complement(520324..521532)
FT                   /locus_tag="CPn_0456"
FT   CDS_pept        complement(520324..521532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18598"
FT                   /db_xref="InterPro:IPR006835"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WL27"
FT                   /protein_id="AAD18598.1"
FT                   /translation="MTHCLHGWFSVVRHHFVQAFNFSRPLYSRITHFALGVIKAIPIVG
FT                   HLVMGVDWLISHCFERGVSHPGFPSDIAPILKVEKIAGRDHISRIENQLKSLRKTIEVE
FT                   DLDKVHGQYQENPYADMASSEVLKLDKGVHVSELGKAFSRVRNRITRSYSYAPTPQLDS
FT                   IAIVGIDLVSPEEQENLVRLANEVIQLYPKSKTTLYLLIDFNKEWVGDISSDKEKQLRS
FT                   LGLHSEVQCLSVLEPQGAEGEDTKHFDLMVGCYGKDSYLREGKILQQALGTSLGTVPWV
FT                   NVMHTLPSRYRSRLSLPINTEKDKTELYKEISRTHHQLHTLGMGLGAQDSGLLLDRQRL
FT                   HAPLSQGSHCHSYLADLTHEELKILLFSAFVDAKNISKKELREVSLNFANDTSVECGCA
FT                   FYF"
FT   gene            complement(522117..523865)
FT                   /locus_tag="CPn_0457"
FT   CDS_pept        complement(522117..523865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18599"
FT                   /db_xref="InterPro:IPR006835"
FT                   /db_xref="InterPro:IPR006850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X554"
FT                   /protein_id="AAD18599.1"
FT                   /translation="MASCLSAWFSIVREHFYRAFDFSLPFCARITEFVLGVIKGIPVVG
FT                   HIIVGIEWLVSRYLESFVTKPTFVSDVVSLLKTEKVAGRDHIARVVETLKRQRVAVAPE
FT                   DEDKVHGKIPVHPFGGIQPVEVLTLYPEVQDATLGLAFSKIRNRVRQAYLQAPRPKLQK
FT                   IYIIGNDMNPFEVDDFLHLARLCNETQRLYPDATISLYLTASGGRNAMDKKNRKLLSDC
FT                   ELNPKIACLDFNQGDVVKQATCDCWMVYHGENDQGTLNQIQEELEKSGEETPWIHVGQK
FT                   PLSQSLWDFSPFSSLEMKGDKEKALEYSELEKEQLYSRLVYVGERSSVLSLGFGDSRSG
FT                   ILMDPKRVHAPLSEGHYCHSYLADLENPGLQKTILAAFLNPKELSSTILQPISLNLILN
FT                   SKTYLRQHFGFFERMSRSDRNVVVVVCDSWWGTDWKEEPSFQHFIMELECRGYSHFNIF
FT                   AFRSNSMCVEERRILNESSQEKAFTMIFCEDSVSQGDIRCLHLASEGMLCGKECYAVDV
FT                   YTSGCANFMMEEVLTLERESNLWNRKHGLWKREVRKQKQEAALDQDESEIYVCNQLTAQ
FT                   QNFACS"
FT   gene            complement(524233..526320)
FT                   /locus_tag="CPn_0458"
FT   CDS_pept        complement(524233..526320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18600"
FT                   /db_xref="GOA:A0A0F7WVW0"
FT                   /db_xref="InterPro:IPR006835"
FT                   /db_xref="InterPro:IPR006850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WVW0"
FT                   /protein_id="AAD18600.1"
FT                   /translation="MFVSNFIFFVVMPIPYISSWISTVRQHFVKAFDFSRPFCSRVTNF
FT                   ALGVIKAIPIVGHIVMGMEWLVSSCVAGIITRSSFTSDVVQIVKTEKALGRDHISRVAE
FT                   ILQRERGTITPENQDKVHGKFPVCPFGRLKSEETLKLKPGEREGTLDTVFSPIRTRVTR
FT                   AYLQAPRPEIRTISIVGSKLKTPQDFSQFVSLANETQRLHPEALVCLYLTGLNRESQMC
FT                   DTTTAEKKQYLHNSGLDSRIQCKDSKEDDAGSPENPELWIGYYSREQQHNIDGQYIQQC
FT                   LGKSADPIPWIHVTEDTKDFYYPPNFTSYSHTRQSTDPTSPPRLPESEGDKDSLYGQLS
FT                   RSYHHEYMLGLGLKPEDAGLLMDPDRIYAPLSQGHYCHSYLADIENEDLRTLVLSPFLD
FT                   PGNLSSEDLRPVAFNIARLPLELDSLFFRLVAGQQEGRNIVTLAHGTPRPEDLDPDSMN
FT                   ILTRRLQMSGYSYLNIFSYKSRKMIVKERQFFGDRSEGKSFTLILFEDPISAADFRCLQ
FT                   LAAEGMVAKDLPSVADICASGCSCIQFSEMQSPQAIEYRQWEARVEDEAGEEAREPVIY
FT                   SQDQLSSMLTTQQNFVFSLDAVVKQAIWRFRSKGLLTMERKALGEEFLTAIFSYLGSQE
FT                   RNENMGKRTTEEHEVVISFEELDRMVQVLPAEVPADSGNDPTRPVPNPDSNPDSSQNEG
FT                   S"
FT   gene            complement(526616..527005)
FT                   /locus_tag="CPn_0459"
FT   CDS_pept        complement(526616..527005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18601"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z890"
FT                   /protein_id="AAD18601.1"
FT                   /translation="MREEGSVSFREYFRAYMCDKIVAQKNFLFTLDAVIKQAGWRSQEK
FT                   LNLFYVESQALGREIKVSLEEYIQSMVGILGSQRTKKSFKFSVDFTPLEQALQERCSSD
FT                   DDEDATATSTATGATASPTDMHEDE"
FT   gene            complement(526989..527840)
FT                   /locus_tag="CPn_0460"
FT   CDS_pept        complement(526989..527840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18602"
FT                   /db_xref="InterPro:IPR006850"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z889"
FT                   /protein_id="AAD18602.1"
FT                   /translation="MIQHLLNFALEETPSISVQYQEQEKLSPCDHSPEIGKKKRWNKLE
FT                   SFSTYCSLFMSVKDHYKLNLGIQNSLSGWLLDPYRVCAPLSSPYSCPSYLLDLQNKELR
FT                   RSLLSTFLDPKNLTSETFRSVSINFGNSSFGQRWSEFLSRVLHDEKEKHVAVVCNDAKL
FT                   LEEGLSPEALSLLEEDLRESGYSYLNILSVSPEGVSKVQERQILRRDLQGRSFTVMITD
FT                   LPLGSEDIRSLQLASDRILVSSSLDAADACASGCKVLVYENPNASWAQELENFYKQVER
FT                   RR"
FT   gene            complement(527841..528638)
FT                   /locus_tag="CPn_0461"
FT   CDS_pept        complement(527841..528638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18603"
FT                   /db_xref="InterPro:IPR006835"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X3S3"
FT                   /protein_id="AAD18603.1"
FT                   /translation="MACPSISSWFTVVRQHFVNAFDFTHPVCSRITNFALGIIKAIPVL
FT                   GHIVMGIEWLISWIPRHTVRHGMFTSDVSSAIKVEQTRGHNCLAPLEAYLSSLRVPISQ
FT                   EDLGKVHGRTPEDPFVDITPTEIVQLLPDEELSTVDEALQGVRSRLTYAYRSVEKPMIQ
FT                   DLALVGFGLRDSADLINFVRLANGVQNHYPHTKVKLYLAKNLADVWDCEISEEEKGQLR
FT                   ALGLDPKIESISLTSAGLPSVPEVATVDFMITCYGKDQEVQDP"
FT   gene            complement(529034..531052)
FT                   /locus_tag="CPn_0462"
FT   CDS_pept        complement(529034..531052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18604"
FT                   /db_xref="GOA:Q9Z887"
FT                   /db_xref="InterPro:IPR006835"
FT                   /db_xref="InterPro:IPR006850"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z887"
FT                   /protein_id="AAD18604.1"
FT                   /translation="MACYISIWISTVKQHFIRAFDFTRPLGSRITNFALGVIKAIPILG
FT                   CVVIGVSWLVSTCSARRFGKPAFTSDVASIVKIEKTRGYNPLAWVEQYLRQLRVRLPEG
FT                   DLGKIHGKVSRDYVCDRTPQENLNMVPHQYLGELGRAFYGIRNRVTKAYQRVTPLEVPC
FT                   LTLVGFDILDPEDQVNFVRLANGIQTQYPQTQIKLYLISIQKIWNQCDGTISQEKEQQL
FT                   RSLGLDAKIKCVSAPALLLQKYLQSENLPSCDLLINYYGKQQSVRDVDSIKSLLNLSSE
FT                   HIPAISVTYRPDDPFYSYYFFPGSQGGTAPDQRIPWSEQEHLQTYTTLSNPRCDRYAVH
FT                   LGMEDFASGVFLDPLRVSAPLSGEYSCPSYLLDLKSEELRCFLLSAFIDPNNSGQGNPR
FT                   PMSINFGNSPLGQRWSEFLSRVLHDETEKHVAVVCNNPQLIKKSFPSHSLSLLENELEE
FT                   SGYSYLNIVSVSQERTCVKERRILSSDPSGRSFTVILTDLPEGSSDIRNLQLASDRILV
FT                   SSALDAADACASECKILEYEDPEQEWAQQYASFYRNIDRAGDLQRQGIPGEPLGVSAST
FT                   RVVLEKDIVFNLNAVIQQAMWKFKKRDLFAVESQALGDDMRRALEGYIGSSLLVEGTIQ
FT                   PQVACNVNVSFATLDEAVCAACDSAQDAPSEENNTDD"
FT   gene            complement(531188..532357)
FT                   /locus_tag="CPn_0463"
FT   CDS_pept        complement(531188..532357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18605"
FT                   /db_xref="InterPro:IPR006850"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z886"
FT                   /protein_id="AAD18605.1"
FT                   /translation="MMKQGVGQDAKELYTFLSRGNEHYQPCLWFSLEEELGFLFDEKML
FT                   CAPLSEDHYCHSYLVDLVDQHLKDLILSMFLDPQNISAGELLKVSINVGDSFSPLQQKD
FT                   FLSMVLRDETGKNVVVVFKGVLSLPATQVCKLVEELNSKDYSYLNIFSCHGDSSPQLLF
FT                   RKELEGTSGRYFTVICALYLGDTDMRSLQLASERIMVSREFDLVDAYAARCKLLKIDHT
FT                   NWRPGTFSRHADFADAVDVSAGFNSREFKLITQANQGILESGELPLPSKTFWEGFLAFC
FT                   DRVTVTRHFIPMLDAAIKQAVWTHKHPSLIDKECEALDLKTQCLPSIVSYLEYVTNSHE
FT                   KTSKGPFIQKEIIADCSPLKEALFPGSDEDVPSTSEDPSDDHPSDLEDS"
FT   gene            complement(532363..532842)
FT                   /locus_tag="CPn_0464"
FT   CDS_pept        complement(532363..532842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18606"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z885"
FT                   /protein_id="AAD18606.1"
FT                   /translation="MFSEGTALNLFRIFAPLRNRVTTEYSRARQPDLHRIAIVYIGVLD
FT                   SESSKILERLISYMSCIYSESQMYLRFFMGKNVNQSAVLSKLHVENLHIRCGFFSEDAV
FT                   PESEPFDLSIYVHTDRSCPLPTKKRSSSWELQTVELPESIYPQSEFLLMRPRMLS"
FT   gene            complement(532868..533212)
FT                   /locus_tag="CPn_0465"
FT   CDS_pept        complement(532868..533212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18607"
FT                   /db_xref="GOA:A0A0F7WSU6"
FT                   /db_xref="InterPro:IPR006835"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WSU6"
FT                   /protein_id="AAD18607.1"
FT                   /translation="MSYYFSLWYLKVQQHFQAAFDFTRSLCSRISNFALGVIALLPIIG
FT                   QLYVGLDWLLSRIKKPEFPSDVDQIVRVEHVVGHDHRSRVEDILKRQRLSLEPRDEGKV
FT                   HGDLPSAPFF"
FT   gene            533724..536540
FT                   /gene="pmp_15"
FT                   /locus_tag="CPn_0466"
FT   CDS_pept        533724..536540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_15"
FT                   /locus_tag="CPn_0466"
FT                   /product="Polymorphic Outer Membrane Protein E Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18608"
FT                   /db_xref="GOA:Q9Z883"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z883"
FT                   /protein_id="AAD18608.1"
FT                   /translation="MRFFCFGMLLPFTFVLANEGLQLPLETYITLSPEYQAAPQVGFTH
FT                   NQNQDLAIVGNHNDFILDYKYYRSNGGALTCKNLLISENIGNVFFEKNVCPNSGGAIYA
FT                   AQNCTISKNQNYAFTTNLVSDNPTATAGSLLGGALFAINCSITNNLGQGTFVDNLALNK
FT                   GGALYTETNLSIKDNKGPIIIKQNRALNSDSLGGGIYSGNSLNIEGNSGAIQITSNSSG
FT                   SGGGIFSTQTLTISSNKKLIEISENSAFANNYGSNFNPGGGGLTTTFCTILNNREGVLF
FT                   NNNQSQSNGGAIHAKSIIIKENGPVYFLNNTATRGGALLNLSAGSGNGSFILSADNGDI
FT                   IFNNNTASKHALNPPYRNAIHSTPNMNLQIGARPGYRVLFYDPIEHELPSSFPILFNFE
FT                   TGHTGTVLFSGEHVHQNFTDEMNFFSYLRNTSELRQGVLAVEDGAGLACYKFFQRGGTL
FT                   LLGQGAVITTAGTIPTPSSTPTTVGSTITLNHIAIDLPSILSFQAQAPKIWIYPTKTGS
FT                   TYTEDSNPTITISGTLTLRNSNNEDPYDSLDLSHSLEKVPLLYIVDVAAQKINSSQLDL
FT                   STLNSGEHYGYQGIWSTYWVETTTITNPTSLLGANTKHKLLYANWSPLGYRPHPERRGE
FT                   FITNALWQSAYTALAGLHSLSSWDEEKGHAASLQGIGLLVHQKDKNGFKGFRSHMTGYS
FT                   ATTEATSSQSPNFSLGFAQFFSKAKEHESQNSTSSHHYFSGMCIENTLFKEWIRLSVSL
FT                   AYMFTSEHTHTMYQGLLEGNSQGSFHNHTLAGALSCVFLPQPHGESLQIYPFITALAIR
FT                   GNLAAFQESGDHAREFSLHRPLTDVSLPVGIRASWKNHHRVPLVWLTEISYRSTLYRQD
FT                   PELHSKLLISQGTWTTQATPVTYNALGIKVKNTMQVFPKVTLSLDYSADISSSTLSHYL
FT                   NVASRMRF"
FT   gene            536633..539437
FT                   /gene="pmp_16"
FT                   /locus_tag="CPn_0467"
FT   CDS_pept        536633..539437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_16"
FT                   /locus_tag="CPn_0467"
FT                   /product="Polymorphic Outer Membrane Protein E Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18609"
FT                   /db_xref="GOA:Q9Z882"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z882"
FT                   /protein_id="AAD18609.1"
FT                   /translation="MFGMTPAVYSLQTDSLEKFALERDEEFRTSFPLLDSLSTLTGFSP
FT                   ITTFVGNRHNSSQDIVLSNYKSIDNILLLWTSAGGAVSCNNFLLSNVEDHAFFSKNLAI
FT                   GTGGAIACQGACTITKNRGPLIFFSNRGLNNASTGGETRGGAIACNGDFTISQNQGTFY
FT                   FVNNSVNNWGGALSTNGHCRIQSNRAPLLFFNNTAPSGGGALRSENTTISDNTRPIYFK
FT                   NNCGNNGGAIQTSVTVAIKNNSGSVIFNNNTALSGSINSGNGSGGAIYTTNLSIDDNPG
FT                   TILFNNNYCIRDGGAICTQFLTIKNSGHVYFTNNQGNWGGALMLLQDSTCLLFAEQGNI
FT                   AFQNNEVFLTTFGRYNAIHCTPNSNLQLGANKGYTTAFFDPIEHQHPTTNPLIFNPNAN
FT                   HQGTILFSSAYIPEASDYENNFISSSKNTSELRNGVLSIEDRAGWQFYKFTQKGGILKL
FT                   GHAASIATTANSETPSTSVGSQVIINNLAINLPSILAKGKAPTLWIRPLQSSAPFTEDN
FT                   NPTITLSGPLTLLNEENRDPYDSIDLSEPLQNIHLLSLSDVTARHINTDNFHPESLNAT
FT                   EHYGYQGIWSPYWVETITTTNNASIETANTLYRALYANWTPLGYKVNPEYQGDLATTPL
FT                   WQSFHTMFSLLRSYNRTGDSDIERPFLEIQGIADGLFVHQNSIPGAPGFRIQSTGYSLQ
FT                   ASSETSLHQKISLGFAQFFTRTKEIGSSNNVSAHNTVSSLYVELPWFQEAFATSTVLAY
FT                   GYGDHHLHSLHPSHQEQAEGTCYSHTLAAAIGCSFPWQQKSYLHLSPFVQAIAIRSHQT
FT                   AFEEIGDNPRKFVSQKPFYNLTLPLGIQGKWQSKFHVPTEWTLELSYQPVLYQQNPQIG
FT                   VTLLASGGSWDILGHNYVRNALGYKVHNQTALFRSLDLFLDYQGSVSSSTSTHHLQAGS
FT                   TLKF"
FT   misc_feature    539632..541463
FT                   /note="Polymorphic Outer Membrane Protein E Family;
FT                   contains frame shift"
FT   gene            539632..540435
FT                   /gene="pmp_17.1"
FT                   /locus_tag="CPn_0468"
FT   gene            540399..541463
FT                   /gene="pmp_17.2"
FT                   /locus_tag="CPn_0469"
FT   gene            541357..542535
FT                   /gene="pmp_17.3"
FT                   /locus_tag="CPn_0470"
FT   CDS_pept        541357..542535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_17.3"
FT                   /locus_tag="CPn_0470"
FT                   /product="Polymorphic Outer Membrane Protein"
FT                   /note="frame-shift with CPn0469"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18611"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULQ3"
FT                   /protein_id="AAD18611.1"
FT                   /translation="MSLNLERISPLLYLLDVTAKKIDTSNLIVEAMNLDEHYGYQGIWS
FT                   PYWMETTTTTSSTVPEQTNTNHRQLYVDWTPVGYRPNPERHGEFIANTLWQSAYNALLG
FT                   IRILPPQNLKEHDLEASLQGLGLLINQHNREGRKGFRNHTTGYAATTSAKTAARHSFSL
FT                   GFAQMFSKTRERQSPSTTSSHNYFAGLRFDSLLFRDFISTGLSLGYSYGDHHMLCHYTE
FT                   ILKGSSKAFFNNHTLVASLDCTFLPARITRTLELQPFISAIALRCSQASFQETGDHIRK
FT                   FHPKHPLTDLSSPIGFRSEWKTSHHIPMLWTTEISYVPTLYRKNPEMFTTLLISNGTWT
FT                   TQATPVSYNSVAAKIKNTSQLFSRVTLSLDYSAQVSSSTVGQYLKAESHCTF"
FT   gene            542564..545404
FT                   /gene="pmp_18"
FT                   /locus_tag="CPn_0471"
FT   CDS_pept        542564..545404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_18"
FT                   /locus_tag="CPn_0471"
FT                   /product="Polymorphic Outer Membrane Protein E/F Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18610"
FT                   /db_xref="GOA:Q9Z880"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z880"
FT                   /protein_id="AAD18610.1"
FT                   /translation="MQNNRSLSKSSFFVGALILGKTTILLNATPLSDYFDNQANQLTTL
FT                   FPLIDTLTNMTPYSHRATLFGVRDDTNQDIVLDHQNSIESWFENFSQDGGALSCKSLAI
FT                   TNTKNQILFLNSFAIKRAGAMYVNGNFDLSENHGSIIFSGNLSFPNASNFADTCTGGAV
FT                   LCSKNVTISKNQGTAYFINNKAKSSGGAIQAAIINIKDNTGPCLFFNNAAGGTAGGALF
FT                   ANACRIENNSQPIYFLNNQSGLGGAIRVHQECILTKNTGSVIFNNNFAMEADISANHSS
FT                   GGAIYCISCSIKDNPGIAAFDNNTAARDGGAICTQSLTIQDSGPVYFTNNQGTWGGAIM
FT                   LRQDGACTLFADQGDIIFYNNRHFKDTFSNHVSVNCTRNVSLTVGASQGHSATFYDPIL
FT                   QRYTIQNSIQKFNPNPEHLGTILFSSTYIPDTSTSRDDFISHFRNHIGLYNGTLALEDR
FT                   AEWKVYKFDQFGGTLRLGSRAVFSTTDEEQSSSSVGSVININNLAINLPSILGNRVAPK
FT                   LWIRPTGSSAPYSEDNNPIINLSGPLSLLDDENLDPYDTADLAQPIAEVPLLYLLDVTA
FT                   KHINTDNFYPEGLNTTQHYGYQGVWSPYWIETITTSDTSSEDTVNTLHRQLYGDWTPTG
FT                   YKVNPENKGDIALSAFWQSFHNLFATLRYQTQQGQIAPTASGEATRLFVHQNSNNDAKG
FT                   FHMEATGYSLGTTSNTASNHSFGVNFSQLFSNLYESHSDNSVASHTTTVALQINNPWLQ
FT                   ERFSTSASLAYSYSNHHIKASGYSGKIQTEGKCYSTTLGAALSCSLSLQWRSRPLHFTP
FT                   FIQAIAVRSNQTAFQESGDKARKFSVHKPLYNLTVPLGIQSAWESKFRLPTYWNIELAY
FT                   QPVLYQQNPEINVSLESSGSSWLLSGTTLARNAIAFKGRNQIFIFPKLSVFLDYQGSVS
FT                   SSTTTHYLHAGTTFKF"
FT   gene            complement(545578..547905)
FT                   /locus_tag="CPn_0472"
FT   CDS_pept        complement(545578..547905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X5H0"
FT                   /protein_id="AAD18612.1"
FT                   /translation="MASGIGGSSGLGKIPPKDNGDRSRSPSPKGELGSHEISLPPQEHG
FT                   EEGASGSSHIHSSSSFLPEDQESQSSSSAASSPGFFSRVRSGVDRALKSFGNFFSAEST
FT                   SQARETRQAFVRLSKTITADERRDVDSSSAAATEARVAEDASVSGENPSQGVPETSSGP
FT                   EPQRLFSLPSVKKQSGLGRLVQTVRDRIVLPSGAPPTDSEPLSLYELNLRLSSLRQELS
FT                   DIQSNDQLTPEEKAEATVTIQQLIQITEFQCGYMEATQSSVSLAEARFKGVETSDEINS
FT                   LCSELTDPELQELMSDGDSLQNLLDETADDLEAALSHTRLSFSLDDNPTPIDNNPTLIS
FT                   QEEPIYEEIGGAADPQRTRENWSTRLWNQIREALVSLLGMILSILGSILHRLRIARHAA
FT                   AEAVGRCCTCRGEECTSSEEDSMSVGSPSEIDETERTGSPHDVPRRNGSPREDSPLMNA
FT                   LVGWAHKHGAKTKESSESSTPEISISAPIVRGWSQDSSVSFIVMEDDHIFYDVPRRKDG
FT                   IYDVPSSPRWSPARELEEDVFGDYEVPITSAEPSKDKNIYMTPRLATPAIYDLPSRPGS
FT                   SGSSRSPSSDRVRSSSPNRRGVPLPPVPSPAMSEEGSIYEDMSGASGAGESDYEDMSRS
FT                   PSPRGDLDEPIYANTPEDNPFTQRNIDRILQERSGGASASPVEPIYDEIPWIHGRPPAT
FT                   LPRPENTLTNVSLRVSPGFGPEVRAALLSESVSAVMVEAESIVPPTEPGDGESEYLEPL
FT                   GGLVATTKILLQKGWPRGESNA"
FT   gene            complement(548067..549593)
FT                   /locus_tag="CPn_0473"
FT   CDS_pept        complement(548067..549593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18613"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XLK0"
FT                   /protein_id="AAD18613.1"
FT                   /translation="MAVGGVGGSRSPSPIPPNRRNSEDGKVSPKDNLGEHTVSSSDSSL
FT                   ASQGPTIEERKAQLGGTDKIPLPSVKEPGDSQTSGRSGVLQRIWKGVKGVFKKTPQARP
FT                   EVSSPRLPSHVQHGQRLPGLEGFRDRIQKRSENPEADLGKMKRSYSDGDLDRVGHDSNE
FT                   DSTEDSRSEGGEPSSKSSSFLSGVRGAVSKVHGALGDIKGKFQRSASEDDLTTQGEDSA
FT                   GDTVKERRSEEAEASSKSSSFLSGVRGATSTVQGALGDAKEKVSAFGEQAAGAIRSAPG
FT                   NIRTRFQRSSSEGDLSNVNKAAKHLRKALENLEKVAPEQVSPEVASRVQSLLARMEQLT
FT                   HQEPPTVEDLITFVESNVGSDSVEYASIVPQDGSQAPAETAEAPETGGVEGSAAQGAWK
FT                   ALRDFVVSIFQAVASFFRAIASRLSSARRESAVDDLASESNTQWFVEQEGVSNPSAAPS
FT                   LSFAEEIARRAAEMSNRNAQSLEKLESGNVTDPVIQQGLGLARSFAPEGQ"
FT   gene            complement(549804..551573)
FT                   /locus_tag="CPn_0474"
FT   CDS_pept        complement(549804..551573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0474"
FT                   /product="CT365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18614"
FT                   /db_xref="GOA:Q9Z877"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z877"
FT                   /protein_id="AAD18614.1"
FT                   /translation="MSTSPISNDPRYLSLSNATEKTSLLANSRSLSPVPNSLVPSNPED
FT                   TGLRKSIFTHSVTLFAGLVVLLVAVSVVVVALTVLAPGVPQAILLGIAISGVGIGGFSI
FT                   MKSLVYMVRDYMSPRMQESSRIKSALAVGTGFTVMGLVMKVGANFVPGGYGGLVGSLGS
FT                   SAYSRGSQTTLASFSHYIYTKFFRSEKVAKGEKLTEAETIKEAKKLHYITLSIATIGVG
FT                   LAVLGILLAIAGTVLLGGAPATIAIILAPPLISIGLTTVLQTILHSSIGKWRAFLLTQE
FT                   KKDLFVDTSLKDIRLEKLPPSEVEESETSQSVIEVPDSEGIAETRISAEEIDTRLSLTT
FT                   RQKVIFALATLLLLASIAAFIVTGFGGLTVMQVLLVASVGSAVASVTLPMVSSGFSYVA
FT                   YQLKARLNISKLRWKEAKNKKRVRQFLIESGVIASDREFNQMWKTVYKKQIQKTDAAIR
FT                   EEVRNFEKGGEVNSALVGGILLGVGTGIMLLALVPAFAPIVPGILALGGSTLGIAGSIL
FT                   MRKFVNWLYDELVKLYERRRNRRELLYGPESKMRSIATDLVVEALAASHDHLFDLDGPV
FT                   DFIDVDVDIDGAA"
FT   gene            complement(551682..553844)
FT                   /gene="glgB"
FT                   /locus_tag="CPn_0475"
FT   CDS_pept        complement(551682..553844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="CPn_0475"
FT                   /product="Glucan Branching Enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18615"
FT                   /db_xref="GOA:Q9Z876"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z876"
FT                   /protein_id="AAD18615.1"
FT                   /translation="MVDKLIHPWDLDLLVSGRQKDPHKLLGILASEDSSDHIVIFRPGA
FT                   HTVAIELLGELHHAVAYRSGLFFLSVPKGIGHGDYRVYHQNGLLAHDPYAFPPLWGEID
FT                   SFLFHRGTHYRIYERMGAIPMEVQGISGVLFVLWAPHAQRVSVVGDFNFWHGLVNPLRK
FT                   ISDQGIWELFVPGLGEGIRYKWEIVTQSGNVIVKTDPYGKSFDPPPQGTARVADSESYS
FT                   WSDHRWMERRSKQSEGPVTIYEVHLGSWQWQEGRPLSYSEMAHRLASYCKEMHYTHVEL
FT                   LPITEHPLNESWGYQVTGYYAPTSRYGTLQEFQYFVDYLHKENIGIILDWVPGHFPVDA
FT                   FALASFDGEPLYEYTGHSQALHPHWNTFTFDYSRHEVTNFLLGSALFWLDKMHIDGLRV
FT                   DAVASMLYRDYGREDGEWTPNIYGGKENLESIEFLKHLNSVIHKEFSGVLTFAEESTAF
FT                   PGVTKDVDQGGLGFDYKWNLGWMHDTFHYFMKDPMYRKYHQKDLTFSLWYAFQESFILP
FT                   LSHDEVVHGKGSLVNKLPGDTWTRFAQMRVLLSYQICLPGKKLLFMGGEFGQYGEWSPD
FT                   RPLDWELLNHHYHKTLRNCVSALNALYIHQPYLWMQESSQECFHWVDFHDIENNVIAYY
FT                   RFAGSNRSSALLCVHHFSASTFPSYVLRCEGVKHCELLLNTDDESFGGSGKGNRAPVVC
FT                   QDQGVAWGLDIELPPLATVIYLVTFF"
FT   gene            complement(553855..554844)
FT                   /locus_tag="CPn_0476"
FT   CDS_pept        complement(553855..554844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0476"
FT                   /product="CT865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18616"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z875"
FT                   /protein_id="AAD18616.1"
FT                   /translation="MIDIMQHFKPYTMVPGQKLPIPGSLLYAQVFPTLWRLFSSKHEIL
FT                   NEQTLQVQGPLKRFAVFQDLHRGGLAVTSERYKYYLLPSGECTQSIKGKLPSAAQAGPL
FT                   LSLGVHKHADWQKVRCRRDLKEILPLWFRFAAMAPKGSYRDLETTAIGSLVKTAHQRVL
FT                   HRETTEIAPALLSIALAGFSECFLPRSYDEEFQGILPQDGDPEGGVPFELLSYSFGMIQ
FT                   DIFLRHQGQLVEILPALPPEFPCGRLIHVALPNLGTLSIVWTKKTIRQVELHAEYSGEV
FT                   FLKFCSSLCSARLREWSERRLSGSKRLSLGETLEIKAGTTYLWDCFHK"
FT   gene            complement(554841..556106)
FT                   /gene="yqeV"
FT                   /locus_tag="CPn_0477"
FT   CDS_pept        complement(554841..556106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqeV"
FT                   /locus_tag="CPn_0477"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18617"
FT                   /db_xref="GOA:Q9Z874"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z874"
FT                   /protein_id="AAD18617.1"
FT                   /translation="MTVAEVKGTFKLVCLGCRVNQYEVQAYRDQLTILGYQEVLDSEIP
FT                   ADLCIINTCAVTASAESSGRHAVRQLCRQNPTAHIVVTGCLGESDKEFFASLDRQCTLV
FT                   SNKEKSRLIEKIFSYDTTFPEFKIHSFEGKSRAFIKVQDGCNSFCSYCIIPYLRGRSVS
FT                   RPAEKILAEIAGVVDQGYREVVIAGINVGDYCDGERSLASLIEQVDRIPGIERIRISSI
FT                   DPDDITEDLHRAITSSRHTCPSSHLVLQSGSNSILKRMNRKYSRGDFLDCVEKFRASDP
FT                   RYAFTTDVIVGFPGESDQDFEDTLRIIEDVGFIKVHSFPFSARRRTKAYTFDNQIPNQV
FT                   IYERKKYLAEVAKRVGQKEMMKRLGETTEVLVEKVTGQVATGHSPYFEKVSFPVVGTVA
FT                   INTLVSVRLDRVEEEGLIGEIV"
FT   gene            complement(556207..557625)
FT                   /gene="hflX"
FT                   /locus_tag="CPn_0478"
FT   CDS_pept        complement(556207..557625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="CPn_0478"
FT                   /product="GTP Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18618"
FT                   /db_xref="GOA:Q9Z873"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z873"
FT                   /protein_id="AAD18618.1"
FT                   /translation="MDTIDTPGEQGSQSFGNSLGARFDLPRKEQDPSQALAVASYQNKT
FT                   DSQVVEEHLDELISLADSCGISVLETRSWILKTPSASTYINVGKLEEIEEILKEFPSIG
FT                   TLIIDEEITPSQQRNLEKRLGLVVLDRTELILEIFSSRALTAEANIQVQLAQARYLLPR
FT                   LKRLWGHLSRQKSGGGSGGFVKGEGEKQIELDRRMVRERIHKLSAQLKAVIKQRAERRK
FT                   VKSRRGIPTFALIGYTNSGKSTLLNLLTAADTYVEDKLFATLDPKTRKCVLPGGRHVLL
FT                   TDTVGFIRKLPHTLVAAFKSTLEAAFHEDVLLHVVDASHPLALEHVQTTYDLFQELKIE
FT                   KPRIITVLNKVDRLPQGSIPMKLRLLSPLPVLISAKTGEGIQNLLSLMTEIIQEKSLHV
FT                   TLNFPYTEYGKFTELCDAGVVASSRYQEDFLVVEAYLPKELQKKFRPFISYVFPEDCGD
FT                   DEGRGPVLESSFGD"
FT   gene            complement(557613..558425)
FT                   /gene="phnP"
FT                   /locus_tag="CPn_0479"
FT   CDS_pept        complement(557613..558425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnP"
FT                   /locus_tag="CPn_0479"
FT                   /product="Metal Dependent Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18619"
FT                   /db_xref="GOA:Q9Z872"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z872"
FT                   /protein_id="AAD18619.1"
FT                   /translation="MVRDIQSESIGKLVFLGTGNPEGIPVPFCSCRVCQNTGIHRLRSS
FT                   VLIQYQNKTLVIDAGPDFRTQMLVAGVSELDGVFLTHPHYDHIGGIDDLRAWYIVTQRS
FT                   LPLVLSASTYRFLNKAKEYLFATPNVESSLPAVLEFTILNEDCGQEEFQGIPYTYVSYY
FT                   QKSCHVTGFRFGNLAYLTDLCSYDAKIFSYLDNVETLILSAGPSETPIPFQGHKSSHLT
FT                   VEEAKAFANHAGIKNLIITHISHCLEAERDQHPEVTFAYDGMEVLWTL"
FT   gene            complement(558647..559303)
FT                   /locus_tag="CPn_0480"
FT   CDS_pept        complement(558647..559303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0480"
FT                   /product="CT383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18620"
FT                   /db_xref="GOA:Q9Z871"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z871"
FT                   /protein_id="AAD18620.1"
FT                   /translation="MLGSLPCYPGAGNIEEYKNRYFYCQLCAEVVSPYVVPVIVVDVQG
FT                   APPTGILQVLRCKQHKFQGLPVHGPITSLWALEPVGKGAPQLESAMYELCSQVRNFDIC
FT                   SIVSWVFGGLCIFAGLIVGVMVEAPLIAGLSAWVIPCIIGGVGAILCLFAILMAYLGRG
FT                   RVREWLNLSHEYITQCHCRQIQAHSQNYSVITEYPATCALSQPITKLPNGSRRDN"
FT   gene            complement(559336..560946)
FT                   /locus_tag="CPn_0481"
FT   CDS_pept        complement(559336..560946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18621"
FT                   /db_xref="GOA:A0A0F7XBY3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XBY3"
FT                   /protein_id="AAD18621.1"
FT                   /translation="MATSVPVTSSTSVGEANSSNERFTERTSRMYYAALVLGALSCLIF
FT                   IAMIVIFPQVGLWAVVLGFALGCLLLSLAIVFAVSGLVLGKTLEPSREATPPEIVAQKE
FT                   WTTQQDVLGNEYWRSELISLFLRGDLHESLIVDSKDRSLDIDQSLQNILKLEPLSTTLS
FT                   LLKKDCVHINIILHLVRQWNLLGVDLSPEVTAHAEELLLFLIEEQYYSPDILKLIRYGD
FT                   ALQATSPLMDWADSGSFSVDADGVFSCRREECSPEDALAQFDLLLALENPDRRFLKDSF
FT                   LTYIWSSSFFEKFLHRHLESLQRKLPETAIDVARYEAQIQTFLSRYFQKLDLINAMSLD
FT                   WGYNCAEGEKCYESANQRLDNLFIAFSSSVPAMKRLFDKYGSVVRVDRRQIREQILSNT
FT                   EILENESGFLCSLYEYPLSYLIDWAVLLDCVRGTEISLEDQADYTVCLQGLDSMLSQFA
FT                   SRLQSGQKVLNPRDVLSEQAAVMLVHGLAAQGVSFQGLKALMYLTAVPQRMWLGALPLF
FT                   ESFPVFNRMKEFLGESLGD"
FT   gene            complement(560958..561737)
FT                   /gene="artJ"
FT                   /locus_tag="CPn_0482"
FT   CDS_pept        complement(560958..561737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artJ"
FT                   /locus_tag="CPn_0482"
FT                   /product="Arginine Periplasmic Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18622"
FT                   /db_xref="GOA:Q9Z869"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR037297"
FT                   /db_xref="PDB:3N26"
FT                   /db_xref="PDB:3QAX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z869"
FT                   /protein_id="AAD18622.1"
FT                   /translation="MIKQIGRFFRAFIFIMPLSLTSCESKIDRNRIWIVGTNATYPPFE
FT                   YVDAQGEVVGFDIDLAKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSITPSR
FT                   QKEIALLPYYGDEVQELMVVSKRSLETPVLPLTQYSSVAVQTGTFQEHYLLSQPGICVR
FT                   SFDSTLEVIMEVRYGKSPVAVLEPSVGRVVLKDFPNLVATRLELPPECWVLGCGLGVAK
FT                   DRPEEIQTIQQAITDLKSEGVIQSLTKKWQLSEVAYE"
FT   gene            561836..564967
FT                   /locus_tag="CPn_0483"
FT   CDS_pept        561836..564967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18623"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR019400"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z868"
FT                   /protein_id="AAD18623.1"
FT                   /translation="MIKKRAIFERMFPIPPPHCPPNNKNNFYHLTTDTKDPLLLRILRT
FT                   IGYVLLHIITLGLLLLIHYYKHHRVVRKEGLPTPPTLPKGPEPKTIEIAKQPPKDGEDK
FT                   KPDVPKPGTPPPEDTPPPPPKAPSPASPKVPKQPADKKPTPPPEAPPPPVRVATPMPLR
FT                   PSSQGYWQCLNRMVSMVLRRAPLPLPAMQVDPILGDFNPHFVASYPNRIDNEPMYFQIK
FT                   QFKKIAQNPDLPQQHRRLAQLSLEQALYLNDNYYLVNVPGDGNCFYRAYAVGWLSALYE
FT                   ESSRNDIVFEQEATRLLDLPFASSSPANANLCAEMAELLQLCSTYCSFIDLYDGVILSQ
FT                   KHTATLIAFLRKLSAYAIRQQIAASSNEETARALFISDMQDDLLPSVLEFLAANRPYSE
FT                   LFQNLIDHSALPYMQSRDKLFLLLEHLPALFLTDAELQKMSPEDQQLRKQYEREIREAF
FT                   AKLSRRIADSGWDTERFNAIVKDHLPEAIRCQYSRFLATIENRRSGDLPWSPALSFFAF
FT                   LCTCPSVRFHKLCATFYKSLEDIIIASAPPQRSIQEILQISNASLSYLNEDLDSSWQRE
FT                   VISSNIMTILTTHESLTLESSMPQLETLHKRIANLLKNVISTSFETPPLSNQPDLLSNL
FT                   VNKLLVAIHSKLELKEHFNTVCSARSLRLTRDEGSGLSQEQDLLYTQAVQLLFFILQHP
FT                   QVNNRPETKDAVKELKMLLLPFLQYAFKKVENEKKLQKLLRSILGSLVLKPPARYPSTP
FT                   SNKDKETFCKFWSRHPEVMVLDPILEKNCMQFLRATFPNYQLETEAILLEKEIESTFRN
FT                   GWNVFLTRLNLFGSKLGSPSSPTALSDQFSKSFLIFCFLNNYPKLLQKKTPLAARLDAF
FT                   QREASHRFTQVKDKLLLSLKYGFPLATATINQYSRARDQLICNLLKNTVTASDGFCRSG
FT                   FRQSLIGYLHSLSSNELGDILDDVKEQAEANDVAAMTTVPLQPFAVCLIMSDRDTVSEE
FT                   NIENFVAMHGFLNTISPERDARIFLIRFPNHYGCLLPRNPRTEDQNSKPDSSNP"
FT   gene            564970..565827
FT                   /gene="aroG"
FT                   /locus_tag="CPn_0484"
FT   CDS_pept        564970..565827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="CPn_0484"
FT                   /product="Deoxyheptonate Aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18624"
FT                   /db_xref="GOA:Q9Z867"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z867"
FT                   /protein_id="AAD18624.1"
FT                   /translation="MHEVLILTFTYPLPRTLKQHPDEVHTVPISPNLSFGEGSPILIAG
FT                   PCTLESYEHTVSSALTVKEAGAQVFRGSIRKPRTSPFSFQGWEKECVLWHKEAQSIHGL
FT                   PTETEVLDVRDVEITAEHVDILRIGAKNMHNTPLLQEVSKSHRPIILKRSPAATLEEWL
FT                   CAAEYILASSPSCPGVILCERGIRTFEHSTRYTLDLNTVALLKEISSLPVIVDPSHAAG
FT                   KRSLVLPLASAGLSVGADGLMIEVHAHPEKALCDAKQQITPEELHLFAKKHFCPSESRA
FT                   HAIS"
FT   gene            566038..566232
FT                   /locus_tag="CPn_0485"
FT   CDS_pept        566038..566232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0485"
FT                   /product="CT382.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z866"
FT                   /protein_id="AAD18625.1"
FT                   /translation="MIKQACKFYLLQCLLCALYWLLKYCRKLLKGTLHHSEETLYQALL
FT                   SSLIDLLYQLKQLPAPTNE"
FT   gene            complement(566402..567784)
FT                   /locus_tag="CPn_0486"
FT   CDS_pept        complement(566402..567784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0486"
FT                   /product="hypothetical proline permease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18626"
FT                   /db_xref="GOA:A0A0F7X2I4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X2I4"
FT                   /protein_id="AAD18626.1"
FT                   /translation="MLKGNIFHLGCGVLYFMNFSLFLFFLIAIQGICLYVGRRGSKKVE
FT                   DRESYFLAGRSLKIFPLMMTFIATQIGGGVLLGAAEEAFCYGYGGILYPLGVALGLIFL
FT                   GMGPGKRLAEGSLTTVVSIFEVFYGSKKLRKIAFLLSAGSLFFILVAQVIALDRLFSSF
FT                   PFGKYVTVAFWIVLASYTSTGGFRGVVRTDVIQAGFLLIAVLVCGVSVWLSVPKSLSVL
FT                   DPFQSLPCAKLSNWIFMPMLFMLVEQDMVQRCVAASSPKRLQWAAVGAGLVLLLFNFIP
FT                   LFLGSLGAKAGLKAGCPLIDTIAYFCNPSLAAVMAAAIGVAILSTADSLMNAVSQLIAE
FT                   EYPTLKAPYYRYLVLGLAVAAPLVAIGFTNIVDVLILSYSLSVCCLSVPVGFYLLAPKG
FT                   RRVSGAAAWAGVLVGALGYGWVQIVSLGMFGELLAWVGSLVAFSFVGFIEITWKNKVKT
FT                   QT"
FT   gene            complement(568109..569740)
FT                   /locus_tag="CPn_0487"
FT   CDS_pept        complement(568109..569740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0487"
FT                   /product="CT384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18627"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z864"
FT                   /protein_id="AAD18627.1"
FT                   /translation="MFGSESLRYQLLIQDFAKVSEEGIGLLESKEYSLLQAKLVLRALA
FT                   QNSSFDDWFRSFKKCQISYPELAHDRDVLEEFGIQVLREGIENPSVTVRAVSVLAIGLA
FT                   RDFRLVPLLLQSCNDDSAIVRSLALQVAVNYGSESLKKAIVELARNDDSIHVRITAYQV
FT                   VALLQIEELLPFLRERAENKLVDSVERREAWKACLELSSQFLETGVAKDDIDQALFTCE
FT                   VLRNGMLPETTEIFTELLSVEHPEVQESLLLSALAWSHQLQNHKEFLSKVRHVMCTSPF
FT                   AKVRFQAAALLHLHGDPLGRDSLVEGLRSPQPLVCEAASAALCSLGIHGVPLAKEHLES
FT                   LSSRKAAANLSILLLVSREDIERAGDVIARYLSNPEMCWAIEYFLWDAQWNLRGDTFPL
FT                   YSDMIKREIGRKLIRLLAVARYSQAKAVTATFLSGQQAQGWSFFSGMFWEEGDVKTSED
FT                   LVTDACFAAKLEGALASLCQKKDQASLQRVSQLYNDSRWQDKLAILESVAFSENLDAVP
FT                   FLLDCCHHEAPSLRSAAAGALFSIFK"
FT   gene            complement(569764..570096)
FT                   /gene="ycfF"
FT                   /locus_tag="CPn_0488"
FT   CDS_pept        complement(569764..570096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfF"
FT                   /locus_tag="CPn_0488"
FT                   /product="HIT Family Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18628"
FT                   /db_xref="GOA:Q9Z863"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z863"
FT                   /protein_id="AAD18628.1"
FT                   /translation="MTVFKQIIDGLIDCEKVFENENFIAIKDRFPQAPVHLLIIPKKPI
FT                   PRFQDIPGDEMILMAEAGKIVQELAAEFGIADGYRVVINNGAEGGQAVFHLHIHLLGGR
FT                   PLGAIA"
FT   gene            complement(570093..570965)
FT                   /locus_tag="CPn_0489"
FT   CDS_pept        complement(570093..570965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0489"
FT                   /product="CT386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18629"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z862"
FT                   /protein_id="AAD18629.1"
FT                   /translation="MQIPRSIGTHDGSFHADEVTACALLIIFDLVDENKIIRSRDPVVL
FT                   SKCEYVCDVGGVYSIENKRFDHHQVSYDGSWSSAGMILHYLKEFGYMDCEEYHFLNNTL
FT                   VHGVDEQDNGRFFSKEGFCSFSDIIKIYNPREEEETNSDADFSCALHFTIDFLCRLRKK
FT                   FQYDRVCRGIVREAMETEDMCLYFDRPLAWQENFFFLGGEKHPAAFVCFPSCDQWILRG
FT                   IPPNLDRRMDVRVPFPENWAGLLGKELSKVSGIPGAVFCHKGLFLSVWTNRESCQRALR
FT                   LTLQDRGII"
FT   gene            571279..573336
FT                   /locus_tag="CPn_0490"
FT   CDS_pept        571279..573336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0490"
FT                   /product="CT387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18630"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z861"
FT                   /protein_id="AAD18630.1"
FT                   /translation="MYNLLHAHHDAASPDGRLVSHLKKLSPHIYEGEVLIENIPAYFLG
FT                   FHLPQQCIQVNLKSSLAQLGVEAVLNHLELNKARKEARLHVLFMSQDPIATAMLELLEP
FT                   GSFVCKLFAADDRRLVRSPCYLNRMFTHTDRTGSPLLRFGKKLEHFITLEIINDRLVVF
FT                   LPILPGTICYEETIYGFLPLMSKSLTRPHLKIRKFLPLYQMVTDRPPVPEDHKILLIKT
FT                   EPLHIRTVFARVVQDLLPQGLRHTAADILEPTTQESGDIYEFYGSTSEPIERIPLEFFT
FT                   LEPYKEHSFFFYRDMLQETLESPQEVFRVFESIPEGEDQAAMFISKGSELLELSQDSWI
FT                   IKPRISPSDERHAREIQKHIEDQPCFPFLKAMETDHITSQGVLFSRYFPSASLKGMFLS
FT                   NYSRYYLQHIYFQIPSPTSGEFFSNRDRSFLLDLYFAGISVFWADLESKRLLQYIKRRN
FT                   KDVGMFVPKHQAEQFAQSYFIGIHGSCLIAGDYDEFLRELLTGMHTLSQQFTIPEFPPQ
FT                   TPLAILTGGGSGAMELANRVATELSILSCGNLISLDTTNAYVEAKMSYAIPDLLERQAD
FT                   FHVDLAVFVIGGMGTDFELLLELISLKTGKKALVPVFLIGPVDYWKSKITALYNSNHAV
FT                   GTIRGSEWVHNCLFCLSSAKAGIAIFRRYLNHTLPIGPEHPVPEDGFVIV"
FT   gene            complement(573333..574352)
FT                   /locus_tag="CPn_0491"
FT   CDS_pept        complement(573333..574352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0491"
FT                   /product="CT389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18631"
FT                   /db_xref="InterPro:IPR009599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULT3"
FT                   /protein_id="AAD18631.1"
FT                   /translation="MHFLDSRTQVVIEKNRAYLFSLPVDSSLSEAITNFVRDLPFICAV
FT                   EICERPYGECITRSSAERPLLPKEKTLGMPIFCGKEGVWLPQNTILFSPLIADPRQVTN
FT                   SAGIRFNEKVVGNRVGATIFGGDFILLRLFDVSRFHVDCDFGIQGGVFSVFDLDHPESC
FT                   MVNSDFFVAGLWSGAIDKWSFRFRLWHLSSHLGDEFILTHPNFPRFNLSDEGVDLFISF
FT                   RYTPQIRLYGGCGYIVSRDLTFPERPFYCEWGAELRPFGLREGNLHAQPIFAMHFRCWE
FT                   EQKFGLDQSYILGMEWAKFQEIGRKIRAVLEYHQGFSKEGQFIREPCNYYGFRLTYGF"
FT   gene            574652..574807
FT                   /locus_tag="CPn_0492"
FT   CDS_pept        574652..574807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18632"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z859"
FT                   /protein_id="AAD18632.1"
FT                   /translation="MIFPICEERNSQQTYKHLHVESACFLLESPLKIHWSSPYGFPPFY
FT                   RRDLKL"
FT   gene            complement(574852..575004)
FT                   /locus_tag="CPn_0493"
FT   CDS_pept        complement(574852..575004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18633"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z858"
FT                   /protein_id="AAD18633.1"
FT                   /translation="MRTYTRSPKQSGVERKQEDAETSFIETPKGILKKPGNKDPKGKHV
FT                   HWKDS"
FT   gene            complement(575143..575364)
FT                   /locus_tag="CPn_0494"
FT   CDS_pept        complement(575143..575364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18634"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z857"
FT                   /protein_id="AAD18634.1"
FT                   /translation="MIRVNPYGSYRGRNPSPEDGKKDVPLSGNSRLHRRGGIRRKHKSA
FT                   SVGVTSGSKTGKASLEKKVKGISEAHFK"
FT   gene            575603..576796
FT                   /gene="aspC"
FT                   /locus_tag="CPn_0495"
FT   CDS_pept        575603..576796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="CPn_0495"
FT                   /product="Aspartate Aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18635"
FT                   /db_xref="GOA:Q9Z856"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z856"
FT                   /protein_id="AAD18635.1"
FT                   /translation="MRRNPHFSLLKPQYLFSEISKKLAQFRKENPEISVIDLSIGDTTQ
FT                   PLCRSITQAIKEFCVSQEKQETYRGYGPETGLEKLRTKIASEVYENRISPEEIFISDGA
FT                   KPDIFRLFSFFGSEKTLGLQDPVYPAYRDIAHITGIRDIIPLACRKETGFIPELPNQQS
FT                   LDILCLCYPNNPTGTVLTFQQLQALVNYANQHGTVLIFDAAYSAFVSDPSLPKSIFEIP
FT                   EAKYCAIEINSFSKSLGFTGMRLAWNVIPKELTYDNNEPMINDWKRLFATTFNGASLLM
FT                   QEAGYYGLDLFPTPPAISLYLTNAQKLKKSLETAGFSVHGGDHAPYLWVELPEGISDEE
FT                   AFDFFLHQYHIAVTPGHGFGSCGQGFVRFSALTQPQNIALACDRLCTASLKETMVLA"
FT   gene            576793..577815
FT                   /locus_tag="CPn_0496"
FT   CDS_pept        576793..577815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0496"
FT                   /product="CT391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18636"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WZI0"
FT                   /protein_id="AAD18636.1"
FT                   /translation="MTILRKLSQYLFFFSLFCSFIYVATCGSQPDSVSSPKIAIFLSFP
FT                   HPLLEDCSKSCIETLKDFENLPEIVVLNAEDSIVKARKIARSLHTDKNVVAIVTLGTIA
FT                   TKVMSHIETQKPVIYAAVPDRESLTLPKNTMNIYGVNDTLDINQYCFAIQAVATNAQSI
FT                   VYLKPSEPFPSDLQKEIVKKLHASGIEVIEISITSSTFKTRIRQAIDKRPSAIFIPLSP
FT                   LSHKEGTAFLQEILKEKIPIITDDTSLISEGACIACSVDYKKSGKQIAKIVHHLLYNNH
FT                   DVDSLRKIIAQRLSPTTTFNEDIIKYLGIKLHKTERNQFLSFKSKKLEKSEKGKNVAVS
FT                   "
FT   gene            complement(577817..578089)
FT                   /locus_tag="CPn_0497"
FT   CDS_pept        complement(577817..578089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0497"
FT                   /product="CT388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18637"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z854"
FT                   /protein_id="AAD18637.1"
FT                   /translation="MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAV
FT                   ISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRVQDIIFSLHIDV"
FT   gene            complement(578082..579035)
FT                   /locus_tag="CPn_0498"
FT   CDS_pept        complement(578082..579035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18638"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z853"
FT                   /protein_id="AAD18638.1"
FT                   /translation="MNRRKARWVVALFAMTALISVGCCPWSQAKSRCSIDKYIPVVNRL
FT                   LEVCGLPEAENVEDLIESSSAWVLTPEERFSGELVSICQVKDEHAFYNDLSLLHMTQAV
FT                   PSYSATYDCAVVFGGPLPALRQRLDFLVREWQRGVRFKKIVFLCGERGRYQSIEEQEHF
FT                   FDSRYNPFPTEENWESGNRVTPSSEEEIAKFVWMQMLLPRAWRDSTSGVRVTFLLAKPE
FT                   ENRVVANRKDTLLLFRSYQEAFPGRVLFVSSQPFIGLDACRVGQFFKGESYDLAGPGFA
FT                   QGVLKYHWAPRICLHTLAEWLKETNGCLNISEGCFG"
FT   gene            complement(579202..580359)
FT                   /locus_tag="CPn_0499"
FT   CDS_pept        complement(579202..580359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18639"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z852"
FT                   /protein_id="AAD18639.1"
FT                   /translation="MSSVNQSSGTPNPEEVTSPESTEENKNVVSSDEAQATHAVALPIV
FT                   TQLSLPEGVGTSSEETASNPRVDEIVAEVSSSRAVADQISSLVERVGELLDDLKGAQSL
FT                   FTSFQSELKNCLPAWKSSTRRLETRGAGDNADIARLELFRSDYEAVLGHANQFHGKAHL
FT                   ILSKLTDVHHKLQGLSREDLSLAFDNNDRVLEHLGSLGLDVDAEGNWSLSCERGIPRLV
FT                   LTADSMLVQIKKVNLPTVEELRTLQGTTESSSDPRVEESLSCCERLLNELRRLWANFVG
FT                   FISSCYDNIVFVLMWIVRRINLLPGLGCLPFHNPDASQEDQRSSSGERSTRRERLSRRS
FT                   DLSEEEMIVRAEGESIHPESPHGDGRNQPSRGDKQDSDSEEETEL"
FT   gene            580659..582365
FT                   /gene="proS"
FT                   /locus_tag="CPn_0500"
FT   CDS_pept        580659..582365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="CPn_0500"
FT                   /product="Prolyl tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18640"
FT                   /db_xref="GOA:Q9Z851"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z851"
FT                   /protein_id="AAD18640.1"
FT                   /translation="MKTSQLFYKTSKNANKSAAVLSNELLEKAGYLFKVSKGVYTYTPL
FT                   LWRVVSKMMNIIREELNAIGGQELLLPLLHNAELWQHTGRWEAFTSEGLLYTLKDREGK
FT                   SHCLAPTHEEVICSFVAQWLSSKRQLPLHLYQIATKFRDEIRPRFGLIRSRELLMEDSY
FT                   TFSDSPEQMNEQYEKLRSAYSKIFDRLGLAYVIVTADGGKIGKGKSEEFQVLCSLGEDT
FT                   ICVSGSYGANIEAAVSIPPQHAYDREFLPVEEVATPGITTIEALANFFSIPLHKILKTL
FT                   VVKLSYSNEEKFIAIGMRGDRQVNLVKVASKLNADDIALASDEEIERVLGTEKGFIGPL
FT                   NCPIDFFADETTSPMTNFVCAGNAKDKHYVNVNWDRDLLPPQYGDFLLAEEGDTCPENP
FT                   GHPYRIYQGIEVAHIFNLGTRYTDSFEVNFQDEHGQTQQCWMGTYGIGVGRTLAACVEQ
FT                   LADDRGIVWPKALAPFSITIAFNGGDTVSQELAETIYHELQSQGYEPLLDDRDERLGFK
FT                   LKDSDLIGIPYKLILGKSYQSSGIFEIESRSGEKYTVSPEAFPTWCQNHLA"
FT   gene            582457..583653
FT                   /gene="hrcA"
FT                   /locus_tag="CPn_0501"
FT   CDS_pept        582457..583653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="CPn_0501"
FT                   /product="HTH Transcriptional Repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18641"
FT                   /db_xref="GOA:Q9Z850"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z850"
FT                   /protein_id="AAD18641.1"
FT                   /translation="MLSVTIVLVGLEMARSKVSKRDSKILDILFATTELYLKTGQPVGS
FT                   KTLKESFCSDLSTATIRNYFAELEAEGFLKKNHTSGGRIPTDLALRHYVDHQEECPEAE
FT                   ISAPIFDKISQLPSESRNIIKDLQKATELLGEILDLPTFFSSPRFENDSVTNIQITQVD
FT                   KQRAVTILSTEFGQIFTDTLWLPEACDTLSIKRIEKFLQNYIRKLPTNEELSKKEEHLS
FT                   MSLYNEVVVRYLTRYCNFSEEDLYQTGMSKLLKYEAFKDPEVLALGLSLFENRRQMCEL
FT                   LNIGMHKGRATAFIGKELSDILGTSNPGCSVITIPYYMNRSPLGALGILGPINLPYKEA
FT                   LPLLKLFANKINETLTQSFYKFKLSFRRPLTSNCKLSNEPILRTEYSSIKLLPSKETL"
FT   gene            583650..584204
FT                   /gene="grpE"
FT                   /locus_tag="CPn_0502"
FT   CDS_pept        583650..584204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="CPn_0502"
FT                   /product="HSP-70 Cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18642"
FT                   /db_xref="GOA:Q9Z849"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z849"
FT                   /protein_id="AAD18642.1"
FT                   /translation="MTDTPPENEEQHESNVQNENEVEHLQQEIVTLKTELKEKNDKYLM
FT                   ALAESENSRKRLQKERQELMQYALENTLIDFLNPIESMEKALGFATQMSDDVKNWALGF
FT                   NMILNQFKQIFEEKGIIEYSSIGQKFNPFLHEAVQTEETSEVPEGTILEEFAKGYKIGE
FT                   RPIRVAKVKVAKAPTPKENKE"
FT   gene            584234..586216
FT                   /gene="dnaK"
FT                   /locus_tag="CPn_0503"
FT   CDS_pept        584234..586216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="CPn_0503"
FT                   /product="Heat Shock Protein-70"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18643"
FT                   /db_xref="GOA:P27542"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27542"
FT                   /protein_id="AAD18643.1"
FT                   /translation="MSEHKKSSKIIGIDLGTTNSCVSVMEGGQAKVITSSEGTRTTPSI
FT                   VAFKGNEKLVGIPAKRQAVTNPEKTLGSTKRFIGRKYSEVASEIQTVPYTVTSGSKGDA
FT                   VFEVDGKQYTPEEIGAQILMKMKETAEAYLGETVTEAVITVPAYFNDSQRASTKDAGRI
FT                   AGLDVKRIIPEPTAAALAYGIDKVGDKKIAVFDLGGGTFDISILEIGDGVFEVLSTNGD
FT                   TLLGGDDFDEVIIKWMIEEFKKQEGIDLSKDNMALQRLKDAAEKAKIELSGVSSTEINQ
FT                   PFITMDAQGPKHLALTLTRAQFEKLAASLIERTKSPCIKALSDAKLSAKDIDDVLLVGG
FT                   MSRMPAVQETVKELFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGI
FT                   ETLGGVMTTLVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLT
FT                   DIPPAPRGHPQIEVSFDIDANGIFHVSAKDVASGKEQKIRIEASSGLQEDEIQRMVRDA
FT                   EINKEEDKKRREASDAKNEADSMIFRAEKAIKDYKEQIPETLVKEIEERIENVRNALKD
FT                   DAPIEKIKEVTEDLSKHMQKIGESMQSQSASAAASSAANAKGGPNINTEDLKKHSFSTK
FT                   PPSNNGSSEDHIEEADVEIIDNDDK"
FT   gene            586487..588517
FT                   /gene="vacB"
FT                   /locus_tag="CPn_0504"
FT   CDS_pept        586487..588517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="CPn_0504"
FT                   /product="ribonuclease family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18644"
FT                   /db_xref="GOA:Q9Z848"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z848"
FT                   /protein_id="AAD18644.1"
FT                   /translation="MLKKPKRKPGRRTYGKSLKIFIPGTLFVHARKGFGFVSPDNPEEY
FT                   PFDIFVPARDLRGALDGDHVIVSVLPYPRDGQKLKGTISEVLARGKTTLVGTITSLVSP
FT                   TSALAYTSMSGSQSLIPVELLPGRTYKIGDRILLSTPPWVDKPQEGASPALQMLEFIGH
FT                   ITNAKADFQAIQAEYNLAEEFPPEVIEEASLFSQKHITQVLHSRKDLRDLLCFTIDSST
FT                   ARDFDDAISLTYDHNNNYILGVHIADVSHYVTPHSHLDKEAAKRCNSTYFPGKVIPMLP
FT                   SALSDNLCSLKPNVDRLAVSVFMTFTKSGHLSDYQIFRSVIRSKYRMTYDEVDNIIEKK
FT                   HSHPLSKILNEMATLSKKFSDIREERGCIRFVLPSVTMSLDNLQEPVALIENHQTFSHK
FT                   LIEEFMLKANEVVAYHISHQGVSLPFRSHEPPNDENLLAFQELAKNMGFDITFTPTQEP
FT                   DYQYLLQTTSAGHPLEQVLHSQFVRSMKTASYSTENKGHYGLKLDYYTHFTSPIRRYID
FT                   LIVHRLLFNPLSIDQTHLEIIVRACSTKERVSAKAENSFENLKKTRFINKFLQEQPKTT
FT                   YHAYIITANHEGLSFVVTEFCHEGFIAAAELPKEYSLKKNALPESIPDKMKPGASIKVT
FT                   IDSVNLLTQKIVWSIATTTEDKPKKIKKTPSKKKGTKKRAS"
FT   gene            588519..589109
FT                   /locus_tag="CPn_0505"
FT   CDS_pept        588519..589109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0505"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18645"
FT                   /db_xref="GOA:Q9Z847"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z847"
FT                   /protein_id="AAD18645.1"
FT                   /translation="MLQEHFFLSEDVITLAQQLLGHKLITTHEGLITSGYIVETEAYRG
FT                   PDDKACHAYNYRKTQRNRAMYLKGGSAYLYRCYGMHHLLNVVTGPEDIPHAVLIRAILP
FT                   DQGKELMIQRRQWRDKPPHLLTNGPGKVCQALGISLENNRQRLNTPALYISKEKISGTL
FT                   TATARIGIDYAQEYRDVPWRFLLSPEDSGKVLS"
FT   gene            589172..589843
FT                   /locus_tag="CPn_0506"
FT   CDS_pept        589172..589843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0506"
FT                   /product="CT421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18646"
FT                   /db_xref="GOA:A0A0H2ULW1"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULW1"
FT                   /protein_id="AAD18646.1"
FT                   /translation="MKKYFITGLVILLPLAITIAIVTMIMNFLTQPFVGLASEFFEKFS
FT                   FYTKHRALLKFVLQIILLFGLFFATVLLGFLTRIMIFKSLLSIYDKILHRIPIIKTVYK
FT                   AAQQVMTTIFGSKSGSFKQVVMVPFPNANVQCIGLVAGDAPTVCCTGEKEDDPLVTVFI
FT                   PTTPNPTSGFLTLFRKSDIVFLDMKIEDAFKYIISCGVLSTPMACPSSPLPDELHQDQG
FT                   S"
FT   gene            589961..590125
FT                   /locus_tag="CPn_0507"
FT   CDS_pept        589961..590125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0507"
FT                   /product="CT421.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18647"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULS4"
FT                   /protein_id="AAD18647.1"
FT                   /translation="MTRMSKQARRRAKSPKKRKPKYAIVHPAPAPRIVYKLHTNALSTS
FT                   DSIFIPKIG"
FT   gene            590142..590303
FT                   /locus_tag="CPn_0508"
FT   CDS_pept        590142..590303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0508"
FT                   /product="CT421.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18648"
FT                   /db_xref="InterPro:IPR026405"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z844"
FT                   /protein_id="AAD18648.1"
FT                   /translation="MSRHRSYGKSVKGVTKRNVLKRFERVEVLRKLGRWNDSTAKKVTG
FT                   LPKTPILK"
FT   gene            590335..590811
FT                   /locus_tag="CPn_0509"
FT   CDS_pept        590335..590811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0509"
FT                   /product="predicted Metalloenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18649"
FT                   /db_xref="GOA:Q9Z843"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z843"
FT                   /protein_id="AAD18649.1"
FT                   /translation="MTQEKIKIHVSNEQTCIPIHLVSVEKLVLTLLEHLKVTTNEIFIY
FT                   FLEDKALAELHDKVFADPSLTDTITLPIDAPGDPAYPHVLGEAFISPQAALRFLENTSP
FT                   NQEDIYEEISRYLVHSILHMLGYDDTSSEEKRKMRVKENQILCMLRKKHALLTA"
FT   gene            590813..591976
FT                   /gene="tlyC_2"
FT                   /locus_tag="CPn_0510"
FT   CDS_pept        590813..591976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyC_2"
FT                   /locus_tag="CPn_0510"
FT                   /product="Hemolysin-like protein"
FT                   /note="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18650"
FT                   /db_xref="GOA:Q9Z842"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z842"
FT                   /protein_id="AAD18650.1"
FT                   /translation="MLHILLAIFCILLFLAFGLTQPSCHGSSKFLKTLNQRFFKDKGRE
FT                   YPPFPSAPTILATLLCILYGALGTKLYTLLPPKTAHKDLLFWPLYSLSALIAYGFLPPW
FT                   ISTKVPKETTAHLRFLASVFQLGLFPLQLLFYRRRPNQQVRSSTSFQSQLSEALSAFDN
FT                   LIVREVMIPKVDIFALPEETTLQEALVLVSEEGYSRVPVYKKNLDNITGILLVKDLLLL
FT                   YTSSHDLSQPISSVAKPPFYAPEIKKASSLLQEFRQKHRHLAIIVNEYGFTEGIATMED
FT                   IIEEIIGEIADEHDVQENTPYKKIGSSWIVDGRMNISDAEEYFNLKIDHENSYDTLGGH
FT                   VFHKVGAVPQKGMRIHHENFDIEIITCTERNVGKLKITPRKRKFNIS"
FT   gene            592141..592491
FT                   /gene="rsbV_1"
FT                   /locus_tag="CPn_0511"
FT   CDS_pept        592141..592491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV_1"
FT                   /locus_tag="CPn_0511"
FT                   /product="Sigma Regulatory Factor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18651"
FT                   /db_xref="GOA:Q9Z841"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z841"
FT                   /protein_id="AAD18651.1"
FT                   /translation="MSDIQKEEHGSTTIFHLHGKLDGISSPEVQENISQSLAAGSKNII
FT                   LDCAHLDYMSSAGIRVLLQSYHQVGQHSGKIVLTTVPKTIEQTLYVTGFLSYFKIFNTV
FT                   DEAIQTLNKDGD"
FT   gene            592553..594415
FT                   /locus_tag="CPn_0512"
FT   CDS_pept        592553..594415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0512"
FT                   /product="CT425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18652"
FT                   /db_xref="InterPro:IPR022028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z840"
FT                   /protein_id="AAD18652.1"
FT                   /translation="MRRSVCYVNPSIARAGQISTWKFLYSLATPLPAGTKCKFDLAGSG
FT                   KPTDWEAPATDLSQTRNVIYAEMPEGEIIEATAIPVKDNPVPQFEFTLPYELQVGETLT
FT                   IVMGASPNHPQVDDAGNGAQLFAQRRKPFYLYIDPTGEGNYDEPDVFSMDIRGNVLKKI
FT                   EIFTPSYVVKNKRFDITVRFEDEFGNLTNFSPEETRIELSYEHLRENLNWQLFIPETGF
FT                   VILPNLYFNEPGIYRIQLKNLSTQEIFISAPIKCFADSAPNLMWGLLHGESERVDSEEN
FT                   IETCMRYFRDDRALNFYASSSFENQENLSPDIWKLINQTVSDFNEEDRFITLSGFQYSG
FT                   EPHLEGVRHILHTKETKSHSKHKEYKHIPLAKLYKSTVNHDMISIPSFTASKEHGFDFE
FT                   NFYPEFERVVEIYNAWGSSETTAALNNPFPIQGKDSEDPRGTVIEGLKKNLRFGFVAGG
FT                   LDDRGIYKDYFDSPQVQYSPGLTAIICNKYTRESLVEALFARHCYATTGPRIVLSFNIT
FT                   SAPMGSELSTGSKPGLNVNRHISGHVAGTALLKTVEIIRNGEVLHTFFPDSNNLDYEYD
FT                   DMVPLSSVTLKDPNGKAPFVFYYLRVTQADNAMAWSSPIWVDLN"
FT   gene            594647..595756
FT                   /locus_tag="CPn_0513"
FT   CDS_pept        594647..595756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0513"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18653"
FT                   /db_xref="GOA:Q9Z839"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z839"
FT                   /protein_id="AAD18653.1"
FT                   /translation="MTTCLPQPPKTSPLYSIFEKLDAQERLSSEDALHLLLLTNKEDQR
FT                   TLWNFADQVRKQRVGDTVYYSSTLYLYPTNFCDFSCKFCSFYAKPGDPKGWLYSPDDLL
FT                   QQIQNIKTPITEVHIVGGCFPSCNLQYYSDLFTKIKEYDPQIHIKALTAIEYAYLSDLD
FT                   NLSIRDVLLTLKDAGLDSIPGGGAEILVDKIRNFLAPKRLSSSDFLNIHKMAHQLGIHS
FT                   NITMLCYHKEGPEDLVTHMVKVRDLQDETQGFKNFILLKFAQENNVLGKRLRKSGQGHA
FT                   IPLKSLMAVARIFLDNFSNMKALWNYLGIEAALDLLSCGANDLSSTHMGEKVFQMASSK
FT                   EPIKMDAEGMAALITQQGRTPCLTNSSHV"
FT   gene            595729..596523
FT                   /locus_tag="CPn_0514"
FT   CDS_pept        595729..596523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0514"
FT                   /product="CT427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18654"
FT                   /db_xref="GOA:A0A0F7WEN4"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WEN4"
FT                   /protein_id="AAD18654.1"
FT                   /translation="MSNQLQPCISLGCVSYINSFPLSLQLIKRNDIRCVLAPPADLLNL
FT                   LIEGKLDVALTSSLGAISHNLGYVPGFGIAANQRILSVNLYAAPTFFNSPQPRIAATLE
FT                   SRSSIGLLKVLCRHLWRIPTPHILRFITTKVLRQTPENYDGLLLIGDAALQHPVLPGFV
FT                   TYDLASGWYDLTKLPFVFALLLHSTSWKEHPLPNLAMEEALQQFESSPEEVLKEAHQHT
FT                   GLPPSLLQEYYALCQYRLGEEHYESFEKFREYYGTLYQQARL"
FT   gene            596492..597184
FT                   /gene="ubiE"
FT                   /locus_tag="CPn_0515"
FT   CDS_pept        596492..597184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="CPn_0515"
FT                   /product="Ubiquinone Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18655"
FT                   /db_xref="GOA:Q9K2B6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K2B6"
FT                   /protein_id="AAD18655.1"
FT                   /translation="MEPSTNKPDCKKIFDSIASKYDRTNTILSLGMHHFWNRSLIQILG
FT                   SGYSLLDLCAGTGKVAKRYIAAHPQASVTLVDFSSAMLDIAKQHLPQGSCSFIHSDINQ
FT                   LPLENHSYPLAAMAYGLRNLSDPHKALQEISRVLMPSGKLGILELTPPKKTHPTYSAHK
FT                   LYLRAVVPWIGKSVSKDPDAYSYLSKSIQQLPKDHDLEDLFSKSGFYIAKKKKLFLGAA
FT                   TIWLLEKQ"
FT   gene            complement(597252..598814)
FT                   /locus_tag="CPn_0516"
FT   CDS_pept        complement(597252..598814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WLR6"
FT                   /protein_id="AAD18656.1"
FT                   /translation="MVARGLCDFPTLVPNERLPIGPFFVPQHTSGAKGKEFAKRNFSII
FT                   SGLDDILKLCILQRRPFALQWDNLSVKSDYEEAGPAIGIRSLEPQVSQISPAHGRLCST
FT                   LVQWAPILGSEEQLVWLEETMKRLKFPKSLGSKDAVIVDSEMVPVNANPTQEIPAASET
FT                   VESSPVAPGNTTDTMPAASGTTDTTSGVSEAAAAEAAVDSTPGTEEEPSFSLRYALVVQ
FT                   NVPYPEPPKEPEVMFTDEEKSLILEATRARRMELDLYNGYLADYELSKDEIQKHVPDLP
FT                   ENWRTNWRWSERLYKFFFKTKKEGLEEIFLNKELGNMILARGLAATQSQARIKVFNSLV
FT                   AWLLQSFNVGRSCTAKPLPTSKLDLFKSEFESKPKNNILTEFLVASDEEILFKGLRVLE
FT                   PGIEGWYDHPDQAGEIRSVLEGLVQAGRISGYWENQPFGRFVLRGVGERRTELVELLES
FT                   LVASGEIMQFFESSDEEGAFIIDNEPSKTAMLKQRFKSCVRTKLVGSFADESLPRGRFT
FT                   ILV"
FT   gene            complement(598792..599631)
FT                   /locus_tag="CPn_0517"
FT   CDS_pept        complement(598792..599631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18657"
FT                   /db_xref="GOA:A0A0F7WUM2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WUM2"
FT                   /protein_id="AAD18657.1"
FT                   /translation="MSSLLSCGRIEPTRVTCSLKTYLEDTSQNQLSTRLVRASVIFLCA
FT                   LLIILVCVALSSLIPSIMALATSFTVMGLILFVMSLLGDVAIISYLTYSTVTSYRQNKR
FT                   AFEIHKPARSVYYEGVRHWDLGRSSLGTGEIPIVRTLFSPFQNHGLNHALAAKIFLFME
FT                   HFSPEPPNEPLVDWACLIRDFRPHVSSLCFVIEKQGSSLRTKEGNTICEAFRSDYDAHF
FT                   AMVDCYRLIHSKLIIEKMGLKNIDIIPSVMVREDYPSRPGEGYREGLLRMYGGKGAL"
FT   gene            complement(599829..600803)
FT                   /locus_tag="CPn_0518"
FT   CDS_pept        complement(599829..600803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0518"
FT                   /product="CT429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18658"
FT                   /db_xref="InterPro:IPR005361"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z834"
FT                   /protein_id="AAD18658.1"
FT                   /translation="MMTYPVPQNPLLLRILRLMDAFSKSDDERDFYLDRVEGFILYIDL
FT                   DKDQEDLNKIYQELEENAERYCLIPKLTFYEVKKIMETFINEKIYDIDTKEKFLEILQS
FT                   KNAREQFLEFIYDHEAELEKWQQFYVERSRIRIIEWLRNNKFHFVFEEDLDFTKNVLEQ
FT                   LKIHLFDAKVGKEITQARQLLSNKAKIYYSNEALNPRPKRGRPPKQSAKVETETTISSD
FT                   IYTKVPQAARRFLFLPEITSPSSITFSEKFDTEEEFLANLRGSTRVEDQLNLTNLSERF
FT                   ASLKELSAKLGYDSLSTGDFFGDDDEKVVTKTKGSKRGRKKSS"
FT   gene            complement(600901..601674)
FT                   /gene="dapF"
FT                   /locus_tag="CPn_0519"
FT   CDS_pept        complement(600901..601674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="CPn_0519"
FT                   /product="Diaminopimelate Epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18659"
FT                   /db_xref="GOA:Q9Z833"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z833"
FT                   /protein_id="AAD18659.1"
FT                   /translation="MAFYSPSTISKYFIYSGAGNRFLLGETLPEVEDVRFLCQETRVDG
FT                   FLYLKPSSCADAQLIIFNSDGSRPTMCGNGLRCAIAHLASQKGKSDISVSTDSGLYSGY
FT                   FYSWDRVLVDMTLADWRASVHRLESRPDPLPKEVVCIHTGVPHAVVILPEISTLDLSIL
FT                   GPFLRYHQTFSPDGVNVNFVQILGHCQLRVRTYERGVEGETAACGTGALASALVVSNSY
FT                   GWKESIQIHTWGGELMTVSQNRGRVYLQGSVTRDL"
FT   gene            complement(601643..602218)
FT                   /gene="clpP_1"
FT                   /locus_tag="CPn_0520"
FT   CDS_pept        complement(601643..602218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP_1"
FT                   /locus_tag="CPn_0520"
FT                   /product="CLP Protease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18660"
FT                   /db_xref="GOA:Q9Z832"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z832"
FT                   /protein_id="AAD18660.1"
FT                   /translation="MADGEVHKLRDIIEKELLEARRVFFSEPVTEKSASDAIKKLWYLE
FT                   LKDPGKPIVFVINSPGGSVDAGFAVWDQIKMLTSPVTTVVTGLAASMGSVLSLCAAPGR
FT                   RFATPHSRIMIHQPSIGGPITGQATDLDIHAREILKTKARIIDVYVEATNQPRDIIEKA
FT                   IDRDMWMTANEAKDFGLLDGILFSFNDL"
FT   gene            complement(602238..603797)
FT                   /gene="glyA"
FT                   /locus_tag="CPn_0521"
FT   CDS_pept        complement(602238..603797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="CPn_0521"
FT                   /product="Serine Hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18661"
FT                   /db_xref="GOA:Q9Z831"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z831"
FT                   /protein_id="AAD18661.1"
FT                   /translation="MLKVFEKFKKFAIVEIFTKVVAVVSLLHKFLENASGKKGQSLAST
FT                   AYLAALDHLLNAFPSIGERIIDELKSQRSHLKMIASENYSSLSVQLAMGNLLTDKYCEG
FT                   SPFKRFYSCCENVDAIEWECVETAKELFAADCACVQPHSGADANLLAVMAILTHKVQGP
FT                   AVSKLGYKTVNELTEEEYTLLKAEMSSCVCLGPSLNSGGHLTHGNVRLNVMSKLMRCFP
FT                   YDVNPDTECFDYAEISRLAKEYKPKVLIAGYSSYSRRLNFAVLKQIAEDCGSVLWVDMA
FT                   HFAGLVAGGVFVDEENPIPYADIVTTTTHKTLRGPRGGLVLATREYESTLNKACPLMMG
FT                   GPLPHVIAAKTVALKEALSVDFKKYAHQVVNNARRLAERFLSHGLRLLTGGTDNHMMVI
FT                   DLGSLGISGKIAEDILSSVGIAVNRNSLPSDAIGKWDTSGIRLGTPALTTLGMGIDEME
FT                   EVADIIVKVLRNIRLSCHVEGSSKKNKGELPEAIAQEARDRVRNLLLRFPLYPEIDLEA
FT                   LV"
FT   gene            603987..604658
FT                   /locus_tag="CPn_0522"
FT   CDS_pept        603987..604658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0522"
FT                   /product="CT433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18662"
FT                   /db_xref="GOA:Q9Z830"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z830"
FT                   /protein_id="AAD18662.1"
FT                   /translation="MTLYLGLNQKTARKYQAHYLPILTLFPYAKSTPQNKRALQFLPQA
FT                   THVILTSPSSTHLFLSRMTSLLSKATLKTKTYLCIGESTKERLLSFLGQVKYVVATQEI
FT                   AEGIFPLLQALPSSARILYPHSSLARPVIREFLYNRFTFFSYPHYTVKPRKLKKNILSK
FT                   YKKIIFTSPSTVRAFAKIFPRFPEKTYWCQGRMTLQEFQKFSSQKQVSLLETLGKSRTS
FT                   P"
FT   gene            604723..605055
FT                   /locus_tag="CPn_0523"
FT   CDS_pept        604723..605055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18663"
FT                   /db_xref="GOA:Q9Z829"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z829"
FT                   /protein_id="AAD18663.1"
FT                   /translation="MASSATPGFDGTAPSLFPPATRPRYNFKLALFVTIAIALVWIALI
FT                   ATTIAIGLCIHPLCSFIFLTAIPLYFISRYICSHYARNVYIALDVVPDHSKLQDMRSHS
FT                   PIFSDR"
FT   gene            605103..606182
FT                   /locus_tag="CPn_0524"
FT   CDS_pept        605103..606182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18664"
FT                   /db_xref="GOA:A0A0F7XXA0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XXA0"
FT                   /protein_id="AAD18664.1"
FT                   /translation="MSGPSRTESSQVSVLSYVPRDKEIAPKKQFTIAKISTLAILASLA
FT                   LGALVAGISLTIVLGNPVFLALLITTALFSVVTFLVYHQMTSKVSSNWQKVLEQNFKPL
FT                   GKAWQEKNVDCYSNEMQFYNNHLNPKFKVAIQTDASQPFQPTFLTGLRVIEKNQSTGII
FT                   FNPVGPTNLIDNTATNLSTILYSTLKDKSVWDTCKQREGGPAKGEDPFSPTEVRVVKLP
FT                   NEALDQTFNLNLSSAEKKSILPTFLGHVCGPKSEELPNQQEYYRQALLAYENCLKAAIE
FT                   SHAAIVALPLFTSVYEVPPEEILPKEGTFYWDNQTQAFCKRALLDAIQNTALRYPQRSL
FT                   LVILQDPFNTIESQSRSEE"
FT   gene            606522..607286
FT                   /locus_tag="CPn_0525"
FT   CDS_pept        606522..607286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0525"
FT                   /product="CT398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18665"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z827"
FT                   /protein_id="AAD18665.1"
FT                   /translation="MHDALLSILAIQELDIKMIRLMRVKKEHQKELAKVQSLKSDIRRK
FT                   VQEKELEMENLKTQIRDGENRIQEISEQINKLENQQAAVKKMDEFNALTQEMTTANKER
FT                   RSLEHQLSDLMDKQAGGEDLIVSLKESLASTENSSSVIEKEIFESIKKINEEGKALLEQ
FT                   RTELKHATNPELLSIYERLLNNKKDRVVVPIENRVCSGCHIVLTPQHENLVRKKDRLIF
FT                   CEHCSRILYWQESQVNAQENSTAKRRRRRAAV"
FT   gene            607342..607649
FT                   /locus_tag="CPn_s02"
FT   misc_RNA        607342..607649
FT                   /locus_tag="CPn_s02"
FT                   /product="ribonuclease P RNA"
FT   gene            complement(607707..608696)
FT                   /gene="kpsF"
FT                   /locus_tag="CPn_0526"
FT   CDS_pept        complement(607707..608696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="CPn_0526"
FT                   /product="GutQ/KpsF Family Sugar-P Isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18666"
FT                   /db_xref="GOA:Q9Z826"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z826"
FT                   /protein_id="AAD18666.1"
FT                   /translation="MPSPMISTDVCQDILGKQKEAVDFFFQAFQPKEAMQLAEKILGHS
FT                   GWVFFSGVGKSGCVARKLVATLQSLSERALFFSPVDLLHGDLGLVSPGDIVCLFSKSGE
FT                   TQELLDTVPHLKSRRAILVAITSMPYSNLAALSDLVVILPSVAELDPFNLIPTNSTTCQ
FT                   MIFGDFLAMLLFHSRGVSLSTYGKNHPSGQVGMKANGKVKDFMFPKTEVPFCHLGDKVS
FT                   FSLEVFSAYGCGCVCIVDPQFRLMGIFTDGDLRRSLASYGGEVLSLSLEKVMTANPRCI
FT                   TEDSDIAIALQLMESSSPVAVLPVLDNEENRHVTGLLHMHTLAKAGLL"
FT   gene            complement(608723..609904)
FT                   /gene="sucB_2"
FT                   /locus_tag="CPn_0527"
FT   CDS_pept        complement(608723..609904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB_2"
FT                   /locus_tag="CPn_0527"
FT                   /product="Dihydrolipoamide Succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18667"
FT                   /db_xref="GOA:A0A0F7WQ13"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7WQ13"
FT                   /protein_id="AAD18667.1"
FT                   /translation="MIFEFRFPKIGETSSGGSIVRWLKNLGDHVARDEPLIEVSTDKIA
FT                   TELPSPKAGRLVRFCVNEGDEVASGDVLGLIELEEISEADDESTSCPPTSCETKSEAGS
FT                   SSSSVWFSPAVLSLAQREGIGLDNLQKIAGTGKGGRVTRQDLEAYISESQQVSIPEIFQ
FT                   GEVNRIPMSPLRRAIASSLSKSSDEVPHASLVVDVDVTDLMNLISGERQRFLDTHGVKL
FT                   TITSFIVQCLAQTLRQFPLLNGSLDGTTIVMKKSVNVGVAVNLNKEGVVVPVIHNCQDR
FT                   GLVSIAKALADLSSRARLNKLDPSEVQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIG
FT                   TIQKRVVVRDDDSLAIRKMVYVTLTFDHRVLDGIYGSEFLTSLKNRLESVTMG"
FT   gene            complement(609918..611162)
FT                   /gene="gltT"
FT                   /locus_tag="CPn_0528"
FT   CDS_pept        complement(609918..611162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltT"
FT                   /locus_tag="CPn_0528"
FT                   /product="Glutamate Symport"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18668"
FT                   /db_xref="GOA:Q9Z824"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z824"
FT                   /protein_id="AAD18668.1"
FT                   /translation="MKLWMKIFIGLFVGVTLGLVLEDKAIFFKPIGDIFLNLLSMVVYP
FT                   LVFCSMVLGIASISDMKKLGRIGIKSVGLYLGTTALAIVIGLCFAWIFSPGNGCDFAQA
FT                   QSMDSAVTVIDSNKTAAYFLSIIAQVFPSNPVRSFAEGNILQIIIFAIFLGIALRLSGE
FT                   RGRPVERFIDGFSEIMLRMVNMIMSFAPYGVGASMAWISGNHGLGVLWQLGKFIIAYYL
FT                   ACLFHATLVFGGLVRFGCKMSFSKFLSSMMDAISCAVSTASSSATLPVTMRCVSKNLGV
FT                   SAEVSGFVLPLGATVNMNGTAIFQGMAAVFIAQAYNCPLSLSSLLLLVVTATFSAVGSA
FT                   GVPGGGMITLGSVLASVGLPIQGIAILAGIDRLRDIVGTPMNILGDAVVATYVASGEGE
FT                   LSPYESIKQESVETT"
FT   gene            complement(611162..612259)
FT                   /gene="ycaH"
FT                   /locus_tag="CPn_0529"
FT   CDS_pept        complement(611162..612259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaH"
FT                   /locus_tag="CPn_0529"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18669"
FT                   /db_xref="GOA:Q9Z823"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z823"
FT                   /protein_id="AAD18669.1"
FT                   /translation="MKKRFPSTLFLFYRRVTIAISLEGILGWGWLGSLLSKVFAFLVAC
FT                   WNRFSWSTPYRARSTVISVGNIVVGGAGKTPTVLWLAEALRLRGYSCGVLSRGYKSQSS
FT                   RQKKLTVVDSKVHSASYVGDEPLLMAEKLPEGSVWVHKDRRISAARAAEKFGILLLDDG
FT                   LQYRKLHKDVEIAVVNGQDPLGGRAFFPKGRLRDFPLRLKTVDAIIVNGGGKEAGTVVK
FT                   RVSNAPQIFVKPTIASVVWTHNGERIPKEALRELRVGVFCGLGFPQGFLNMLREEGIHI
FT                   LGKYLLPDHAAITKKELNYFCQQMAMRQGQGLLCTEKDSVKLPRLSGEVSLLPIAKVEM
FT                   RLSVNQDDTLSLLNMIEQIHKNRGN"
FT   gene            complement(612457..613254)
FT                   /gene="spoU_1"
FT                   /locus_tag="CPn_0530"
FT   CDS_pept        complement(612457..613254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU_1"
FT                   /locus_tag="CPn_0530"
FT                   /product="rRNA Methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18670"
FT                   /db_xref="GOA:Q9Z822"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z822"
FT                   /protein_id="AAD18670.1"
FT                   /translation="MDCIGKHNPLVKEALALKRSRCRKSSWFLVEGAREIQKALRTGYL
FT                   CQHVFCSTHLSEKEKEFLYELKRNSTKILYCLDSTLAQLSFKEHHDSFVAVIQKRVWNK
FT                   EDFLIQRKNAQPFYLIIEQVEKPGNVGAILRIADGAGVDGVILCNPIVDLYNPNVVRSS
FT                   LGAVFSLPILSISREEGKELFKQEGWTVFVTSPRAETMYFSKNYLGPTALVFGSEKDGL
FT                   TEDWFSEDFSEIALPMLGESDSLNLATSVAAVAYEVVRQRWVN"
FT   gene            complement(613242..614069)
FT                   /locus_tag="CPn_0531"
FT   CDS_pept        complement(613242..614069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0531"
FT                   /product="SAM dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18671"
FT                   /db_xref="GOA:Q9Z821"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z821"
FT                   /protein_id="AAD18671.1"
FT                   /translation="MDYKLLDSGDGNKLECFGPVTLIRPSSIAVWPKSRPELWSQAQLQ
FT                   YVREGERGAWKNFKRLPEEWEVAFSDVRCLLKRTPFGHLGVFPEHMGFWPALKQAIEKH
FT                   KERQVLNLFAYTGAGSIFAAKCGARVTHVDASQAAVRWAQRNVEKNAFPERRIFWVIED
FT                   VISFLKKEIRRNKKYQVILLDPPSYGRGPDGEVFKIDKDLFPLLSLCSKLLADDASYFL
FT                   LTSHTPGHTPEFLRAIARRSVPTLVSEAWSCGESFCGEGVGALPSGSFVQWIA"
FT   gene            complement(614072..614674)
FT                   /gene="ribC"
FT                   /locus_tag="CPn_0532"
FT   CDS_pept        complement(614072..614674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC"
FT                   /locus_tag="CPn_0532"
FT                   /product="Riboflavin Synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18672"
FT                   /db_xref="GOA:Q9Z820"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z820"
FT                   /protein_id="AAD18672.1"
FT                   /translation="MFSGIIQELGEVCFFEAQGNGLSLGIKSTPLFVTPLVTGDSVAVD
FT                   GVCLTLTSCNESKIFFDVIPETLACTTLGEKRCSDQVNLEAALKMGDSIGGHLLSGHVF
FT                   GTAEIFLIKENRYYFRGSKELSQYLFEKGFIAIDGISLTLVSVDSDTFSVGLIPETLQR
FT                   TTLGKKREGERVNIEIDMSTKIQVDTVKRILASSGKD"
FT   gene            614930..615388
FT                   /locus_tag="CPn_0533"
FT   CDS_pept        614930..615388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0533"
FT                   /product="CT406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18673"
FT                   /db_xref="GOA:Q9Z819"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z819"
FT                   /protein_id="AAD18673.1"
FT                   /translation="MQCPFCNHGELKVIDSRNAPEANAIKRRRECLKCSQRFTTFETVE
FT                   LTLQVLKRDGRYENFQESKLIHGLNAASSHTRIGQDQVHAIASNVKSELLGKQNREIST
FT                   KEIGELVMKYLKKADMIAYIRFACVYRRFKDVGELMEVLLSATPDMEK"
FT   gene            615413..615787
FT                   /gene="dksA"
FT                   /locus_tag="CPn_0534"
FT   CDS_pept        615413..615787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="CPn_0534"
FT                   /product="DnaK Suppressor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18674"
FT                   /db_xref="GOA:A0A0H2ULV7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULV7"
FT                   /protein_id="AAD18674.1"
FT                   /translation="MPLSDDEIEQFKKRLLEMKAKLSHTLEGNAQEVKKPNEATGYSQH
FT                   QADQGTDTFDRTISLEVTTKEYELLRQINRALEKINESSYGICDVSGEEIPLARLIAIP
FT                   YATMTVKAQEQFEKGLLSGN"
FT   gene            615793..616299
FT                   /gene="lspA"
FT                   /locus_tag="CPn_0535"
FT   CDS_pept        615793..616299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="CPn_0535"
FT                   /product="Lipoprotein Signal Peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18675"
FT                   /db_xref="GOA:Q9Z817"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z817"
FT                   /protein_id="AAD18675.1"
FT                   /translation="MATRFRSTLLVITLFVLIDWVTKLVVLLQYKDLQILTHPTLYTHS
FT                   WGRFSFSIAPVFNEGAAFGLFSNYKYFLFLLRIFVILGLLAYLFFKKKSIQSTTQTALV
FT                   LLCAGAIGNVGDIIFYGHIVDFISFNYKQWAFPTFNVADVLISLGTLLLVYKFYFPTKQ
FT                   TEKKR"
FT   gene            616345..617694
FT                   /gene="dagA_1"
FT                   /locus_tag="CPn_0536"
FT   CDS_pept        616345..617694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dagA_1"
FT                   /locus_tag="CPn_0536"
FT                   /product="D-Ala/Gly Permease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18676"
FT                   /db_xref="GOA:Q9Z816"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z816"
FT                   /protein_id="AAD18676.1"
FT                   /translation="MNRLLSLLSVFDDFFWSYVAFILIIVLGVSFSWKSRFFQFTKFSQ
FT                   FCKLFRYYSQNPQERETKQGVHPLKVFFASAGGNIGIGNVVGIVTAACIGGPGALFWVW
FT                   IAGIFGSIVKYSEVYLGIKFRKLDRDGVYQGGPMYFLIKAFKTPVVSVIVAILLCIYGV
FT                   EIYQFSVITDSLAHCWNLPKVYPMLGLLFLVFYAIRGGLQRIGKICSIVLPFFMLLYCA
FT                   LSLYILVKEFHTLPHLLSTVFSSAFKGQSALGGFAGCTVATTIHQGISRAAYSGDIGIG
FT                   FDSIIQSESSAKDPSTQAQLSIVGIAIDNLICTLSLLMVLASGSWSLGLENASQVVEHT
FT                   LASYFPMVKFFLPTFFFVTGYTTIISYFLVGKKCAKFLYGNTGAKIYTLYGLLILPLFC
FT                   FLSQNTALLIMSVSGALLLCFNLLGVFILRKEVIFPARAASLTETSLSTE"
FT   gene            617833..618192
FT                   /locus_tag="CPn_0537"
FT   CDS_pept        617833..618192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0537"
FT                   /product="CT814.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18677"
FT                   /db_xref="GOA:Q9Z815"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z815"
FT                   /protein_id="AAD18677.1"
FT                   /translation="MDNYLLGSLIFCCVLLSIGMCTIFVMTICFLRQLNKILKNIHRVT
FT                   TILNFEAKILAPLMLGKKLLCGWLKKRKNRGSLSEDIDELLDEKKQRSWKKNLDQGIKW
FT                   CAALVLIWKVFRNKD"
FT   gene            618212..618514
FT                   /locus_tag="CPn_0538"
FT   CDS_pept        618212..618514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0538"
FT                   /product="CT814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18678"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z814"
FT                   /protein_id="AAD18678.1"
FT                   /translation="MFRNNHKPKKTKCKRFRWLRGVLFGGFIATLLTCLFTPKSGVQLR
FT                   KKILKVKNSGAKKSRVFFKNSKQHTKSFVKQAKLLAKNISHELQDFKKGILDDKD"
FT   gene            618705..621548
FT                   /gene="pmp_19"
FT                   /locus_tag="CPn_0539"
FT   CDS_pept        618705..621548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_19"
FT                   /locus_tag="CPn_0539"
FT                   /product="polymorphic membrane protein A Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18679"
FT                   /db_xref="GOA:Q9Z813"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z813"
FT                   /protein_id="AAD18679.1"
FT                   /translation="MKQMRLWGFLFLSSFCQVSYLRANDVLLPLSGIHSGEDLELFTLR
FT                   SSSPTKTTYSLRKDFIVCDFAGNSIHKPGAAFLNLKGDLFFINSTPLAALTFKNIHLGA
FT                   RGAGLFSESNVTFKGLHSLVLENNESWGGVLTTSGDLSFINNTSVLCQNNISYGPGGAL
FT                   LLQGRKSKALFFRDNRGTILFLKNKAVNQDESHPGYGGAVSSISPGSPITFADNQEILF
FT                   QENEGELGGAIYNDQGAITFENNFQTTSFFSNKASFGGAVYSRYCNLYSQWGDTLFTKN
FT                   AAAKVGGAIHADYVHIRDCKGSIVFEENSATAGGAIAVNAVCDINAQGPVRFINNSALG
FT                   LNGGAIYMQATGSILRLHANQGDIEFCGNKVRSQFHSHINSTSNFTNNAITIQGAPREF
FT                   SLSANEGHRICFYDPIISATENYNSLYINHQRLLEAGGAVIFSGARLSPEHKKENKNKT
FT                   SIINQPVRLCSGVLSIEGGAILAVRSFYQEGGLLALGPGSKLTTQGKNSEKDKIVITNL
FT                   GFNLENLDSSDPAEIRATEKASIEISGVPRVYGHTESFYENHEYASKPYTTSIILSAKK
FT                   LVTAPSRPEKDIQNLIIAESEYMGYGYQGSWEFSWSPNDTKEKKTIIASWTPTGEFSLD
FT                   PKRRGSFIPTTLWSTFSGLNIASNIVNNNYLNNSEVIPLQHLCVFGGPVYQIMEQNPKQ
FT                   SSNNLLVQHAGHNVGARIPFSFNTILSAALTQLFSSSSQQNVADKSHAQILIGTVSLNK
FT                   SWQALSLRSSFSYTEDSQVMKHVFPYKGTSRGSWRNYGWSGSVGMSYAYPKGIRYLKMT
FT                   PFVDLQYTKLVQNPFVETGYDPRYFSSSEMTNLSLPIGIALEMRFIGSRSSLFLQVSTS
FT                   YIKDLRRVNPQSSASLVLNHYTWDIQGVPLGKEALNITLNSTIKYKIVTAYMGISSTQR
FT                   EGSNLSANAHAGLSLSF"
FT   gene            621694..626865
FT                   /gene="pmp_20"
FT                   /locus_tag="CPn_0540"
FT   CDS_pept        621694..626865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmp_20"
FT                   /locus_tag="CPn_0540"
FT                   /product="polymorphic membrane protein B Family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18680"
FT                   /db_xref="GOA:Q9Z812"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z812"
FT                   /protein_id="AAD18680.1"
FT                   /translation="MKWLPATAVFAAVLPALTAFGDPASVEISTSHTGSGDPTSDAALT
FT                   GFTQSSTETDGTTYTIVGDITFSTFTNIPVPVVTPDANDSSSNSSKGGSSSSGATSLIR
FT                   SSNLHSDFDFTKDSVLDLYHLFFPSASNTLNPALLSSSSSGGSSSSSSSSSSGSASAVV
FT                   AADPKGGAAFYSNEANGTLTFTTDSGNPGSLTLQNLKMTGDGAAIYSKGPLVFTGLKNL
FT                   TFTGNESQKSGGAAYTEGALTTQAIVEAVTFTGNTSAGQGGAIYVKEATLFNALDSLKF
FT                   EKNTSGQAGGGIYTESTLTISNITKSIEFISNKASVPAPAPEPTSPAPSSLINSTTIDT
FT                   STLQTRAASATPAVAPVAAVTPTPISTQETAGNGGAIYAKQGISISTFKDLTFKSNSAS
FT                   VDATLTVDSSTIGESGGAIFAADSIQIQQCTGTTLFSGNTANKSGGGIYAVGQVTLEDI
FT                   ANLKMTNNTCKGEGGAIYTKKALTINNGAILTTFSGNTSTDNGGAIFAVGGITLSDLVE
FT                   VRFSKNKTGNYSAPITKAASNTAPVVSSSTTAASPAVPAAAAAPVTNAAKGGALYSTEG
FT                   LTVSGITSILSFENNECQNQGGGAYVTKTFQCSDSHRLQFTSNKAADEGGGLYCGDDVT
FT                   LTNLTGKTLFQENSSEKHGGGLSLASGKSLTMTSLESFCLNANTAKENGGGANVPENIV
FT                   LTFTYTPTPNEPAPVQQPVYGEALVTGNTATKSGGGIYTKNAAFSNLSSVTFDQNTSSE
FT                   NGGALLTQKAADKTDCSFTYITNVNITNNTATGNGGGIAGGKAHFDRIDNLTVQSNQAK
FT                   KGGGVYLEDALILEKVITGSVSQNTATESGGGIYAKDIQLQALPGSFTITDNKVETSLT
FT                   TSTNLYGGGIYSSGAVTLTNISGTFGITGNSVINTATSQDADIQGGGIYATTSLSINQC
FT                   NTPILFSNNSAATKKTSTTKQIAGGAIFSAAVTIENNSQPIIFLNNSAKSEATTAATAG
FT                   NKDSCGGAIAANSVTLTNNPEITFKGNYAETGGAIGCIDLTNGSPPRKVSIADNGSVLF
FT                   QDNSALNRGGAIYGETIDISRTGATFIGNSSKHDGSAICCSTALTLAPNSQLIFENNKV
FT                   TETTATTKASINNLGAAIYGNNETSDVTISLSAENGSIFFKNNLCTATNKYCSIAGNVK
FT                   FTAIEASAGKAISFYDAVNVSTKETNAQELKLNEKATSTGTILFSGELHENKSYIPQKV
FT                   TFAHGNLILGKNAELSVVSFTQSPGTTITMGPGSVLSNHSKEAGGIAINNVIIDFSEIV
FT                   PTKDNATVAPPTLKLVSRTNADSKDKIDITGTVTLLDPNGNLYQNSYLGEDRDITLFNI
FT                   DNSASGAVTATNVTLQGNLGAKKGYLGTWNLDPNSSGSKIILKWTFDKYLRWPYIPRDN
FT                   HFYINSIWGAQNSLVTVKQGILGNMLNNARFEDPAFNNFWASAIGSFLRKEVSRNSDSF
FT                   TYHGRGYTAAVDAKPRQEFILGAAFSQVFGHAESEYHLDNYKHKGSGHSTQASLYAGNI
FT                   FYFPAIRSRPILFQGVATYGYMQHDTTTYYPSIEEKNMANWDSIAWLFDLRFSVDLKEP
FT                   QPHSTARLTFYTEAEYTRIRQEKFTELDYDPRSFSACSYGNLAIPTGFSVDGALAWREI
FT                   ILYNKVSAAYLPVILRNNPKATYEVLSTKEKGNVVNVLPTRNAARAEVSSQIYLGSYWT
FT                   LYGTYTIDASMNTLVQMANGGIRFVF"
FT   gene            626904..626987
FT                   /locus_tag="CPn_t15"
FT   tRNA            626904..626987
FT                   /locus_tag="CPn_t15"
FT                   /product="tRNA-Ser"
FT   gene            627170..628006
FT                   /locus_tag="CPn_0541"
FT   CDS_pept        627170..628006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0541"
FT                   /product="Solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18681"
FT                   /db_xref="GOA:Q9Z811"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z811"
FT                   /protein_id="AAD18681.1"
FT                   /translation="MHKVIVFIFLTLYSLKSYGNDVIDKPHVLVSIAPYKFLVEQIAEE
FT                   TCFVYAIVTNHYDPHTYELPPQQIKELRQGDLWFRIGEAFEKTCERNLTCQQVDLSQNV
FT                   SLIQGKPCCNQHTTNYDTHTWLSPKNLKVQVETIVTTLSKKYPQHATLYQSNGEKLLLA
FT                   LDQLNEEILTITSKAKQRHILVSHGAFGYFCRDYNFSQHTIEKSSHVEPSPKDVARVFR
FT                   DIEQYKISSVILLEYSGRRSSAMLADRFHMHTVNLDPYAENVLVNLKTIATTFSSL"
FT   gene            628003..628740
FT                   /locus_tag="CPn_0542"
FT   CDS_pept        628003..628740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0542"
FT                   /product="ABC Transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18682"
FT                   /db_xref="GOA:Q9Z810"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z810"
FT                   /protein_id="AAD18682.1"
FT                   /translation="MTIRILAEGLAFRYGSKGPNIIHDVSFSVYDGDFIGIIGPNGGGK
FT                   STLTMLILGLLTPTFGSLKTFPSHSAGKQTHSMIGWVPQHFSYDPCFPISVKDVVLSGR
FT                   LSQLSWHGKYKKKDFEAVDHALDLVGLSDHHHHCFAHLSGGQIQRVLLARALASYPEIL
FT                   ILDEPTTNIDPDNQQRILSILKKLNRTCTILMVTHDLHHTTNYFNKVFYMNKTLTSLAD
FT                   TSTLTDQFCCHPYKNQEFSCSPH"
FT   gene            628725..629606
FT                   /locus_tag="CPn_0543"
FT   CDS_pept        628725..629606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0543"
FT                   /product="Metal Transport Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18683"
FT                   /db_xref="GOA:Q9Z809"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z809"
FT                   /protein_id="AAD18683.1"
FT                   /translation="MLSSLIRDSFPLLILLPTFLAALGASVAGGVMGTYIVVKRIVSIS
FT                   GSISHAILGGIGLTLWIQYKLHLSFFPMYGAIVGAIFLALCIGKIHLKYQEREDSLIAM
FT                   IWSVGMAIGIIFISRLPTFNGELINFLFGNILWVTPSDLYSLGIFDLLVLGIVVLCHTR
FT                   FLALCFDERYTALNHCSVQLWYFLLLVLTAITIVMLIYVMGTILMLSMLVLPVAIACRF
FT                   SYKMTRIMFISVLLNILCSFSGICIAYCLDFPVGPTISLLMGLGYTASLCVKKRYNPST
FT                   PSPVSPEINTNV"
FT   gene            complement(629522..630529)
FT                   /gene="yhbZ"
FT                   /locus_tag="CPn_0544"
FT   CDS_pept        complement(629522..630529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbZ"
FT                   /locus_tag="CPn_0544"
FT                   /product="GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18684"
FT                   /db_xref="GOA:Q9Z808"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z808"
FT                   /protein_id="AAD18684.1"
FT                   /translation="MFVDQITLELRAGKGGNGVVAWRKEKYLPKGGPYGGNGGNGGSVI
FT                   IEATTSVYSFEAYRNIRFLKAPDGQSGATNNRTGRSGKDLIVSVPTGTLLRDAETGEIL
FT                   HDFTVDGERLLVSQGGKGGKGNTFFKTSVNRAPTKATPGKPGEIRQVELELKLIADIGL
FT                   VGFPNAGKSTLFNTLAHTEVKVGAYPFTTLAPSLGLVLCKDRLYQKPWIIADIPGIIEG
FT                   AHQNKGLGLDFLRHIERTLLLLFVIDVSKRERNSPEEDLETLIHELHSHQPDFEKKDML
FT                   VALNKIDDLLPDEQEECLQSFQKRFPSYTFVLISGLTGEGVDGLYRFFTQRLAV"
FT   gene            complement(630630..630884)
FT                   /gene="rl27"
FT                   /locus_tag="CPn_0545"
FT   CDS_pept        complement(630630..630884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl27"
FT                   /locus_tag="CPn_0545"
FT                   /product="L27 ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18685"
FT                   /db_xref="GOA:Q9Z807"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z807"
FT                   /protein_id="AAD18685.1"
FT                   /translation="MAHKKGQGASRNGRDSKSKRLGVKVGAGQKVSTGSILVRQRGTRW
FT                   NPAQNVGRGRDDTLFALVDGIVVMKKTNRTYISVVPEQL"
FT   gene            complement(630909..631229)
FT                   /gene="rl21"
FT                   /locus_tag="CPn_0546"
FT   CDS_pept        complement(630909..631229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl21"
FT                   /locus_tag="CPn_0546"
FT                   /product="L21 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18686"
FT                   /db_xref="GOA:Q9Z806"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z806"
FT                   /protein_id="AAD18686.1"
FT                   /translation="MEPYAVIQTGSKQYQVRSGDVIDVELLGEVASDKEVIFQDVLFVF
FT                   DGTKASLGSPTIANAQVKAEYLSHVKGEKVVAYKYKKRKNYHRKHGHRQKYLRVKIREI
FT                   LI"
FT   gene            631373..631445
FT                   /locus_tag="CPn_t16"
FT   tRNA            631373..631445
FT                   /locus_tag="CPn_t16"
FT                   /product="tRNA-Phe"
FT   gene            631661..632191
FT                   /gene="ygbB"
FT                   /locus_tag="CPn_0547"
FT   CDS_pept        631661..632191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygbB"
FT                   /locus_tag="CPn_0547"
FT                   /product="YgbB family hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18687"
FT                   /db_xref="GOA:Q9Z805"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z805"
FT                   /protein_id="AAD18687.1"
FT                   /translation="MDRDNEVPLPKPKWIYRTGIGQDSHRFLPESSTKPCILGGIIFDH
FT                   CPGFQANSDGDIIFHAICNAISSVTNKIILGKVADELLQTRGITDSGIYLEEALKSLKP
FT                   NQKISHVAITIEGSRPKFLCKLSALRQNIAQVMNLTPTDIGITATSGEGLSDFGCGDGV
FT                   QCFCVLTVMEYCD"
FT   gene            complement(632188..633231)
FT                   /gene="cysJ"
FT                   /locus_tag="CPn_0548"
FT   CDS_pept        complement(632188..633231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="CPn_0548"
FT                   /product="Sulfite Reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18688"
FT                   /db_xref="GOA:Q9Z804"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z804"
FT                   /protein_id="AAD18688.1"
FT                   /translation="MYLQEKFKAQQVPLVLRELLSCSDSINDSDPIYRMVFDSNDTTIS
FT                   YKVGDALGVLPENSKEVSEHVLQLLGYSPTTLVNVKKTSEKVSAQKFIQGYVDLDKIPA
FT                   KLNSFFPDKDPKITLYDAIQEYRPQIPIELFAESVFPLLPRFYSIASSPDLHPKSIELL
FT                   VKHVSYPGKYQKRFGVCSSFLCSELQVNDSAYIFVQPTKHFTLSTQTEGKPLVMIGAGT
FT                   GIAPYKAFLEERLFNKDPGNNLLFFGERKEKVNFYYREFWNHAEEEGKLKLFLAFSRER
FT                   DQKVYVQDLLRIQKDEVRKAYEEGGFFFVCGRKVLGIEVKHALEEILGKDTLASLRKEH
FT                   RYVVDVY"
FT   gene            complement(633252..633569)
FT                   /gene="rs10"
FT                   /locus_tag="CPn_0549"
FT   CDS_pept        complement(633252..633569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs10"
FT                   /locus_tag="CPn_0549"
FT                   /product="S10 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18689"
FT                   /db_xref="GOA:Q9Z803"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z803"
FT                   /protein_id="AAD18689.1"
FT                   /translation="MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARVVGPIPLP
FT                   TKREVYTVLRSPHVDKKSREQFEIRTHKRLVDILDPTGKTIDALKMLALPAGVDIKIKA
FT                   A"
FT   gene            complement(633577..635661)
FT                   /gene="fusA"
FT                   /locus_tag="CPn_0550"
FT   CDS_pept        complement(633577..635661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="CPn_0550"
FT                   /product="Elongation Factor G"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18690"
FT                   /db_xref="GOA:Q9Z802"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z802"
FT                   /protein_id="AAD18690.1"
FT                   /translation="MSNQEFDLSAIRNIGIMAHIDAGKTTTTERILFYAGRTHKIGEVH
FT                   EGGATMDWMAQEQERGITITSAATTVFWLGAKINIIDTPGHVDFTIEVERSLRVLDGAV
FT                   AVFDAVSGVEPQSETVWRQADKYGVPRIAFVNKMDRMGADYFAAVESMKEKLGANAFPV
FT                   HCPIGSESQFVGMVDLISQKALYFLDDTLGAKWEEKEISEDLKERCAELRANLLEELAT
FT                   IDESNEAFMMKVLEDPDSITEDEIHQVMRKGVIENKINPVLCGTAFKNKGVQQLLNVIV
FT                   KWLPSPLDRGNIRGINLKTDQEISLEPRRDGPLAALAFKIMTDPYVGRITFIRIYSGTL
FT                   KKGSAILNSTKDKKERISRLLEMHANERTDRDEFTVGDIGACVGLKFSVTGDTLCDDNQ
FT                   EIVLERIEFPDPVIDMAIEPKSKGDREKLAQALSSLSEEDPTFRVSTNEETGQTIISGM
FT                   GELHLDILRDRMIREFKVEANVGKPQVSYKETITVSGNSETKYVKQSGGRGQYAHVCLE
FT                   IEPNEPGKGNEVVSKIVGGVIPKEYIPAVIKGIEEGLNTGVLAGYGLVDVKVSIVFGSY
FT                   HEVDSSEMAFKICGSMAVKDACRKAKPVILEPIMKVAVITPEDHLGDVIGDLNRRRGKI
FT                   LGQESSRGMAQVNAEVPLSEMFGYTTSLRSLTSGRATSTMEPAFFAKVPQKIQEEIVKK
FT                   "
FT   gene            complement(635695..636168)
FT                   /gene="rs7"
FT                   /locus_tag="CPn_0551"
FT   CDS_pept        complement(635695..636168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs7"
FT                   /locus_tag="CPn_0551"
FT                   /product="S7 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18691"
FT                   /db_xref="GOA:Q9Z801"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z801"
FT                   /protein_id="AAD18691.1"
FT                   /translation="MSRRHSAEKRDIPGDPIYGSVILEKFINKVMMHGKKSVARKIVYS
FT                   ALERFGKKLNLENVLEGFGEALENAKPILEVRSRRVGGATYQVPVEVASERRNCLAMQW
FT                   IIKHARSKPGKSMEVGLATELIDCFNKQGATIKKREDTHRMAEANKAFAHYKW"
FT   gene            complement(636216..636587)
FT                   /gene="rs12"
FT                   /locus_tag="CPn_0552"
FT   CDS_pept        complement(636216..636587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs12"
FT                   /locus_tag="CPn_0552"
FT                   /product="S12 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18692"
FT                   /db_xref="GOA:Q9Z800"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z800"
FT                   /protein_id="AAD18692.1"
FT                   /translation="MPTINQLIRKRRKSSLARKKSPALQKCPQKRGVCLQVKTKTPKKP
FT                   NSALRKVAWVRLSNGQEVIAYIGGEGHNLQEHSIVLIQGGRVKDLPGVRYHIVRGTLDC
FT                   AAVKNRKQSRSRYGAKRPK"
FT   gene            complement(636809..637747)
FT                   /locus_tag="CPn_0553"
FT   CDS_pept        complement(636809..637747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18693"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Z9"
FT                   /protein_id="AAD18693.1"
FT                   /translation="MWRVVLRFLIIFILGRAVFPLRASESFSWETSTCLTVLGIPFIDI
FT                   ILTTNEDFVAQCGLQIGTISSTNNAKIKEIFLIYKEKFPEASISFKRKEPLNLSQSHLS
FT                   DLGILCMRNGETYAEGMANKENGPALKQPKDLRLVLRCPNQPDTLLYSEKEAEKGIETN
FT                   TCLCNQGYTLLDGQLILYGDSIEKFLKETKRKNNHTLVDLCDSQVVTTFLGRFWSLLNY
FT                   VQVLFLSEDSAKILAGIPDLAQATQLLSHTVPLLFIYTNDSIHIIEQGKESSFTYNQDL
FT                   TEPILGFLFGYINRGSMEYCFNCAQSSLGET"
FT   gene            637854..638144
FT                   /locus_tag="CPn_0554"
FT   CDS_pept        637854..638144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0554"
FT                   /product="CT440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18694"
FT                   /db_xref="GOA:Q9Z7Z8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Z8"
FT                   /protein_id="AAD18694.1"
FT                   /translation="MYEGKSRMASPTPGQLHLQQKVESKAYDYSRSLAMIATALLFFIV
FT                   ALILSGLSLLPQVFLPFSGAYFIIGSFLAFIALGILLINCVCDLKQYLTSS"
FT   gene            638298..640244
FT                   /gene="tsp"
FT                   /locus_tag="CPn_0555"
FT   CDS_pept        638298..640244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsp"
FT                   /locus_tag="CPn_0555"
FT                   /product="Tail-Specific Protease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18695"
FT                   /db_xref="GOA:Q9Z7Z7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Z7"
FT                   /protein_id="AAD18695.1"
FT                   /translation="MFVMKKLVRLCVVLLSLLPNVLFSSDLLREEGIKKMMDKLIEYHV
FT                   DAQEVSTDILSRSLSSYIQSFDPHKSYLSNQEVAVFLQSPETKKRLLKNYKAGNFAIYR
FT                   NINQLIHESILRARQWRNEWVKNPKELVLEASSYQISKQPMQWSKSLDEVKQRQRALLL
FT                   SYLSLHLAGASSSRYEGKEEQLAALCLRQIENHENVYLGINDHGVAMDRDEEAYQFHIR
FT                   VVKALAHSLDAHTAYFSKDEALAMRIQLEKGMCGIGVVLKEDIDGVVVREIIPGGPAAK
FT                   SGDLQLGDIIYRVDGKDIEHLSFRGVLDCLRGGHGSTVVLDIHRGESDHTIALRREKIL
FT                   LEDRRVDVSYEPYGDGVIGKVTLHSFYEGENQVSSEQDLRRAIQGLKEKNLLGLVLDIR
FT                   ENTGGFLSQAIKVSGLFMTNGVVVVSRYADGTMKCYRTVSPKKFYDGPLAILVSKSSAS
FT                   AAEIVAQTLQDYGVALVVGDEQTYGKGTIQHQTITGDASQDDCFKVTVGKYYSPSGKST
FT                   QLQGVKSDILIPSLYAEDRLGERFLEHPLPADCCDNVLHDPLTDLDTQTRPWFQKYYLP
FT                   NLQKQETLWREMLPQLTKNSEQRLSENSNFQAFLSQIKSSEKTDLSYGSNDLQLEESIN
FT                   ILKDMILLQQCRK"
FT   gene            complement(640322..640912)
FT                   /gene="crpA"
FT                   /locus_tag="CPn_0556"
FT   CDS_pept        complement(640322..640912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crpA"
FT                   /locus_tag="CPn_0556"
FT                   /product="15 kDa Cysteine-Rich Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18696"
FT                   /db_xref="GOA:Q9Z7Z6"
FT                   /db_xref="InterPro:IPR008436"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Z6"
FT                   /protein_id="AAD18696.1"
FT                   /translation="MSSNLHPVGGTGTGAAAPESVLNIVEEIAASGSVTAGLQAITSSP
FT                   GMVNLLIGWAKTKFIQPIRESKLFQSRACQITLLVLGILLVVAGLACMFIFHSQLGANA
FT                   FWLIIPAAIGLIKLLVTSLCFDEACTSEKLMVFQKWAGVLEDQLDDGILNNSNKIFGHV
FT                   KTEGNTSRATTPVLNDGRGTPVLSPLVSKIARV"
FT   gene            complement(641191..642861)
FT                   /gene="omcB"
FT                   /locus_tag="CPn_0557"
FT   CDS_pept        complement(641191..642861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omcB"
FT                   /locus_tag="CPn_0557"
FT                   /product="60 kDa Cysteine-Rich OMP"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18697"
FT                   /db_xref="GOA:P23700"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR003506"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23700"
FT                   /protein_id="AAD18697.1"
FT                   /translation="MSKLIRRVVTVLALTSMASCFASGGIEAAVAESLITKIVASAETK
FT                   PAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSV
FT                   KVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETT
FT                   PTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGCCFTAATVCACPELRSYTKCGQPAICI
FT                   KQEGPDCACLRCPVCYKIEVVNTGSAIARNVTVDNPVPDGYSHASGQRVLSFNLGDMRP
FT                   GDKKVFTVEFCPQRRGQITNVATVTYCGGHKCSANVTTVVNEPCVQVNISGADWSYVCK
FT                   PVEYSISVSNPGDLVLHDVVIQDTLPSGVTVLEAPGGEICCNKVVWRIKEMCPGETLQF
FT                   KLVVKAQVPGRFTNQVAVTSESNCGTCTSCAETTTHWKGLAATHMCVLDTNDPICVGEN
FT                   TVYRICVTNRGSAEDTNVSLILKFSKELQPIASSGPTKGTISGNTVVFDALPKLGSKES
FT                   VEFSVTLKGIAPGDARGEAILSSDTLTSPVSDTENTHVY"
FT   gene            complement(643028..643300)
FT                   /gene="omcA"
FT                   /locus_tag="CPn_0558"
FT   CDS_pept        complement(643028..643300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omcA"
FT                   /locus_tag="CPn_0558"
FT                   /product="9 kDa-Cysteine-Rich Lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18698"
FT                   /db_xref="GOA:Q9Z7Z5"
FT                   /db_xref="InterPro:IPR003517"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Z5"
FT                   /protein_id="AAD18698.1"
FT                   /translation="MKKAVLIAAMFCGVVSLSSCCRIVDCCFEDPCAPSSCNPCEVIRK
FT                   KERSCGGNACGSYVPSCSNPCGSTECNSQSPQVKGCTSPDGRCKQ"
FT   gene            643742..643930
FT                   /locus_tag="CPn_0559"
FT   CDS_pept        643742..643930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0559"
FT                   /product="CT444.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18699"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Z4"
FT                   /protein_id="AAD18699.1"
FT                   /translation="MKLFYFCNIIFLTSLFSVSCTHTPPPRSYILAQGRTPLVNKAHSL
FT                   EFFLARSVFNTCYNTNL"
FT   gene            complement(644095..645612)
FT                   /gene="gltX"
FT                   /locus_tag="CPn_0560"
FT   CDS_pept        complement(644095..645612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="CPn_0560"
FT                   /product="Glutamyl-tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18700"
FT                   /db_xref="GOA:Q9Z7Z3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Z3"
FT                   /protein_id="AAD18700.1"
FT                   /translation="MNWENVRVRVAPSPTGDPHVGTAYMALFNEIFAKRFKGKMILRIE
FT                   DTDRTRSRQDYEENIFSALRWCGIQWDEGPDVGGPYGPYRQSERTKIYQGYVETLLKTD
FT                   CAYKCFATPQELAEMRAVASTLGYRGGYDRRYRYLSPEEVASREAAGQPYTIRLKVPLS
FT                   GECVFEDYSKGRVVFPWADVDDQVLVKSDGFPTYHFANVIDDHLMGITHVLRGEEWLSS
FT                   TPKHLLLYEAFGWEPPVFLHMPLLLNPDGTKLSKRKNPTSIFYYRDSGYVKEAFVNFLT
FT                   LMGYSMEGDEEVYSLERIIETFNPRRIGKSGAVFDIQKLDWMNKHYLNHEGSPECLLKE
FT                   LQGWLLNDEFFLKILPLCQSRITTLAEFINLTSFFFSGLLEYRVEELLPQALSPEKAAI
FT                   LLYSYVKYLEKTDQWTKETCYLGSKWLAQAFNVHHKKAIIPLLYVAITGKKQGLPLFDS
FT                   IEILGKPRARARLVYAEKLLGGVPKKLAATVDKFMQREDFEEATFDL"
FT   gene            complement(645868..646404)
FT                   /gene="euo"
FT                   /locus_tag="CPn_0561"
FT   CDS_pept        complement(645868..646404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="euo"
FT                   /locus_tag="CPn_0561"
FT                   /product="CHLPS Euo Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18701"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Z2"
FT                   /protein_id="AAD18701.1"
FT                   /translation="MACEQHEGCYELEEREEIEDIKDSDTKWVSITQAAKLHNVTRQAI
FT                   YVAIKQKKLKASKETRWEIDIKDLEEYKRNRYSRKKSLYQGELVFDNGKGCYSINQVAQ
FT                   ILGIPVQKVYYATRTGTIRGERKGAAWVIHVSEIERYKNEYLSKQAAKKLKGAEPKEHQ
FT                   APNFEPPTEIFPESN"
FT   gene            complement(646915..648036)
FT                   /locus_tag="CPn_0562"
FT   CDS_pept        complement(646915..648036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0562"
FT                   /product="CHLPS 43 kDa-like protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18702"
FT                   /db_xref="GOA:A0A0F7XHZ3"
FT                   /db_xref="InterPro:IPR008536"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XHZ3"
FT                   /protein_id="AAD18702.1"
FT                   /translation="MSIAIAREQYAAILDMHPKPSIAMFSSEQARTSWEKRQAHPYLYR
FT                   LLEIIWGVVKFLLGLIFFIPLGLFWVLQKICQNFILLGAGGWIFRPICRDSNLLRQAYA
FT                   ARLFSASFQDHVSSVRRVCLQYDEVFIDGLELRLPNAKPDRWMLISNGNSDCLEYRTVL
FT                   QGEKDWIFRIAEESQSNILIFNYPGVMKSQGNITRNNVVKSYQACVRYLRDEPAGPQAR
FT                   QIVAYGYSLGASVQAEALSKEIADGSDSVRWFVVKDRGARSTGAVAKQFIGSLGVWLAN
FT                   LTHWNINSEKRSKDLHCPELFIYGKDSQGNLIGDGLFKKETCFAAPFLDPKNLEECSGK
FT                   KIPVAQTGLRHDHILSDDVIKEVAGHIQRHFDN"
FT   gene            complement(648290..650056)
FT                   /gene="recJ"
FT                   /locus_tag="CPn_0563"
FT   CDS_pept        complement(648290..650056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="CPn_0563"
FT                   /product="ssDNA Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18703"
FT                   /db_xref="GOA:Q9Z7Z0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Z0"
FT                   /protein_id="AAD18703.1"
FT                   /translation="MTNSDNASAAGLLWAHPKEDPAFLGMIIKEFHLPPTVAQIFISRG
FT                   FQTIQEIHKFLYSHLSSLYDPGLFLDMSKAVERLLLARDRKEHVMIYGDSDVDGMTGVA
FT                   LLVEFLRDIDVHVSYFFLGAILKQHGETSTLIAKLKEEGITLLITVDCGITAGKEVSDI
FT                   TRQGIDVIITDHHMPTGKIPHCVATLNPKLRDHTYPNRELTGVGVAFKLARGVLNALIS
FT                   RNLVPKSQGSLKKLLDLVTLGTITDVGVLLGENRVMVRYGIKEIARGARPGLNKLCALC
FT                   GVEKSEVTSTDIVLKIAPKLNSLGRLDDPAKGVELLLTQDDERVDALIMELDNINRERQ
FT                   RIEAEVFQDVQEILNSNPEILKQAAIVLSSTAWHARVIPIISARLAKTYNKPVVIIAIQ
FT                   RGIGKGSARTIGSFPLLGVLKKCSSLLLSYGGHDFAAGVIMKEDKVEDFKKKFVHLVNS
FT                   SLKKGDTLPHLEIDAYADFDAIDYDLLASMELFEPFGKGNLMPIFYSKVRQVRYPKVLP
FT                   GNHLKLYLSQKERNLEGVAFGLGRHADALKASWHYPLEIAYTPRLSQTSGSGVIHLLVR
FT                   DFRISSEPRFSD"
FT   gene            complement(650142..654350)
FT                   /gene="secD/secF"
FT                   /locus_tag="CPn_0564"
FT   CDS_pept        complement(650142..654350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD/secF"
FT                   /locus_tag="CPn_0564"
FT                   /product="SecD/SecF fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18704"
FT                   /db_xref="GOA:Q9Z7Y9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Y9"
FT                   /protein_id="AAD18704.1"
FT                   /translation="MKQKVKRNFAIIICVFALALYYVLPTCLYYAKPLDKKIDGNEAEH
FT                   IIKSFTKQAQQVRKDVIPRVSAILSSLHLRGHIQQHPAIPDIVSVRFKRGEDAEDFIGN
FT                   LVHGEPNVPIKSARLHVVGYSREHDDHVIQVASSINTSLVESDFSFVSYSSENEQEMAS
FT                   SILQRVYSACTFPKQKDCSCSYPSIWETAPKEQLLQYAKNLSSGFEVFSSRLSAFCQQS
FT                   FSSNQDRLAFLSRLSSLSNDAAIDVEDQKLLKSVYETLSQTACIRSLDCPYIEGLRLDC
FT                   SESSLFFSSIEYCPKERKIFLTLHSDLLAQRTSLSKEQRLDFDSRLAVEKQKLSKNLTV
FT                   QVEDYNNGFSFQWMDKDTQGKIILQGERLLQGIAEHLTALTLHRPAAESCDLIPENFPV
FT                   FCRQPRESEAFGCYIFSPNTDCKHFSKGSVYILLKGLRSIVAKYQQGGGKELQSFEKDL
FT                   QNLYNCFSHTEAISWTLGEDQVLEIRHPLQQFLDVWGEGFVIGKEGCAFLEVKDIQDRL
FT                   ATVNQIEKNRQSDLVRWHEQYRHAKCSMDLQERLSAPIPYQNLFLENMKLNMRKFSRGE
FT                   NILRLGIDFVGGRQLLLSFKDHQGKQLTDKEDILKVSDELCARLNKLGVSEIELRREGD
FT                   YIHLSVPGSSTISSSEILGTSKMSFHVVNERFSSYSASRYEVQRFLDYLWFTSQAQGKT
FT                   SPEEINTFASALFNEEVDVPPSVHEAITKLKSEGLAFSPSGCETPSTDLDTTFSMIAIG
FT                   KDAEQKANPLVIVFRNYALDGASLKDIRPEFAAGEGYVLNFSVKDTSPKKMAEKLSPTE
FT                   SFHTWTSAYCQEGISGTANGQYSANRGWRMAVVIDGYMVSSPILNVPLKNHASVSGKFT
FT                   HREVSKLASDLKSGAMSFVPEVLSEETISSDLGKKQCTQGIISACCGLAMLIVLMSVYY
FT                   RFGGVIASGAVLLNLLLIWAALQYLDAPLTLSGLAGIVLAMGMAVDANVLVFERIREEF
FT                   LLSQSLKKSVEKGYTKAFGAIFDSNLTTVLASALLFFLDTGPIKGFALTLILGIFSSMF
FT                   TALFMTKFFFMLWMNKTQHTQLHMMNKFVGIKHDFLRGCKKLWAVSGSVFLLGCVALGF
FT                   GAWNSVLGMDFKGGYAFTFNPKEHGISDVAQMRGKVVHKLQEAGLSSRDFRIQTFGSSE
FT                   KIKIYFSDKALSYTKADTSLSPKINDHELALAVGLLSETGLDFSTETLNETQNFWSKVS
FT                   SKLSKKMRYQATIGLLGALAIILLYVSLRFEWQYAFSAVCALIHDLLATCAVLFIAHFF
FT                   LKKIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRQANLFTPMHVLVNDALQKTFSRT
FT                   VMTTATTLSVLLMLLFIGGSSVFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKENRSK
FT                   "
FT   gene            complement(654530..655630)
FT                   /locus_tag="CPn_0565"
FT   CDS_pept        complement(654530..655630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0565"
FT                   /product="CT449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18705"
FT                   /db_xref="GOA:Q9Z7Y8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Y8"
FT                   /protein_id="AAD18705.1"
FT                   /translation="MKFPRISISDLIPTQMVIWWRGGGNVHYVPNAQNLPKKILGGVLA
FT                   CFGLALLGCAAFAAGVCQTIFPCIGLMILGLVLLGFAYLQYSKGWSRFERPLFRETKVF
FT                   EKPINWLGCLSLLQSWKKIRPGCYYHPGCPQVEICEGSQEIVTKIFQKKSDRNTSIFLI
FT                   QEMDQIALRQGIEKSSLSRKTFAIDPSVVSSLLSEIQREEQQYLDPKVISWSSEDQASD
FT                   RTHPKSAIYVNISDAAQEPQGRCYIDAYTKAFFTVLDQIGDPNIVKKHTIYVLTPILGV
FT                   PDALPKEEQENLKLLSQAAFLYSAEQVAKRMREEKQDSIRIKFIFTDPTSPTSLYFSPH
FT                   HSSTPHSVTPISLSGFVGEQESYTFA"
FT   gene            656141..656893
FT                   /gene="yaeS"
FT                   /locus_tag="CPn_0566"
FT   CDS_pept        656141..656893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeS"
FT                   /locus_tag="CPn_0566"
FT                   /product="YaeS family hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18706"
FT                   /db_xref="GOA:Q9Z7Y7"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y7"
FT                   /protein_id="AAD18706.1"
FT                   /translation="MSLATNNAESKFPSLQRLPNHVAIIMDGNRRWYKKHREECGHTHT
FT                   SGHYYGAKVLPNILNAVLDLGIKVLTLYTFSTENFGRPKEEIQEIFNIFYTQLDKQLPY
FT                   LMENEICLRCIGDLSKLPKGIQTKINHVSRMTASFSRLELVLAVNYGGKDELVRAFKKL
FT                   HVDILNKKISSDDLSESLISSYLDTSGLTDPDLLIRTGGEMRVSNFLLWQIAYTELYIT
FT                   DTLWPDFTPQDLFEAINVYQQRSRRGGK"
FT   gene            656894..657820
FT                   /gene="cdsA"
FT                   /locus_tag="CPn_0567"
FT   CDS_pept        656894..657820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="CPn_0567"
FT                   /product="Phosphatidate Cytidylytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18707"
FT                   /db_xref="GOA:Q9Z7Y6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y6"
FT                   /protein_id="AAD18707.1"
FT                   /translation="MLNSNKFKSKTGAYGDLFQRVVVHSLVLTFLVLLLYSSLFPLTSF
FT                   ALGFITATCGAVGTYEYSSMAKAKMHYPLSTFSAIGSFLFLALSFLSIRWGHSLPGFFD
FT                   ALPWTLLIVWVVWSIFRVRKSTIGALQLSGVTLFSILYVGIPIRLFLHVLYSFIHTQEP
FT                   YLGIWWASFLIATTKGADIFGYFFGKAFGNKKIAPQISPNKTVVGFVAGCLGATLISFI
FT                   FFLQIPTRFASYFPMPAILIPLGLALGITGFFGDIIESIFKRDAHLKNSNKLKAVGGML
FT                   DTLDSLLLSTPIAYLFLLITQSKEFIG"
FT   gene            657817..658467
FT                   /gene="cmk"
FT                   /locus_tag="CPn_0568"
FT   CDS_pept        657817..658467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="CPn_0568"
FT                   /product="CMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18708"
FT                   /db_xref="GOA:Q9Z7Y5"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y5"
FT                   /protein_id="AAD18708.1"
FT                   /translation="MIITIDGPSGTGKSTTAKALADHLHFNYCNTGKMYRTLAYARLQS
FT                   PWATLPLTKFLEEPPFSFTFATGQPLESFFNGHLLTSELTTQEVANAASELSQLPEVRA
FT                   FMQDLQRRYAQLGNCVFEGRDMGSKVFPNADLKIFLTSSPEVRAQRRLKDLPEGTLSPE
FT                   QLQAELVKRDAADAQRAHDPLVIPENGIVIDSSDLTIRQVLEKILALLFRNEL"
FT   gene            658464..659102
FT                   /gene="plsC"
FT                   /locus_tag="CPn_0569"
FT   CDS_pept        658464..659102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="CPn_0569"
FT                   /product="Glycerol-3-P Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18709"
FT                   /db_xref="GOA:Q9Z7Y4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Y4"
FT                   /protein_id="AAD18709.1"
FT                   /translation="MIFRICKFFTWVAFSLFYKLKVYGVKKNFIKGPAIIAVNHNSFLD
FT                   PIALHMCVHECIYHLARASLFNIPWLWKQWGCFPVRQDEGNSAAFKIASRLFNKRKKLV
FT                   IYPEGARSPDGQLQPGKVGIGMMAAKSRVPIIPVYIRGTFEAFNRHQKIPHVWKTITCV
FT                   FGTPMYFDDIIQNPEIKNKETYQIITNQTMNKIAELKAWYESGCKGDVP"
FT   gene            659107..660792
FT                   /gene="argS"
FT                   /locus_tag="CPn_0570"
FT   CDS_pept        659107..660792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="CPn_0570"
FT                   /product="Arginyl tRNA Transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18710"
FT                   /db_xref="GOA:Q9Z7Y3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y3"
FT                   /protein_id="AAD18710.1"
FT                   /translation="MSTLLSILSVICSQAIAKAFPNLEDWAPEITPSTKEHFGHYQCND
FT                   AMKLARVLKKAPRAIAEAIVAELPQEPFSLIEIAGAGFINFTFSPVFLNQQLEHFKDAL
FT                   KLGFQVSQPKKIIIDFSSPNIAKDMHVGHLRSTIIGDSLARIFSYVGHDVLRLNHIGDW
FT                   GTAFGMLITYLQENPCDYSDLEDLTSLYKKAYVCFTNDEEFKKRSQQNVVALQAKDPQA
FT                   IAIWEKICETSEKAFQKIYDILDIVVEKRGESFYNPFLPEIIEDLEKKGLLTVSNDAKC
FT                   VFHEAFSIPFMVQKSDGGYNYATTDLAAMRYRIEEDHADKIIIVTDLGQSLHFQLLEAT
FT                   AIAAGYLQPGIFSHVGFGLVLDPQGKKLKTRSGENVKLRELLDTAIEKAEEALREHRPE
FT                   LTDEAIQERAPVIGINAIKYSDLSSHRTSDYVFSFEKMLRFEGNTAMFLLYAYVRIQGI
FT                   KRRLGISQLSLEGPPEIQEPAEELLALTLLRFPEALESTIKELCPHFLTDYLYNLTHKF
FT                   NGFFRDSHIQDSPYAKSRLFLCALAEQVLATGMHLLGLKTLERL"
FT   gene            complement(660746..662122)
FT                   /gene="murA"
FT                   /locus_tag="CPn_0571"
FT   CDS_pept        complement(660746..662122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="CPn_0571"
FT                   /product="UDP-N-Acetylglucosamine Transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18711"
FT                   /db_xref="GOA:Q9Z7Y2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y2"
FT                   /protein_id="AAD18711.1"
FT                   /translation="MQIAQVFGCGRLNGEVKVSGAKNAATKLLVASLLSDQKCTLRNVP
FT                   DIGDVSLTVELCKSLGAHVSWDKETEVLEIYTPEIQCTRVPPTFSNVNRIPILLLGALL
FT                   GRCPEGVYVPTVGGDAIGERTLNFHFEGLKQLGVQISSDSSGYYAKAPRGLKGNYIHLP
FT                   YPSVGATENLILAAIHAKGRTVIKNVALEAEILDLVLFLQKAGADITTDNDRTIDIFGT
FT                   GGLGSVDHTILPDKIEAASFGMAAVVSGGRVFVRNAKQELLIPFLKMLRSIGGGFLVSE
FT                   SGIEFFQERPLVGGVVLETDVHPGFLTDWQQPFAVLLSQAQGSSVIHETVHENRLGYLH
FT                   GLQHMGAECQLFHQCLSTKACRYAIGNFPHSAVIHGATPLWASHLVIPDLRAGFAYVMA
FT                   ALIAEGGGSIIENTHLLDRGYTNWVGKLRSLGAKIQIFDMEQEELTTSPKSLALRDASL
FT                   "
FT   gene            662352..664619
FT                   /locus_tag="CPn_0572"
FT   CDS_pept        662352..664619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0572"
FT                   /product="CT456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18712"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y1"
FT                   /protein_id="AAD18712.1"
FT                   /translation="MAAPINQPSTTTQITQTGQTTTTTTVGSLGEHSVTTTGSGAAAQT
FT                   SQTVTLIADHEMQEIASQDGSAVSFSAEHSFSTLPPETGSVGATAQSAQSAGLFSLSGR
FT                   TQRRDSEISSSSDGSSISRTSSNASSGETSRAESSPDLGDLDSLSGSERAEGAEGPEGP
FT                   GGLPESTIPHYDPTDKASILNFLKNPAVQQKMQTKGGHFVYVDEARSSFIFVRNGDWST
FT                   AESIKVSNAKTKENITKPADLEMCIAKFCVGYETIHSDWTGRVKPTMEERSGATGNYNH
FT                   LMLSMKFKTAVVYGPWNAKESSSGYTPSAWRRGAKVETGPIWDDVGGLKGINWKTTPAP
FT                   DFSFINETPGGGAHSTSHTGPGTPVGATVVPNVNVNLGGIKVDLGGINLGGITTNVTTE
FT                   EGGGTNITSTKSTSTDDKVSITSTGSQSTIEEDTIQFDDPGQGEDDNAIPGTNTPPPPG
FT                   PPPNLSSSRLLTISNASLNQVLQNVRQHLNTAYDSNGNSVSDLNQDLGQVVKNSENGVN
FT                   FPTVILPKTTGDTDPSGQATGGVTEGGGHIRNIIQRNTQSTGQSEGATPTPQPTIAKIV
FT                   TSLRKANVSSSSVLPQPQVATTITPQARTASTSTTSIGTGTESTSTTSTGTGTGSVSTQ
FT                   STGVGTPTTTTRSTGTSATTTTSSASTQTPQAPLPSGTRHVATISLVRNAAGRSIVLQQ
FT                   GGRSQSFPIPPSGTGTQNMGAQLWAAASQVASTLGQVVNQAATAGSQPSSRRSSPTSPR
FT                   RK"
FT   gene            complement(664688..665404)
FT                   /gene="yebC"
FT                   /locus_tag="CPn_0573"
FT   CDS_pept        complement(664688..665404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebC"
FT                   /locus_tag="CPn_0573"
FT                   /product="YebC family hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18713"
FT                   /db_xref="GOA:Q9Z7Y0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y0"
FT                   /protein_id="AAD18713.1"
FT                   /translation="MAGHSKWANTKHRKERADHKKGKIFSRIIKELISAVKLGGADPKS
FT                   NARLRMVIQKAKENNIPNENIERNLKKATSAEQKNFEEVTYELYGHGGVGIIVEAMTDN
FT                   KNRTASDMRIAINKRGGSLVEPGSVLYNFARKGACTVAKSSIDEEVIFSYAIEAGAEDL
FT                   DTEDEENFLVICAPSELASVKEKLISQGATCSEDRLIYLPLRLVDCDEKDGEANLALID
FT                   WLEQIEDVDDVYHNMS"
FT   gene            complement(665391..665945)
FT                   /locus_tag="CPn_0574"
FT   CDS_pept        complement(665391..665945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18714"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7X9"
FT                   /protein_id="AAD18714.1"
FT                   /translation="MVETVLHNFQRYLSKYLYRVFRFPCRKKTFLSSHRVLARPSFPVD
FT                   YCPGKIYDLQEIYEELNAQLFQGALRLQIGWFGRKATRKGKSVVLGLFHENEQLIRIHR
FT                   SLDRQEIPRFFMEYLVYHEMVHSVVPREYSLSGRSIFHGKKFKEYEQRFPLYDRAVAWE
FT                   KANAYLLRGYKKRVGGGYGRA"
FT   gene            complement(665979..666494)
FT                   /gene="yhhY"
FT                   /locus_tag="CPn_0575"
FT   CDS_pept        complement(665979..666494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhY"
FT                   /locus_tag="CPn_0575"
FT                   /product="Amino Group Acetyl Transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18715"
FT                   /db_xref="GOA:Q9Z7X8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7X8"
FT                   /protein_id="AAD18715.1"
FT                   /translation="MTAEKQNTGILGLEIRYTLPSDATYMLKWLNDPKILRGFPIQTEA
FT                   EIRETVNFWVGFYRYHSSLTAVYNGNVAGVATLVLNPYVKVSHHALISIIVGEEFRNKG
FT                   IGTALLNNLIHLAKTRFKLEVLYLEVYEGNPALHLYQRFGFVEVGRQNRFYKDEIGYLA
FT                   KTTMEKDL"
FT   misc_feature    complement(666491..667598)
FT                   /note="Peptide Chain Release Factor 2; contains natural UGA
FT                   frame-shift"
FT   gene            complement(666491..667543)
FT                   /gene="prfB_1"
FT                   /locus_tag="CPn_0576.1"
FT   gene            complement(667527..667598)
FT                   /gene="prfB_2"
FT                   /locus_tag="CPn_0576.2"
FT   gene            667895..668158
FT                   /locus_tag="CPn_0577"
FT   CDS_pept        667895..668158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0577"
FT                   /product="SWIB (YM74) complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18716"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7X7"
FT                   /protein_id="AAD18716.1"
FT                   /translation="MSQKNKNSAFMHPVNISTDLAVIVGKGPMPRTEIVKKVWEYIKKH
FT                   NCQDQKNKRNILPDANLAKVFGSSDPIDMFQMTKALSKHIVK"
FT   gene            668406..669368
FT                   /gene="yaeI"
FT                   /locus_tag="CPn_0578"
FT   CDS_pept        668406..669368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeI"
FT                   /locus_tag="CPn_0578"
FT                   /product="phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18717"
FT                   /db_xref="GOA:Q9Z7X6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7X6"
FT                   /protein_id="AAD18717.1"
FT                   /translation="MLISISLATLPILAFSWASFIEPNWLRTTAIPWRLPKKHAHLHGL
FT                   RIAQISDLHFHKRVPEKFLNKVSKSIKNFSPDLIVFCGDLLCRARLEDKERLETFLNTL
FT                   EAPLGVFAILGNHDYSSYISRNTKGEITCIPEEKSRPIQRAIIAVMQGLFSSPSYRYDP
FT                   NLTPQEPHPDLLKLLKNTPLTLLHNTTHVIPNTLNIVGLGDLFARQFHPEQAFKNYDPS
FT                   LPGLLLSHNPDGITRLQQYPGDFVLSGHSHGPQVTLSWPKFARKFFERLSGLENPYLAR
FT                   GYFVTKEGKQLYVNRGLGGLKRIRFCSPPEICYITCSYD"
FT   gene            669361..669996
FT                   /gene="yacM"
FT                   /locus_tag="CPn_0579"
FT   CDS_pept        669361..669996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacM"
FT                   /locus_tag="CPn_0579"
FT                   /product="Sugar Nucleotide Phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18718"
FT                   /db_xref="GOA:Q9Z7X5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7X5"
FT                   /protein_id="AAD18718.1"
FT                   /translation="MIKSSLILLSGGQGTRFGSKIPKQYLPLNGTPLVLHSLKILSSLP
FT                   QIAEVIVVCDPSYQETFQEYPVSFAIPGERRQDSVFSGLQQVSYPWVIIHDGARPFIYP
FT                   DEIHDLLETAEKIGATALASPIPYTIKQRNPVRTLDRDNLAIIHTPQCIKTEILREGLA
FT                   LAKEKQLTLVDDIEAAEIIGKPSQLVFNKHPQIKISYPEDLTIAQALL"
FT   gene            669993..670796
FT                   /gene="truA"
FT                   /locus_tag="CPn_0580"
FT   CDS_pept        669993..670796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="CPn_0580"
FT                   /product="Pseudouridylate Synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18719"
FT                   /db_xref="GOA:Q9Z7X4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7X4"
FT                   /protein_id="AAD18719.1"
FT                   /translation="MTKVALLIAYQGTAYSGWQQQPNDLSIQEVIESSLKKITKTRTPL
FT                   IASGRTDAGVHAYGQVAHFRAPDHPLFANANLTKKALNAILPKDIVIRDVALFDDNFHA
FT                   RYLAIAKEYRYSLSRLAKPLPWQRHFCYTPRHPFSTELMQEGANLLIGTHDFASFANHG
FT                   RDYNSTVRTIYTLDIVDKGDSLSIICRGNGFLYKMVRNLVGALLDVGKGAYPPEHLLDI
FT                   LEQKNRREGPSAAPAYGLSLHHVCYSSPYNNFCCEQCSVSTSNEG"
FT   gene            complement(670742..671434)
FT                   /locus_tag="CPn_0581"
FT   CDS_pept        complement(670742..671434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0581"
FT                   /product="Phosphoglycolate Phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18720"
FT                   /db_xref="GOA:A0A0H2ULY7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULY7"
FT                   /protein_id="AAD18720.1"
FT                   /translation="MYLEDYDVFFFDLDGLLVDTEPCFYRAFLQACAEFSLEVHWDFST
FT                   YYSHTTLGTEIFSKKFIEQYPQAQEYMAEIFAKRLQIYYKSLEHAGPALMPGVEAFIEL
FT                   VLSLNKTFGVVTNSPRDATHTLRTMYPILNKFLFWVTRENYARPKPYGDSYDYAYRTFA
FT                   REGMKVIGFEDSVKGLRALSKIPATLVCINSMAEITPEDYPELKGKEFFSYPSFDVLTE
FT                   HCSQQKLL"
FT   gene            671503..672180
FT                   /locus_tag="CPn_0582"
FT   CDS_pept        671503..672180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0582"
FT                   /product="CT465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18721"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7X2"
FT                   /protein_id="AAD18721.1"
FT                   /translation="MILRISTVSLLTSCSFSKNSRTCFVTPERITSQKDCPVLLHPKST
FT                   TISPPLYDWISPNREVITAYSFYCRGQGNSIITPEGVLYDCDGLHHSITKEEFRYIHPR
FT                   LIEVVRLLQQDHPKVSIIEAFCCPKHFHFLEASGISLSQLHLQGTAATFALDPPLPMEK
FT                   LLATIKKLYKKNSDPSLSNFIVTEATLTNPELRLTQQDLGSHTEITVEILDNLQNKEAL
FT                   SSA"
FT   gene            672236..672318
FT                   /locus_tag="CPn_t17"
FT   tRNA            672236..672318
FT                   /locus_tag="CPn_t17"
FT                   /product="tRNA-Leu"
FT   gene            672400..672720
FT                   /locus_tag="CPn_0583"
FT   CDS_pept        672400..672720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0583"
FT                   /product="CT466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18722"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7X1"
FT                   /protein_id="AAD18722.1"
FT                   /translation="MNERTLLLLLKKKKGLFLAILDLTQTESSLTTPELEKVLKQKKIF
FT                   LSCIDRVDLQIKEFRHAFSSELPQDIQEELEEIRDVIIRILDTDKRNYAQKKKEFGIYE
FT                   RP"
FT   gene            672707..673801
FT                   /gene="atoS"
FT                   /locus_tag="CPn_0584"
FT   CDS_pept        672707..673801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoS"
FT                   /locus_tag="CPn_0584"
FT                   /product="2-Component Sensor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18723"
FT                   /db_xref="GOA:A0A0H2ULY8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULY8"
FT                   /protein_id="AAD18723.1"
FT                   /translation="MNVPDSKNLHPPAYELLEIKARITQSYKEASAILTAIPDGILLLS
FT                   ETGHFLICNSQAREILGIDENLEILNRSFTDVLPDTCLGFSIQEALESLKVPKTLRLSL
FT                   CKESKEKEVELFIRKNEISGYLFIQIRDRSDYKQLENAIERYKNIAELGKMTATLAHEI
FT                   RNPLSGIVGFASILKKEISSPRHQRMLSSIISGTRSLNNLVSSMLEYTKSQPLNLKIIN
FT                   LQDFFSSLIPLLSVSFPNCKFVREGAQPLFRSIDPDRMNSVVWNLVKNAVETGNSPITL
FT                   TLHTSGDISVTNPGTIPSEIMDKLFTPFFTTKREGNGLGLAEAQKIIRLHGGDIQLKTS
FT                   DSAVSFFIIIPELLAALPKERAAS"
FT   gene            complement(673862..675817)
FT                   /locus_tag="CPn_0585"
FT   CDS_pept        complement(673862..675817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0585"
FT                   /product="similarity to CHLPS IncA"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18724"
FT                   /db_xref="GOA:Q9Z7W9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7W9"
FT                   /protein_id="AAD18724.1"
FT                   /translation="MATPAQKSPTFQDPSFVRELGSNHPVFSPLTLEERGEMAIARVQQ
FT                   CGWNHTIVKVSLIILALLTILGGGLLVGLLPAVPMFIGTGLIALGAVIFALALILCLYD
FT                   SQGLPEELPPVPEPQQIQIEDLRNETREVLEGTLLEVLLKDRDAKDPAVPQVVVDCEKR
FT                   LGMLDRKLRREEEILYRSTAHLKDEERYEFLLELLEMRSLVADRLEFNRRSYERFVQGI
FT                   MTVRSEEGEKEISRLQDLISLQQQTVQDLRSRIDDEQKRCWTALQRINQSQKDIQRAHD
FT                   REASQRACEGTEMDCAERQQLEKDLRRQLKSMQEWIEMRGTIHQQEKAWRKQNAKLERL
FT                   QEDLRLTGIAFDEQSLFYREYKEKYLSQKLDMQKILQEVNAEKSEKACLESLVHDYEKQ
FT                   LEQKDANLKKAAAVWEEELGKQQQEDYEQTQEIRRLSTFILEYQDSLREAEKVEKDFQE
FT                   LQQRYSRLQEEKQVKEKILEESMNHFADLFEKAQKENMAYKKKLADLEGAAAPTEIGED
FT                   DDWVLTDSASLSQKKIRELVEENQELLKALAFKSNELTQLVADAVEAEKEISKLREHIE
FT                   EQKEGLRALDKMHAQAIKDCEAAQRKCCDLESLLSPVREDAGMRFELEVELQRLQEENA
FT                   QLRAEVERLEQEQFQG"
FT   gene            676026..677186
FT                   /gene="atoC"
FT                   /locus_tag="CPn_0586"
FT   CDS_pept        676026..677186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoC"
FT                   /locus_tag="CPn_0586"
FT                   /product="2-Component Regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18725"
FT                   /db_xref="GOA:A0A0H2ULZ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULZ2"
FT                   /protein_id="AAD18725.1"
FT                   /translation="MAIKNILVVDDEPLLRDFLSELLTSQGFIPDTAENLRNALQMIRS
FT                   RDYDLVISDMSMPDGSGLDLIKIIKQSSPHTPVLVVTAYGSIENAVEAMHQGAFNYLTK
FT                   PFSSEALFAFISKAEELKNLVHENLFLHSQTTPDSHPLIAESKAMKDLLAIAKKAASSS
FT                   ANIFIHGESGCGKEVLSFFIHHNSPRANHPYIKVNCAAIPETLLESELFGHEKGAFTGA
FT                   TTKKAGRFELAHKGTLLLDEITEVPVNLQAKLLRAIQEKEIEHLGGTKTLSVDVRILAT
FT                   SNRKLKEAIDDKSFRQDLYYRLNVIPLHLPPLRDRQDDILPLANYFLNKFCRMNNTPLK
FT                   TLSPKAQELLLNYPWPGNIRELSNVLERVVILENTSLLTEDMLALA"
FT   gene            complement(677264..677337)
FT                   /locus_tag="CPn_t18"
FT   tRNA            complement(677264..677337)
FT                   /locus_tag="CPn_t18"
FT                   /product="tRNA-Arg"
FT   gene            677441..678127
FT                   /gene="yvyD"
FT                   /locus_tag="CPn_0587"
FT   CDS_pept        677441..678127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvyD"
FT                   /locus_tag="CPn_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18726"
FT                   /db_xref="GOA:Q9Z7W7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR016968"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7W7"
FT                   /protein_id="AAD18726.1"
FT                   /translation="MRPHRKHVSSKSLALKQSASTHVEITTKAFRLSMPLKQLILEKSD
FT                   HLPPMETIRVVLTSHKDKLGTEVHVVASHGKEILQTKVHNANPYTAVINAFKKIRTMAN
FT                   KHSNKRKDRTKHDLGLAAKEERIAIQEEQEDRLSNEWLPVEGLDAWDSLKTLGYVPASA
FT                   KKKISKKKMSIRMLSQDEAIRQLESAAENFLIFLNEQEHKIQCIYKKHDGNYVLIEPSL
FT                   KPGFCI"
FT   gene            678084..678629
FT                   /locus_tag="CPn_0588"
FT   CDS_pept        678084..678629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0588"
FT                   /product="CT469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18727"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7W6"
FT                   /protein_id="AAD18727.1"
FT                   /translation="MSLLNLPSSQDSASEDSTSQSQIFDPIRNRELVSTPEEKVRQRLL
FT                   SFLMHKLNYPKKLIIIEKELKTLFPLLMRKGTLIPKRRPDILIITPPTYTDAQGNTHNL
FT                   GDPKPLLLIECKALAVNQNALKQLLSYNYSIGATCIAMAGKHSQVSALFNPKTQTLDFY
FT                   PGLPEYSQLLNYFISLNL"
FT   gene            678640..679398
FT                   /locus_tag="CPn_0589"
FT   CDS_pept        678640..679398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0589"
FT                   /product="CT470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18728"
FT                   /db_xref="GOA:Q9Z7W5"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7W5"
FT                   /protein_id="AAD18728.1"
FT                   /translation="MQICVTGVVLRSRPLGKNHTLTTLFTPEGLFTFFAKQGQTLQCDY
FT                   RETLVPISLGKYTLHRNGSRLPKLTHGDILNAFEAIKQTYALLEASGKMIQALLASQWK
FT                   EKPSHKLFSLFLNFLHRIPESSNPEFFAAIFVLKLLQYEGILDLTPACSLCKASLPYAC
FT                   YRYQGHKLCKKHQHKQAISIEKEEEQILQAIIHAKQFSELLAIAEFPIAIAEKIFYLFD
FT                   SLQEEKKSERNSSEDPYHEILRLSKVVHPY"
FT   gene            complement(679513..680112)
FT                   /locus_tag="CPn_0590"
FT   CDS_pept        complement(679513..680112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0590"
FT                   /product="CT471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7W4"
FT                   /protein_id="AAD18729.1"
FT                   /translation="MGFACRYLFFFIVLFASGSFGNQLLSVPCWLSEEESFYTHRFDFS
FT                   KSYPDMENMEIQAQRKKRVEFNLTGEFPKLETLNYQGSFGHLRAKCRGVYPVLYALNFS
FT                   CSSCKMDMDFRGKWNRSSTITISNQKESINLKLPKDVGVIVNTKTSLKGNVCPGSTFIK
FT                   QGWGVWNKIYHNDLVGFSEVTLIFNVSSEGGTITFS"
FT   gene            680178..680257
FT                   /locus_tag="CPn_t19"
FT   tRNA            680178..680257
FT                   /locus_tag="CPn_t19"
FT                   /product="tRNA-Leu"
FT   gene            680373..681023
FT                   /gene="yagE"
FT                   /locus_tag="CPn_0591"
FT   CDS_pept        680373..681023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagE"
FT                   /locus_tag="CPn_0591"
FT                   /product="YagE family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18730"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7W3"
FT                   /protein_id="AAD18730.1"
FT                   /translation="MRCTAYCTASAYNLHVLFHLLKPRYPTILSREYVLANLDSTQASN
FT                   QLAIFFPFGVAVFWGWEESEEIKLLQTIVTASPEILPQPEIDCYNFHYGDKLQIRRDRL
FT                   TLADTTLNTKLAIAFGLAQSVKLTTFETTIYKTIEDSKRLPQDLATKGKISMSRKAIAK
FT                   KIGKLFLDKASVNLHSDILDEPDFFWDHPETQAIYRDVLSCLDIEARINVLIV"
FT   gene            681153..681464
FT                   /gene="yidD"
FT                   /locus_tag="CPn_0592"
FT   CDS_pept        681153..681464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidD"
FT                   /locus_tag="CPn_0592"
FT                   /product="YidD family"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18731"
FT                   /db_xref="GOA:Q9Z7W2"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7W2"
FT                   /protein_id="AAD18731.1"
FT                   /translation="MSFKRFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAE
FT                   QALKSHGFLMGCWLSIKRIGKCGPWHPGGIDMVPKTALQEVLEPYQEIDGGDSSHFSE"
FT   gene            complement(681388..682476)
FT                   /locus_tag="CPn_0593"
FT   CDS_pept        complement(681388..682476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0593"
FT                   /product="CT474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18732"
FT                   /db_xref="GOA:Q9Z7W1"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7W1"
FT                   /protein_id="AAD18732.1"
FT                   /translation="MAFKRKTRWLWQVLILSVGLNMLFLLLFYSAIFRKDIYKLHLFSG
FT                   PLIAKSSRKVYLSEDFLNEISQASLDDLISLFKDERYMYGRPIKLWALSVAIASHHIDI
FT                   TPVLSKPLTYTELKGSSVRWLLPNIDLKDFPVILDYLRCHKYPYTSKGLFLLIEKMVQE
FT                   GWVDEDCLYHFCSTPEFLYLRTLLVGADVQASSVASLARMVIRCGSERFFHFCNEESRT
FT                   SMISATQRQKVLKSYLDCEESLAALLLLVHDSDVVLHEFCDEDLEKVIRLMPQESPYSQ
FT                   NFFSRLQHSPRRELACMSTQRVEAPRVQEDQDEEYVVQDGDSLWLIAKRFGIPMDKIIQ
FT                   KNGLNHHRLFPGKVLKLPAKQS"
FT   gene            682583..684961
FT                   /gene="pheT"
FT                   /locus_tag="CPn_0594"
FT   CDS_pept        682583..684961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="CPn_0594"
FT                   /product="phenylalanyl tRNA Synthetase Beta"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18733"
FT                   /db_xref="GOA:Q9Z7W0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7W0"
FT                   /protein_id="AAD18733.1"
FT                   /translation="MRIPITLLQTYFSEPLSTKEILEACDHIGIEAEIENTTLYSFASV
FT                   ITAKILHTIPHPNADKLRVATLTDGEKEHQVVCGAPNCEAGLIVALALPGAKLFDSEGQ
FT                   AYTIKKSKLRGVESQGMCCGADELGLDELQIQERALLELPEATPLGEDLATVLGNTSLE
FT                   ISLTPNLGHCASFLGLAREICHVTQANLVIPKEFSFENLPTTALDMGNDPDICPFFSYV
FT                   VITGISAQPSPIKLQESLQALKQKPINAIVDITNYIMLSLGQPLHAYDASHVALDSLRV
FT                   EKLSTPESLTLLNGETVLLPSGVPVVRDDHSLLGLGGVMGAKAPSFQETTTTTVIKAAY
FT                   FLPEALRASQKLLPIPSESAYRFTRGIDPQNVVPALQAAIHYILEIFPEATISPIYSSG
FT                   EICRELKEVALRPKTLQRILGKSFSIEILSQKLQSLGFSTTPQETSLLVKVPSYRHDIN
FT                   EEIDLVEEICRTESWNIETQNPVSCYTPIYKLKRETAGFLANAGLQEFFTPDLLDPETV
FT                   ALTRKEKEEISLQGSKHTTVLRSSLLPGLLKSAATNLNRQAPSVQAFEIGTVYAKHGEQ
FT                   YQETQTLAILLTEDGESRSWLPKPSLSFYSLKGWVERLLYHHHLSIDALTLESSALCEF
FT                   HPYQQGVLRIHKQSFATLGQVHPELAKKAQIKHPVFFAELNLDLLCKMLKKTTKLYKPY
FT                   AIYPSSFRDLTLTVPEDIPANLLRQKLLHEGSKWLESVTIISIYQDKSLETRNKNVSLR
FT                   LVFQDYERTLSNQDIEEEYCRLVALLNELLTDTKGTINS"
FT   gene            684958..685929
FT                   /locus_tag="CPn_0595"
FT   CDS_pept        684958..685929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0595"
FT                   /product="CT476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18734"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V9"
FT                   /protein_id="AAD18734.1"
FT                   /translation="MKQLLFCVCVFAMSCSAYASPRRQDPSVMKETFRNNYGIIVSGQE
FT                   WVKRGSDGTITKVLKNGATLHEVYSGGLLHGEITLTFPHTTALDVVQIYDQGRLVSRKT
FT                   FFVNGLPSQEELFNEDGTFVLTRWPDNNDSDTITKPYFIETTYQGHVIEGSYTSFNGKY
FT                   SSSIHNGEGVRSVFSSNNILLSEETFNEGVMVKYTTFYPNRDPESITHYQNGQPHGLRL
FT                   TYLQGGIPNTIEEWRYGFQDGTTIVFKNGCKTSEIAYVKGVKEGLELRYNEQEIVAEEV
FT                   SWRNDFLHGERKIYAGGIQKHEWYYRGRSVSKAKFERLNAAG"
FT   gene            685939..686460
FT                   /gene="ada"
FT                   /locus_tag="CPn_0596"
FT   CDS_pept        685939..686460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="CPn_0596"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18735"
FT                   /db_xref="GOA:Q9Z7V8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V8"
FT                   /protein_id="AAD18735.1"
FT                   /translation="MADDTLIPKLMKNSLSQACSEGLLIAKYPPLQVIVHFDNNLVVKT
FT                   HLSVAPVFSCLFLGPAAHKAMQEIVLWCSRYANKEHPPFSSHFAKDLIPSQYLEILNCV
FT                   AEIPFGEQQTYAEIAKKTDTHPRTVGAACKQNPFLLFFPCHRVVGSHGERNYVLGPVIH
FT                   EILLKFENSY"
FT   gene            complement(686476..688215)
FT                   /gene="oppC_2"
FT                   /locus_tag="CPn_0597"
FT   CDS_pept        complement(686476..688215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC_2"
FT                   /locus_tag="CPn_0597"
FT                   /product="Oligopeptide Permease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18736"
FT                   /db_xref="GOA:Q9Z7V7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V7"
FT                   /protein_id="AAD18736.1"
FT                   /translation="MQKHPSFYQRFLSAYYKNLLASLSWKFFISVALIGIYAPLFASSK
FT                   PLLVTWHGEIFFPLLRYLFFPGYYTKPVDLFFNVLMVTFPFFILSFKLTRGWLRRWLLG
FT                   LCIISQCMIFAWAYSGKVQDPALAENLKKMRAEKVRENISKVNSEMVMLLPKDTRTWEM
FT                   ERRYMSTYEQLGILIKAKYRKKQEASVKKYQVAFEEKRQSPMPTLRHLEMKNEGICLKR
FT                   LQQRVDKMQRPYEMAQQAWNRATDNYRPFLMALTRIEHELRLADYNNWGQPEDLCIAYA
FT                   NVEKRAEPYKKSLLEIRQVLEDYAKLRSAISFIQDKRLWIEKESEDLRILINPFFSSFH
FT                   WEDDAGGSREMNKYVPWWQLSRVTRKDLLAALVFGIRIALVVAGIGITIALAIGIMIGL
FT                   VSGYFGGTVDMILSRFTEIWETMPVLFILMLVISITQQKSLLLNTVLLGCFSWTGFSRY
FT                   VRIEVLKQRDRGYVLAATNLGYSHYYIMVHQILPNAIVPVISLVPFAMMAMISCEAGLT
FT                   FLGLGEESSASWGNLMREGVTGFPAESAVLWPPAIILTMLLIAIALIGDGVRDALDPRL
FT                   QDS"
FT   gene            complement(688216..689697)
FT                   /gene="oppB_2"
FT                   /locus_tag="CPn_0598"
FT   CDS_pept        complement(688216..689697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB_2"
FT                   /locus_tag="CPn_0598"
FT                   /product="Oligopeptide Permease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18737"
FT                   /db_xref="GOA:Q9Z7V6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V6"
FT                   /protein_id="AAD18737.1"
FT                   /translation="MLKYILKRLVLIPLTLFAIVSINFVILNAAPGDVLEEKSRDALGE
FT                   AGKSDKMRSYKGPDRYLQFREHYGLTLPIFFNTRPKITHKKIQTALQELANANNTTPSA
FT                   KNAAKSLVYWGDCAKFVMPALLFEADDASRDDKYRHIAADLFIRGGVLQGFVGPNLSPE
FT                   QRAQNKEIAESNAFLVRQLNEEDLDTKVEALKGWFQDHGGTEVFCYSSKQFWKTFFLET
FT                   RFARYMSRVLRLDFGTLRNDAHKTVISEVIKRLRCSLVLSILPMIVGFVLCQIFGMIMA
FT                   LKRNRWIDHSLNFIFLILFSIPVFVAVPWILDNFVINKTIPFTTIPMPYSGLRSPPEVF
FT                   NELSTLGRIFDLVSHGFLPFCAVSYGALAAQSRLSRSIFLEVLSQDFICAAKARGLRWF
FT                   DILYKHVGKNAAVSIVTSLASSLGTLLGGALVVETLFNIDGFGNFFYQAILNRDHNVVL
FT                   FSVLVGSALSLVGYLLGDICYVLLDPRVQLEGRRI"
FT   gene            complement(689679..691802)
FT                   /gene="oppA_5"
FT                   /locus_tag="CPn_0599"
FT   CDS_pept        complement(689679..691802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA_5"
FT                   /locus_tag="CPn_0599"
FT                   /product="Oligopeptide Binding Lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18738"
FT                   /db_xref="GOA:Q9Z7V5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V5"
FT                   /protein_id="AAD18738.1"
FT                   /translation="MYKRCVLDKILKGIVAGSLILLYWSSDLLERDIKSIKGNVRDIQE
FT                   DIREISRVVKQQQTSQAIPAAPGVMLAPKLVRDEAFALLFGDPSYPNLLSLDPYKQQTL
FT                   PELLGTNFHPHGILRTAHVGKPENLSPFNGFDYVVGFYDLCIPSLASPHVGKYEEFSPD
FT                   LAVKIEEHLVEDGSGDKEFHIYLRPNVFWRPIDPKALPKHVQLDEVFQRPHPVTAHDIK
FT                   FFYDAVMNPYVATMRAVALRSCYEDVVSVSVENDLKLVVRWKAHTVINEEGKEERKVLY
FT                   SAFSNTLSLQPLPRFVYQYFANGEKIIEDENIDTYRTNSIWAQNFTMHWANNYIVSCGA
FT                   YYFAGMDDEKIVFSRNPDFYDPLAALIDKRFVYFKESTDSLFQDFKTGKIDISYLPPNQ
FT                   RDNFYSFMKSSAYNKQVAKGGAVRETVSADRAYTYIGWNCFSLFFQSRQVRCAMNMAID
FT                   RERIIEQCLDGQGYTISGPFASSSPSYNKQIEGWHYSPEEAARLLEEEGWIDTDGDGIR
FT                   EKVIDGVIVPFRFRLCYYVKSVTAHTIADYVATACKEIGIECSLLGLDMADLSQAFDEK
FT                   NFDALLMGWCLGIPPEDPRALWHSEGAMEKGSANVVGFHNEEADKIIDRLSYEYDLKER
FT                   NRLYHRFHEIIHEEAPYAFLFSRHCSLLYKDYVKNIFVPTHRTDLIPEAQDETVNVTMV
FT                   WLEKKEDPCLSTS"
FT   gene            complement(691824..692147)
FT                   /locus_tag="CPn_0600"
FT   CDS_pept        complement(691824..692147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18739"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V4"
FT                   /protein_id="AAD18739.1"
FT                   /translation="MKIKKSFQYSLCQAKRFQNMLPNHFDPCLQPVNLQLKQDRLAYGE
FT                   LIILLSKYQQKTFSSLLKEETCSLNRAKQHLLYKILRDFNTMQHLRSLGLNGWGEIPMS
FT                   PCL"
FT   gene            complement(692733..693053)
FT                   /locus_tag="CPn_0601"
FT   CDS_pept        complement(692733..693053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0601"
FT                   /product="CT483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18740"
FT                   /db_xref="GOA:Q9Z7V3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V3"
FT                   /protein_id="AAD18740.1"
FT                   /translation="MDEITPNYPLLRQDSLWNRVRVSWRADLSVSSRYEIASAIAILGL
FT                   LVAFCASAAVSIIFTANPLAQVFIDGCLALGLLPIPLVIGLLIIGIIVLLYGIYLFPQQ
FT                   RE"
FT   gene            complement(693101..694105)
FT                   /locus_tag="CPn_0602"
FT   CDS_pept        complement(693101..694105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0602"
FT                   /product="CT484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18741"
FT                   /db_xref="GOA:Q9Z7V2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V2"
FT                   /protein_id="AAD18741.1"
FT                   /translation="MKPLGFQENLEALCNKTSRQLLKYLIKQILFVCGASLLIALEFSF
FT                   FLYFFLFSGKTVIPAFCLACFFLTLFVCLVTRLYLLSGKGDFFEDLASEYLQGAVPPNK
FT                   RSQNIVEEQSHLAAAATKLSINLQNQEYSLLSEIFKFLPKHDLIRKFSCFCFWKDYFLF
FT                   RECLLQKAIEAYIKVVQAIPVDLSAHVSLADAYVALSGLYADPRKYPEFDANYWIPSGR
FT                   YSAEIQEKFFATARRAIEEFQILNEYAPGNAWVHAQLAYSYHDLQMPMEEIQEYEIVLK
FT                   LKPNDVETMSKLGILYFQQGMNAKGLRIYEEIKKRDYKKSQKLIKFYGVEYKY"
FT   gene            694205..695188
FT                   /gene="hemZ"
FT                   /locus_tag="CPn_0603"
FT   CDS_pept        694205..695188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemZ"
FT                   /locus_tag="CPn_0603"
FT                   /product="Ferrochetalase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18742"
FT                   /db_xref="GOA:Q9Z7V1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7V1"
FT                   /protein_id="AAD18742.1"
FT                   /translation="MTTPAYLLANFGGPRHAKDLQEFLISLLTDRDVTGTFLPRVLHRH
FT                   LFTFIAKKRVPKVLPQYQSLQNWSPIYFDTETLAKTLSEILRAPVIPFHRYLPSTHEKT
FT                   LLALRTLHTRHVIGIPLFPHFTYSVTGSIVRFFMKHVPEIPISWIPQFGSDSKFVSLIT
FT                   CHIRDFLQKLGILEKECCFLFSVHGLPVRYISQGDPYSKQCYESFSAITTNFKQSENFL
FT                   CFQSKFGPGKWLSPSTAQLCQNIDTDKPNVIVVPFGFISDHLETLYEIERDYLPLLRSR
FT                   GYRALRIPAIYSSPLWVSTLVDIVKENSTVVAEELIKSGKKHTGIR"
FT   gene            complement(695193..695945)
FT                   /gene="fliY"
FT                   /locus_tag="CPn_0604"
FT   CDS_pept        complement(695193..695945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliY"
FT                   /locus_tag="CPn_0604"
FT                   /product="Glutamine Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18743"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7V0"
FT                   /protein_id="AAD18743.1"
FT                   /translation="MKIKFSWKVNFLICLLAVGLIFFGCSRVKREVLVGRDATWFPKQF
FT                   GIYTSDTNAFLNDLVSEINYKENLNINIVNQDWVHLFENLDDKKTQGAFTSVLPTLEML
FT                   EHYQFSDPILLTGPVLVVAQDSPYQSIEDLKGRLIGVYKFDSSVLVAQNIPDAVISLYQ
FT                   HVPIALEALTSNCYDALLAPVIEVTALIETAYKGRLKIISKPLNADGLRLAILKGTNGD
FT                   LLEGFNAGLVKTRRSGKYDAIKQRYRLP"
FT   gene            complement(696147..696707)
FT                   /gene="yhhF"
FT                   /locus_tag="CPn_0605"
FT   CDS_pept        complement(696147..696707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhF"
FT                   /locus_tag="CPn_0605"
FT                   /product="predicted Methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18744"
FT                   /db_xref="GOA:Q9Z7U9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7U9"
FT                   /protein_id="AAD18744.1"
FT                   /translation="MRILAGKYKGKSLKTFSNPHIRPTSGLVKEAFFSICREDIEGAAF
FT                   LDLFAGMGAIGFEALSRGAASVVFVDISIKAIQLIHTNSALLGEQLPVVIFRQDAQSAI
FT                   QRLIKQKRSFDLIYIDPPYELCNCYVETLLQKIVSGNILNPEGTLFLENASDEEIACEG
FT                   LTLRRRRKLGKTYLAEYIVEKDP"
FT   gene            complement(696704..697444)
FT                   /locus_tag="CPn_0606"
FT   CDS_pept        complement(696704..697444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0606"
FT                   /product="CT488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18745"
FT                   /db_xref="GOA:Q9Z7U8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7U8"
FT                   /protein_id="AAD18745.1"
FT                   /translation="MHIYGLADLHLALGVPEKTMEVFGDPWIGYHQKICSEWQAVVHPE
FT                   DIVLLPGDISWAMNLSEAHKDFAFIGDLPGTKYMIRGNHDYWSSASTSKILQALPPSLY
FT                   YLNQGFALLTPHLAVVGVRLWDSPTICVKKENFLTPSTQEQSYTEQDEKIFLRELGRLK
FT                   RAFAALPKEVTEVIVMTHYPPISSDGTPGPISEFLEADGRVSLCLFGHIHKVQRPIDGF
FT                   GNIRGIHYILVAADYVNFVPQEVM"
FT   gene            complement(697570..698895)
FT                   /gene="glgC"
FT                   /locus_tag="CPn_0607"
FT   CDS_pept        complement(697570..698895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="CPn_0607"
FT                   /product="Glucose-1-P Adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18746"
FT                   /db_xref="GOA:Q9Z7U7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7U7"
FT                   /protein_id="AAD18746.1"
FT                   /translation="MIENDFPEASNFESSHFYRDKVGVIILCGGEGKRLSPLTNCRCKP
FT                   TVSFGGRYKLIDIPISHAISAGFSKIFVIGQYLTYTLQQHLFKTYFYHGVLQDQIHLLA
FT                   PEARQGDQIWYQGTADAIRKNLLYFEDTEIEYFLILSGDQLYNMDFRSIVDTAIRTHVD
FT                   MVLVAQPIPEKDAYRMGVLDIDSEGKLIDFYEKPQEKEVLKRFQLSSEDRRIHKLTEDS
FT                   GDFLGSMGIYLFRRDSLFSLLREEEGNDFGKHLIQAQMKRGQVQTLLYNGYWADIGTIE
FT                   SYYEANIALTQKPHAEKRGLNCYDDNGMIYSKNHHLPGAIITDSMISSSLLCEGCVINT
FT                   SHVSRSVLGIRSKIGENSVVDQSIIMGNARYGSPSMPSLGIGKDCEIRKAIIDENCCIG
FT                   NGVKLQNLKGYIKYDSPDKKLFVRDNIIIVPQGTHIPDNYIF"
FT   gene            complement(699013..699645)
FT                   /locus_tag="CPn_0608"
FT   CDS_pept        complement(699013..699645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0608"
FT                   /product="Uridine 5'-Monophosphate Synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18747"
FT                   /db_xref="GOA:Q9Z7U6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7U6"
FT                   /protein_id="AAD18747.1"
FT                   /translation="MMNYEDAKLRGQAVAILYQIGAIKFGKHILASGEETPLYVDMRLV
FT                   ISSPEVLQTVATLIWRLRPSFNSSLLCGVPYTALTLATSISLKYNIPMVLRRKELQNVD
FT                   PSDAIKVEGLFTPGQTCLVINDMVSSGKSIIETAVALEENGLVVREALVFLDRRKEACQ
FT                   PLGPQGIKVSSVFTVPTLIKALIAYGKLSSGDLTLANKISEILEIES"
FT   gene            699705..699989
FT                   /locus_tag="CPn_0609"
FT   CDS_pept        699705..699989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0609"
FT                   /product="CT490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18748"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7U5"
FT                   /protein_id="AAD18748.1"
FT                   /translation="MLIRLFLGISLPKGFPLYLEPPLVLATFQGTQFVGTYSEATNPLY
FT                   IDNLNLNYHYTQELLYKAVPCNYKSIYREIPLIIFPEVLIGSTPTQSTE"
FT   gene            complement(700026..701420)
FT                   /gene="rho"
FT                   /locus_tag="CPn_0610"
FT   CDS_pept        complement(700026..701420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="CPn_0610"
FT                   /product="Transcription Termination Factor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18749"
FT                   /db_xref="GOA:Q9Z7U4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7U4"
FT                   /protein_id="AAD18749.1"
FT                   /translation="MKEERSSEILPRVKETKKHAYVSMQEKSCVGECAVVASESEEAES
FT                   VTVTKIAKLQRMGIEELNILARQYGVKNIGSLTKSQVVFEIVKAKSERPDELLIGEGVL
FT                   EVLPDGFGFLRSPTYNYLPSAEDIYVSPAQIRRFDLKKGDTIIGTIRSPKEKEKYFALL
FT                   KVDKINGSTPDKAKERVLFENLTPLYPNQRIVMEMGKDHLAERVLDLTAPIGKGQRGLI
FT                   VAPPRSGKTVILQSIAHAIAVNNPDIVLIVLLIDERPEEVTDMIRQVRGEVVASTFDEQ
FT                   PERHIQVAEMVIEKARRLVEHGNDVVILLDSITRLARAYNTVQPHSGKILTGGVDASAL
FT                   HKPKRFFGAARNIEGGGSLTILATALIDTGSRMDEVIFEEFKGTGNMELVLDRRLSDRR
FT                   TYPAIDLIKSGTRKEELLYHPSELERVYLFRQAIADLTTIDAMHLLLGRLKKTNSNAEF
FT                   LLSLKE"
FT   gene            complement(701417..702025)
FT                   /gene="yacE"
FT                   /locus_tag="CPn_0611"
FT   CDS_pept        complement(701417..702025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacE"
FT                   /locus_tag="CPn_0611"
FT                   /product="predicted phosphatase/kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18750"
FT                   /db_xref="GOA:Q9Z7U3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7U3"
FT                   /protein_id="AAD18750.1"
FT                   /translation="MLKLLKVSITGDLSSGKTEACQVFQELGAYVVSADEISHSFLIPH
FT                   TRIGRRVIDLLGSDVVVDGAFDAQAIAAKVFYNSVLLQGLEAILHPEVCRIIEEQYHQS
FT                   IQDGNYPLFVAEVPLLYEIHYAKWFDSVILVMANEDIRRERFMKKTGRSSEDFDQRCSR
FT                   FLNVEEKLAQADVVVENNGTKKELHQKIEEYFYALKGAL"
FT   gene            complement(702019..704631)
FT                   /gene="polA"
FT                   /locus_tag="CPn_0612"
FT   CDS_pept        complement(702019..704631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="CPn_0612"
FT                   /product="DNA Polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18751"
FT                   /db_xref="GOA:Q9Z7U2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7U2"
FT                   /protein_id="AAD18751.1"
FT                   /translation="MKKLFVLDASGFIFRAYFALPEMKNHQGQATQAVFGFIRSLNKLI
FT                   KEFSPEYMISVFDGPNNKQSRQAIYADYKSNRQKKFEDIPPQIALVKEYCSLIGLAYLE
FT                   KESVEADDVIASIAKKAREENYKVYVCTADKDLLQLVNDHVVAWNPWADQGVVGISEVI
FT                   ERYGIPPGNIPDYLALVGDSSDNIPGLPGCGPKKAAALLKQFGSVEGLLENLDAVKGLS
FT                   QTMLSERQETLKLSKRLALLDSNIPIPVPIESLTFPQHPVDEEKLIHFYIQQGFKTLVP
FT                   SKQTEAATVDVQIIKDAESLTNILNLVQGGDIAFAVAYTGNHLLSLKLEGLALTQGSGV
FT                   FFIALEEEGTKILPILKDFFLREDLTFYGYNLKRDCHALLNAGIVIREISYDLALAEHL
FT                   TNGGGKISFQSLLVNHGFTETAHRFAKEWGNSGLPIGRLPEQPEQYFGEFVAYLPIIKD
FT                   AILEEINRKNLNHILSDIEMPLEKVLFSMERAGVPLDVEELAILEALFETELAVLTEEI
FT                   YDLSGRPFNIKSPKQLSDILYNELGLRPIDKAKSTRAEVLEALRSEHPIIEKLLAFRTI
FT                   EKLLSTYVKALPKQVDSHTQRIHPSFDQTGAVTGRLACRDPNLQNIPIRSERGILLRKA
FT                   FRLSEKNSYFLSADYSQIELRFLAHLSQDKSLKFAFESGEDIHAFTASQVFHVPLEQVS
FT                   KEQRMQAKTVNFGIVYGQQAFGLAKVLKISIGEAQELIQAYFSRYPEIAHFVEETIQQA
FT                   AKDLRVTTMLGRERIIDSWNEFPGSRAASGRFAVNTRIQGSAAELIKLAMLDISQAIKQ
FT                   QQMKSRMLLQIHDELLFEVPEEEIEEMQRLVREKMESAMTLSVPIVVNILIGKNWAEC"
FT   gene            complement(704655..705656)
FT                   /gene="sohB"
FT                   /locus_tag="CPn_0613"
FT   CDS_pept        complement(704655..705656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /locus_tag="CPn_0613"
FT                   /product="Protease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18752"
FT                   /db_xref="GOA:Q9Z7U1"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7U1"
FT                   /protein_id="AAD18752.1"
FT                   /translation="MKTLWHFVSKAFLSIVGLCCGVVLAFVVIFALIASSLGNGDATFV
FT                   SLPDAQGEVKDLGKTAPIIAVIEMKDVIASSKNTAKTIQNILEGFEKAPLKDRVKGIVI
FT                   DMDCPGGEVFEIDRIYSMLRFWKERKGFPIYIYVNGLCASGGYYVSCAATKIYATSSSL
FT                   IGSIGVRSGPFFNVKEGLNRYGVESDLLTAGKDKAPMNPYTPWTSHDREERQATLDFLY
FT                   GQFVDIVTQNRPLLTKEKLVHTLGARIFSPEKAKQEGYIDVVGATKEQVLQDIVAVCKI
FT                   EDNYRVIGSGGDGWWKRVASAAASSPLVTGMIKHDILPLSHDAAYIPPYLAL"
FT   gene            complement(705780..707402)
FT                   /gene="adt_2"
FT                   /locus_tag="CPn_0614"
FT   CDS_pept        complement(705780..707402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adt_2"
FT                   /locus_tag="CPn_0614"
FT                   /product="ADP/ATP Translocase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18753"
FT                   /db_xref="GOA:Q9Z7U0"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7U0"
FT                   /protein_id="AAD18753.1"
FT                   /translation="MQSSEVKPFSRLRAYLCPIYKSEFSKFVPLFLLAFFVGFNYCLLK
FT                   NMKDTLVIVGSDAGAEVIPFLKVWGIVPGAVIVTMVYGWLGSRYPRDTVFYCFMAAFLG
FT                   FFFLFAVIIYPVGDSLHLNSLADKLQELLPQGLRGFIVMVRYWSYSIYYVMSELWSSVV
FT                   LSMLFWGLANQITTITEAGRFYALINTGLNLSSICAGEISYWMGKQTFVAYSFACDSWH
FT                   SVMLNLTMLITCSGLIMIWLYRRIHHLTIDTSIPPSRRVLAEEGAATANLKEKKKPKAK
FT                   ARNLFLHLIQSRYLLGLAIIVLSYNLVIHLFEVVWKDQVSQIYSSHVEFNGYMSRITTL
FT                   IGVVSVLAAVLLTGQCIRKWGWTVGALVTPLVMLVSGLLFFGTIFAAKRDISIFGGVLG
FT                   MTPLALAAWTGGMQNVLSRGTKFTFFDQTKEMAFIPLSPEDKNHGKAAIDGVVSRIGKS
FT                   GGSLIYQGLLVIFSSVAASLNVIALVLLIIMVVWIAVVAYIGKEYYSRAADAVATLKQP
FT                   KEPSSSIVREAQESVEQEEMAVL"
FT   gene            complement(707631..708137)
FT                   /gene="pgsA_1"
FT                   /locus_tag="CPn_0615"
FT   CDS_pept        complement(707631..708137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA_1"
FT                   /locus_tag="CPn_0615"
FT                   /product="Glycerol-3-P Phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18754"
FT                   /db_xref="GOA:Q9Z7T9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7T9"
FT                   /protein_id="AAD18754.1"
FT                   /translation="MRQFCNLLSLSRLWLALYFCQEKLHIRLLAIVGAMLSDVLDGYLA
FT                   RRYKATSRLGSILDPITDKVFVFVCITVLYMEGSLSIAHLFFICARDLFLIIFVCYLSL
FT                   VKGWKGYDYGSLFWGKIFTVVQFIILLGVTAGGEIPWTGLVPLVALGFLYFLERIMDYK
FT                   KQFLR"
FT   gene            708359..708440
FT                   /locus_tag="CPn_t20"
FT   tRNA            708359..708440
FT                   /locus_tag="CPn_t20"
FT                   /product="tRNA-Ser"
FT   gene            708791..710140
FT                   /gene="dnaB"
FT                   /locus_tag="CPn_0616"
FT   CDS_pept        708791..710140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="CPn_0616"
FT                   /product="Replicative DNA Helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18755"
FT                   /db_xref="GOA:A0A0H2ULZ6"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ULZ6"
FT                   /protein_id="AAD18755.1"
FT                   /translation="MIVLGCMLTGVHYLNLAANQLYEEDFYYLEHKIIFRVLQDAFKQD
FT                   KPIDVHLAGEELKRHNQITVIGGPSYLITLAEFAGTAAYLEEYVDIIRSKSILRKMIST
FT                   AKEIEKRALEQPKNVAEALDEAQNSFFKISQSTSVSQYTLVADKLRGLTTTTDKPYLVQ
FT                   LQERQELFLQNAQGDNKSFFTGIPTHFIDLDQLIHGFSPSNLMILAARPAMGKTALALN
FT                   IAENLCFQNRLPIGIFSLEMTVDQLIHRMICSRSEVDSKKISIGDLSGHDFQRIVSVIN
FT                   EMQEHTLLIDDQPGLKVSDLRARARRMKESYDIQFLIIDYLQLLSGSGTLRATESRQTE
FT                   ISEISRMLKTLARELNIPILCLSQLSRKVEDRANHRPMMSDLRESGSIEQDSDLVMFLL
FT                   RREYYDPNDKPGTAELIIAKNRHGSIGSVPLVFEKELARFRNYSAFECIS"
FT   gene            710484..712319
FT                   /gene="gidA"
FT                   /locus_tag="CPn_0617"
FT   CDS_pept        710484..712319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="CPn_0617"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18756"
FT                   /db_xref="GOA:Q9Z7T7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T7"
FT                   /protein_id="AAD18756.1"
FT                   /translation="MWTHPIAYDVIVVGAGHAGCEAAYCSAKMGVSVLMLTSNLDTIAK
FT                   LSCNPAVGGIGKGHIVREIDALGGIMAEVTDQSGIQFRILNQTKGPAVRAPRAQVDKQL
FT                   YHIHMKRLLENTPGLHIMQATVESLLDKEGVISGVTTKEGWMFSGKTVVLSSGTFMRGL
FT                   IHIGDRNFSGGRLGDPSSQGLSEDLKKRGFPISRLKTGTPPRLLASSINFSCMEEQPGD
FT                   LGVGFVHRTEPFQPPLPQLSCFITHTMEKTKAIISANLHRSALYGGCIEGVGPRYCPSI
FT                   EDKIVKFSDKERHHVFLEPEGLHTQEIYANGLSTSMPFDVQYDMIRSVLGLENAIITRP
FT                   AYAIEYDYIHGNVIHPTLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGINAVNKVFNR
FT                   PPFIPSRQESYIGVMLDDLTTQILDEPYRMFTGRAEHRLLLRQDNACARLSHYGYELGL
FT                   LSEERYELVKKQNQLLEEEKVRLQKTFRQYGQSVVSLAKALSRPEVSYDMLREAFPNDI
FT                   RDLGAVLNASLEMEIKYSGYIDRQKILIQSLEKAESLLIPEDLDYKQITALSLEAQEKL
FT                   AKFTPRTLGSASRISGIASADIQVLMIALKKHAHH"
FT   gene            712306..713013
FT                   /gene="lplA_2"
FT                   /locus_tag="CPn_0618"
FT   CDS_pept        712306..713013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA_2"
FT                   /locus_tag="CPn_0618"
FT                   /product="Lipoate-Protein Ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18757"
FT                   /db_xref="GOA:Q9Z7T6"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7T6"
FT                   /protein_id="AAD18757.1"
FT                   /translation="MPTTNCIFLDLRGHSILHQLQIEEALLRVANQNFCIINSGAKDSI
FT                   VLGISRNLNQDVHISRAQADHIPIIRRYSGGGTVFIDSNTLMVSWIMNSSEASAQPQEL
FT                   LAWTYGIYSPLLPNTFSIRENDYVLGHKKIGGNAQYIQRHRWVHHTTFLWDIDLDKLSY
FT                   YLPIPQQQPTYRNQRSHEEFLTTLRPWFPSRDDFLERIKASGSLLFTWEEFLDNELEEI
FT                   LAQPHRKATTVLN"
FT   gene            complement(713010..713444)
FT                   /gene="ndk"
FT                   /locus_tag="CPn_0619"
FT   CDS_pept        complement(713010..713444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="CPn_0619"
FT                   /product="Nucleoside-2-P Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18758"
FT                   /db_xref="GOA:Q9Z7T5"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T5"
FT                   /protein_id="AAD18758.1"
FT                   /translation="MEQTLSIIKPDSVSKAHIGEILSIFEQSGLRIAAMKMMHLSQTEA
FT                   EGFYFVHRERPFFQELVDFMVSGPVVVLVLEGANAVSRNRELMGATNPAEAASGTIRAK
FT                   FGESIGVNAVHGSDTLENAAVEIAYFFSKIEVVNASKPLV"
FT   gene            complement(713516..714139)
FT                   /gene="ruvA"
FT                   /locus_tag="CPn_0620"
FT   CDS_pept        complement(713516..714139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="CPn_0620"
FT                   /product="Holliday Junction Helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18759"
FT                   /db_xref="GOA:Q9Z7T4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T4"
FT                   /protein_id="AAD18759.1"
FT                   /translation="MYDYIRGTLTYVHTGAIVIECQGIGYHIAITERWAIECIRALHQD
FT                   FLVFTHVIFRETEHLLYGFHSREERECFRILISFSGIGPKLALAILNALPLKVLCSVVR
FT                   SEDIRALASVSGIGKKTAEKLMVELKQKLPDLLPLDSRVETSQTHTTSSCLEEGIQALA
FT                   ALGYSKIAAERMIAEAIKDLPEGSSLTDILPIALKKNFSGVNKD"
FT   gene            complement(714141..714647)
FT                   /gene="ruvC"
FT                   /locus_tag="CPn_0621"
FT   CDS_pept        complement(714141..714647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="CPn_0621"
FT                   /product="Crossover Junction Endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18760"
FT                   /db_xref="GOA:Q9Z7T3"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T3"
FT                   /protein_id="AAD18760.1"
FT                   /translation="MSELIIGVDPGTIVAGYAIIAVEQRYQLRPYSYGAIRLSSDMPLP
FT                   MRYKTLFEQLSGVLDDTQPNAMVLETQFVNKNPQSTMKLAMARGIVLLAAAQRDILIFE
FT                   YAPNVAKKAVVGKGHASKRQVQVMVSKILNVPEVLHPSNEDIADAFALAICHTHVARSP
FT                   LCGVR"
FT   gene            complement(714790..715752)
FT                   /locus_tag="CPn_0622"
FT   CDS_pept        complement(714790..715752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0622"
FT                   /product="CT503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18761"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7T2"
FT                   /protein_id="AAD18761.1"
FT                   /translation="MRLLSILKLHLFSLRSSSSLSPHYYHSCSRSMLHLLCRWKDADIM
FT                   EWQQICNILSGVCSRMSGKLVSLQKETQDSCHQEHERIHLQYREQLSALEEEYRRREEA
FT                   KNQDLEKLQQENTWLQNRLAEKLQQIRHQSDIIDEIKKELLQSVQRTEISEGRRLCYEH
FT                   KIKQLEEQLQRYVSQHGAPSIEIEEDKSSAAYAEINRLKKSLIDLQQEKDIYIKTYHSE
FT                   IAKLREKLQRQEGAQTSSEVCSIEKLTEVQTDLAEKKKAIALLQDIVEDQYCQLRDLHK
FT                   EKGMAMPSNTKLDHLKGLLGKEPESEVDVVFSESKSLGS"
FT   gene            715889..715971
FT                   /locus_tag="CPn_t21"
FT   tRNA            715889..715971
FT                   /locus_tag="CPn_t21"
FT                   /product="tRNA-Leu"
FT   gene            complement(716160..716993)
FT                   /locus_tag="CPn_0623"
FT   CDS_pept        complement(716160..716993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0623"
FT                   /product="CT504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T1"
FT                   /protein_id="AAD18762.1"
FT                   /translation="MYFTRDPVIETVITSREGYKLSVRNTKHFSQDPFMVEAIEVISLG
FT                   NICFFRNCDHSKPFLVPAGDYEVMEVRDTKINLKAVGLDRGVKIAGGREALIKLTKSTP
FT                   LPVIDEKPLADSPEEGTEPTSPSKKEKKEARKDSFKGEKWKEKKKLSRRRNHKEIAEVT
FT                   GASQEILDTVKEELWEESQENEIVEQKKFSLLPPPAKLISEVISQTVVDPVVTSADLNE
FT                   SLQALVRESSDLINALLSADDAIHFPETEEEPTSASFEESSAMFFPETSSATEEE"
FT   gene            complement(717008..718015)
FT                   /gene="gapA"
FT                   /locus_tag="CPn_0624"
FT   CDS_pept        complement(717008..718015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="CPn_0624"
FT                   /product="Glyceraldehyde-3-P Dehyrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18763"
FT                   /db_xref="GOA:Q9Z7T0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T0"
FT                   /protein_id="AAD18763.1"
FT                   /translation="MKVVINGFGRIGRLVLRQILKRNSSVEVLAINDLVPGDALTYLFK
FT                   FDSTHGRFPEDVRCEADHLIVGKRKIQFLSERNVQNLPWKDLGVDLVIECTGLFTKKED
FT                   AEKHIQAGAKRVLISAPGKGDIPTFVMGVNHKTFNPEKDFVISNASCTTNCLAPIAKVL
FT                   LDNFGITEGLMTTVHAATATQLVVDGPSKKDWRGGRGCLQNIIPASTGAAKAVTLCLPE
FT                   LKGKLTGMAFRVPIEDVSVVDLTVRLDKSTTYDDICKAMKQASETDLKGILDYTDEQVV
FT                   SSDFIGSEYSSIFDALAGIALNDRFFKLVAWYDNETGYATRIVDLLEYVEKNSK"
FT   gene            complement(718057..718485)
FT                   /gene="rl17"
FT                   /locus_tag="CPn_0625"
FT   CDS_pept        complement(718057..718485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl17"
FT                   /locus_tag="CPn_0625"
FT                   /product="L17 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18764"
FT                   /db_xref="GOA:Q9Z7S9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S9"
FT                   /protein_id="AAD18764.1"
FT                   /translation="MQHARKKFRVGRTSSHNRCMLANMLKSLIHYERIETTLPKAKELR
FT                   RHADKMITLAKKNSLAARRIAIGRLMVRYNKLTSKEARQAKGGDTSVYNVDRLVVNKLF
FT                   DELGNRFVERKGGYTRILKLQNRIGDNAQKCIIEFLAS"
FT   gene            complement(718492..719616)
FT                   /gene="rpoA"
FT                   /locus_tag="CPn_0626"
FT   CDS_pept        complement(718492..719616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="CPn_0626"
FT                   /product="RNA Polymerase Alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18765"
FT                   /db_xref="GOA:Q9Z7S8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S8"
FT                   /protein_id="AAD18765.1"
FT                   /translation="MSDNAHNLLYDKFELPEAVKMLPVEGLPIDKHARFIAEPLERGMG
FT                   HTLGNALRRALLIGLEAPAIISFAMTGVLHEYMAIEGVIEDVTNIILNLKGALLKKYPM
FT                   QDSSLGRTTQVLKASISIDASDLAAANGQKEVTLQDLLQEGDFEAVNPDQVIFTVTQPI
FT                   QLEVVLRIAFGRGYTPSERIVLEDKGVYEIVLDAAFSPVTLVNYFVEDTRVGQDTDFDR
FT                   LVLIVETDGRVTPKEALAFSTQILTKHFSIFENMDEKKIVFEEAISIEKENKDDILHKL
FT                   ILGINEIELSVRSTNCLSNANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLKEMKL
FT                   ELGMDLTQFGVGLDNVKEKMKWYAEKIRAKNTKG"
FT   gene            complement(719637..720038)
FT                   /gene="rs11"
FT                   /locus_tag="CPn_0627"
FT   CDS_pept        complement(719637..720038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs11"
FT                   /locus_tag="CPn_0627"
FT                   /product="S11 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18766"
FT                   /db_xref="GOA:Q9Z7S7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S7"
FT                   /protein_id="AAD18766.1"
FT                   /translation="MVKNQAQAKKSVKRKQLKNIPSGVVHVKATFNNTIVSITDPAGNV
FT                   ISWASAGKVGYSGSRKSSAFAATVAAQDAAKTAMNSGLKEVEVCLKGTGAGRESAVRAL
FT                   ISAGLVVSVIRDETPVPHNGCRPRKRRRV"
FT   gene            complement(720060..720428)
FT                   /gene="rs13"
FT                   /locus_tag="CPn_0628"
FT   CDS_pept        complement(720060..720428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs13"
FT                   /locus_tag="CPn_0628"
FT                   /product="S13 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18767"
FT                   /db_xref="GOA:Q9Z7S6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S6"
FT                   /protein_id="AAD18767.1"
FT                   /translation="MPRIIGIDIPAKKKLKISLTYIYGIGSARSDEIIKKLKLDPEARA
FT                   SELTEEEVGRLNSLLQSEYTVEGDLRRRVQSDIKRLIAIHSYRGQRHRLSLPVRGQRTK
FT                   TNSRTRKGKRKTVAGKKK"
FT   gene            complement(720484..721857)
FT                   /gene="secY"
FT                   /locus_tag="CPn_0629"
FT   CDS_pept        complement(720484..721857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="CPn_0629"
FT                   /product="Translocase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18768"
FT                   /db_xref="GOA:Q9Z7S5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S5"
FT                   /protein_id="AAD18768.1"
FT                   /translation="MTTLRQFFLITELRQKLFYTFALLTACRVGVFIPVPGINGELAVA
FT                   YFKQLLGSGQNLFQLADIFSGGAFAQMTVIALGVVPYISASIIVQLFLVFMPALQREMR
FT                   ESSDQGKRRIGRLTRLFTVALAVIQSLLFAKFALRMNLTIPGIVLPTLLSSKLFGVPWI
FT                   FYITTVVVMTTGTLLLMWIGEQISDKGIGNGISLIIALGILSSFPSVLGSIVNKLNLGS
FT                   QDSSDLGLISILILALVFVFVLITTILIIEGVRKIPVQYARRVIGRREVPGGGSYLPLK
FT                   VNYAGVIPVIFASSLLMFPATIGQFIASESSWMKRIAALLAPGSLVYSICYVLLIIFFT
FT                   YFWTATQFHPEQIASEMKKNNAFIPGIRQGKPTQHYLEYTMNRVTLLGALFLAAIAILP
FT                   SLLGCLLRVDSNVSYFLGGTAMLIVVGVVLDTMKQVDAFLLMRRYDSVLKTDRTKGRH"
FT   gene            complement(721882..722316)
FT                   /gene="rl15"
FT                   /locus_tag="CPn_0630"
FT   CDS_pept        complement(721882..722316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl15"
FT                   /locus_tag="CPn_0630"
FT                   /product="L15 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18769"
FT                   /db_xref="GOA:Q9Z7S4"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S4"
FT                   /protein_id="AAD18769.1"
FT                   /translation="MIKLESLFDISERKRRKKLLGRGPSSGHGKTSGRGHKGDGSRSGY
FT                   KRRFGYEGGGVPLYRRVPTRGFSHKRFDKCVEEITTGRLAELFQEGEAITLDALKAKKA
FT                   IARQAVRVKVILKGDLEKTFVWQDTAVVLSQGVQNLLGIT"
FT   gene            complement(722309..722806)
FT                   /gene="rs5"
FT                   /locus_tag="CPn_0631"
FT   CDS_pept        complement(722309..722806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs5"
FT                   /locus_tag="CPn_0631"
FT                   /product="S5 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18770"
FT                   /db_xref="GOA:Q9Z7S3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S3"
FT                   /protein_id="AAD18770.1"
FT                   /translation="MSLSKNSHKEDQLEEKVLVVNRCSKVVKGGRKFSFSALILVGDGK
FT                   GRLGYGFAKANELTDAIRKGGEAAKKNLMKIEALEDGSIPHEVLVHHDGAQLLLKPAKP
FT                   GTGIVAGSRIRLILEMAGIKDIVAKSFGSNNPMNQVKAAFKALTGLSPRKDLLRRGAAI
FT                   ND"
FT   gene            complement(722824..723195)
FT                   /gene="rl18"
FT                   /locus_tag="CPn_0632"
FT   CDS_pept        complement(722824..723195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl18"
FT                   /locus_tag="CPn_0632"
FT                   /product="L18 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18771"
FT                   /db_xref="GOA:Q9Z7S2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S2"
FT                   /protein_id="AAD18771.1"
FT                   /translation="MESSLCKKSLMKRRRALRVRKVLKGSPTKPRLSVVKTNKHIYVQL
FT                   IDDSIGKTLASVSTLSKLNKSQGLTKKNQEVAKVLGTQIAELGKNLQLDRVVFDRGPFK
FT                   YHGIVSMVADGAREGGLQF"
FT   gene            complement(723206..723757)
FT                   /gene="rl6"
FT                   /locus_tag="CPn_0633"
FT   CDS_pept        complement(723206..723757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl6"
FT                   /locus_tag="CPn_0633"
FT                   /product="L6 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18772"
FT                   /db_xref="GOA:Q9Z7S1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S1"
FT                   /protein_id="AAD18772.1"
FT                   /translation="MSRKAREPILLPQGVEVSIQDDKIIVKGPKGSLTQKSVKEVEITL
FT                   KDNSIFVHAAPHVVDRPSCMQGLYWALISNMVQGVHLGFEKRLEMIGVGFRASVQGAFL
FT                   DLSIGVSHPTKIPIPSTLQVSVEKNTLISVKGLDKQLVGEFAASIRAKRPPEPYKGKGI
FT                   RYENEYVRRKAGKAAKTGKK"
FT   gene            complement(723784..724185)
FT                   /gene="rs8"
FT                   /locus_tag="CPn_0634"
FT   CDS_pept        complement(723784..724185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs8"
FT                   /locus_tag="CPn_0634"
FT                   /product="S8 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18773"
FT                   /db_xref="GOA:Q9Z7S0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S0"
FT                   /protein_id="AAD18773.1"
FT                   /translation="MGMTSDSIADLLTRIRNALMAEHLYVDVEHSKMREAIVKILKHKG
FT                   FVAHYLVKEENRKRAMRVFLQYSDDRKPVIHQLKRVSKPSRRVYVSAAKIPYVFGNMGI
FT                   SVLSTSQGVMEGSLARSKNIGGELLCLVW"
FT   gene            complement(724203..724745)
FT                   /gene="rl5"
FT                   /locus_tag="CPn_0635"
FT   CDS_pept        complement(724203..724745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl5"
FT                   /locus_tag="CPn_0635"
FT                   /product="L5 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18774"
FT                   /db_xref="GOA:Q9Z7R9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R9"
FT                   /protein_id="AAD18774.1"
FT                   /translation="MSRLKKFYTEEIRKSLFEKFGYANKMQIPVLKKIVLSMGLAEAAK
FT                   DKNLFQAHLEELTMISGQKPLVTKARNSIAGFKLREGQGIGAKVTLRGIRMYDFMDRFC
FT                   NIVSPRIRDFRGFSNKGDGRGCYSVGLDDQQIFPEINLDRVKRTQGLNITWVTTAQTDD
FT                   ECTTLLELMGLRFKKAQ"
FT   gene            complement(724747..725082)
FT                   /gene="rl24"
FT                   /locus_tag="CPn_0636"
FT   CDS_pept        complement(724747..725082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl24"
FT                   /locus_tag="CPn_0636"
FT                   /product="L24 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18775"
FT                   /db_xref="GOA:Q9Z7R8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R8"
FT                   /protein_id="AAD18775.1"
FT                   /translation="MKKQNIRVGDKVFILAGNDKGKEGKVLSLTEDKVVVEGVNVRIKN
FT                   IKRSQQNPKGKRISIEAPIHISNVRLTIAGEPAKLSVKVTEQGRELWQRRPDGTSQLYR
FT                   LVRGKKG"
FT   gene            complement(725096..725464)
FT                   /gene="rl14"
FT                   /locus_tag="CPn_0637"
FT   CDS_pept        complement(725096..725464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl14"
FT                   /locus_tag="CPn_0637"
FT                   /product="L14 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18776"
FT                   /db_xref="GOA:Q9Z7R7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R7"
FT                   /protein_id="AAD18776.1"
FT                   /translation="MIQQESQLKVADNTGAKKVKCFKVLGGSRRRYATVGDVIVCSVRD
FT                   VEPNSSIKKGDVIKAVIVRTRRHITRKDGSTLKFDTNSCVIIDDKGNPKGTRIFGPVAR
FT                   EIRDRGFIKISSLAPEVI"
FT   gene            complement(725487..725747)
FT                   /gene="rs17"
FT                   /locus_tag="CPn_0638"
FT   CDS_pept        complement(725487..725747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs17"
FT                   /locus_tag="CPn_0638"
FT                   /product="S17 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18777"
FT                   /db_xref="GOA:Q9Z7R6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R6"
FT                   /protein_id="AAD18777.1"
FT                   /translation="MASEPRGSRKVKIGVVVSAKMEKTVVVRVERIFSHPQYLKVVRSS
FT                   KKYYAHTELKVSEGDKVKIQETRPLSKLKRWRVIEHVGVVS"
FT   gene            complement(725740..725958)
FT                   /gene="rl29"
FT                   /locus_tag="CPn_0639"
FT   CDS_pept        complement(725740..725958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl29"
FT                   /locus_tag="CPn_0639"
FT                   /product="L29 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18778"
FT                   /db_xref="GOA:Q9Z7R5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R5"
FT                   /protein_id="AAD18778.1"
FT                   /translation="MAAKKDLLTQLRGKSDDDLDAYVHENKKALFALRAENLLQNKVVK
FT                   VHMFSTHKKNIARALTVKQERKGKVHG"
FT   gene            complement(725961..726377)
FT                   /gene="rl16"
FT                   /locus_tag="CPn_0640"
FT   CDS_pept        complement(725961..726377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl16"
FT                   /locus_tag="CPn_0640"
FT                   /product="L16 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18779"
FT                   /db_xref="GOA:Q9Z7R4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R4"
FT                   /protein_id="AAD18779.1"
FT                   /translation="MLMPKRTKFRKQQKGQFAGLSKGATFVDFGEYAMQTLERGWVTSR
FT                   QIEACRVAINRYLKRRGKVWIRIFPDKSVTKKPAETRMGKGKGAPDHWVAVVRPGRILF
FT                   EVANVSKEDAQDALRRAAAKLGIKTRFVKRVERV"
FT   gene            complement(726406..727077)
FT                   /gene="rs3"
FT                   /locus_tag="CPn_0641"
FT   CDS_pept        complement(726406..727077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs3"
FT                   /locus_tag="CPn_0641"
FT                   /product="S3 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18780"
FT                   /db_xref="GOA:Q9Z7R3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R3"
FT                   /protein_id="AAD18780.1"
FT                   /translation="MGQKGCPIGFRTGVTKRWRSLWYGNKQEFGKFLIEDVRIRQFLRK
FT                   KPSCQGAAGFVVRRMSGKIEVTIQTARPGLVIGKKGAEVDLLKEELRALTGKEVWLEIA
FT                   EIKRPELNAKLVADNIARQIERRVSFRRAMKKAMQSVMDAGAVGVKIQVSGRLAGAEIA
FT                   RSEWYKNGRVPLHTLRADIDYATACAETTYGIIGIKVWINLGENSSSTTPNNPAAPSAA
FT                   A"
FT   gene            complement(727093..727428)
FT                   /gene="rl22"
FT                   /locus_tag="CPn_0642"
FT   CDS_pept        complement(727093..727428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl22"
FT                   /locus_tag="CPn_0642"
FT                   /product="L22 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18781"
FT                   /db_xref="GOA:Q9Z7R2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R2"
FT                   /protein_id="AAD18781.1"
FT                   /translation="MFKATARYIRVQPRKARLAAGLMRNLSVQEAEEQLGFSQLKAGRC
FT                   LKKVLNSAVANAELHENIKRENLSVTEVRVDAGPVYKRSKSKSRGGRSPILKRTSHLTV
FT                   IVGEKER"
FT   gene            complement(727447..727713)
FT                   /gene="rs19"
FT                   /locus_tag="CPn_0643"
FT   CDS_pept        complement(727447..727713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs19"
FT                   /locus_tag="CPn_0643"
FT                   /product="S19 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18782"
FT                   /db_xref="GOA:Q9Z7R1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R1"
FT                   /protein_id="AAD18782.1"
FT                   /translation="MGRSLRKGPFVDHHLLKKVRAMNIEEKKTPIKTWSRRSMITPEMI
FT                   GHTFEVHNGKKFLTVFVSETMVGHKLGEFSPTRIFKSHPVKKG"
FT   gene            complement(727719..728573)
FT                   /gene="rl2"
FT                   /locus_tag="CPn_0644"
FT   CDS_pept        complement(727719..728573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl2"
FT                   /locus_tag="CPn_0644"
FT                   /product="L2 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18783"
FT                   /db_xref="GOA:Q9Z7R0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R0"
FT                   /protein_id="AAD18783.1"
FT                   /translation="MFKKFKPVTPGTRQLVLPAFDELTTRGELRGTKSKRSLRPNKKLS
FT                   FFKKSSGGRDNLGHISCRHRGGGAKQLYRVVDFKRNKDGITAKVVTVEYDPNRSAYIAL
FT                   LSYEDGEKRYILAPKGIQRGDVVVSGEGSPFKPGCCMTLKSIPLGLSVHNIEMRPSSGG
FT                   KLVRSAGLAAQVIAKSPGYVTLKMPSGEFRMLNEGCRATIGEVSNADHNLRVDGKAGRR
FT                   RWMGVRPTVRGTAMNPVDHPHGGGEGRHNGYIPRTPWGKVTKGLKTRDKNKSNKWIVKD
FT                   RRK"
FT   gene            complement(728595..728930)
FT                   /gene="rl23"
FT                   /locus_tag="CPn_0645"
FT   CDS_pept        complement(728595..728930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl23"
FT                   /locus_tag="CPn_0645"
FT                   /product="L23 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18784"
FT                   /db_xref="GOA:Q9Z7Q9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q9"
FT                   /protein_id="AAD18784.1"
FT                   /translation="MKDPYDVIKRHYVTEKAKMLEHLSAGTGEGKKKGSFCKDPKFVFI
FT                   VSHDATKPLIAQALEAIYVDKNVKVKSVNTINVKPQPARMFRGRRKGKTSGFKKAIVTF
FT                   YQGHSVG"
FT   gene            complement(728947..729621)
FT                   /gene="rl4"
FT                   /locus_tag="CPn_0646"
FT   CDS_pept        complement(728947..729621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl4"
FT                   /locus_tag="CPn_0646"
FT                   /product="L4 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18785"
FT                   /db_xref="GOA:Q9Z7Q8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q8"
FT                   /protein_id="AAD18785.1"
FT                   /translation="MVLLSKFDFSGNKIGEVEVADSLFADEGDGLQLIKDYIVAIRANK
FT                   RQWSACTRNRSEVSHSTKKPFKQKGTGNARQGCLASPQFRGGGIVFGPKPKFNQHVRIN
FT                   RKERKAAIRLLLAQKIQTNKLTVVDDTVFVDALTAPKTQSALRFLKDCNVECRSILFID
FT                   HLDHVEKNENLRLSLRNLTAVKGFVYGININGYDLASAHNIVISKKALQELVERLVSET
FT                   KD"
FT   gene            complement(729654..730331)
FT                   /gene="rl3"
FT                   /locus_tag="CPn_0647"
FT   CDS_pept        complement(729654..730331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl3"
FT                   /locus_tag="CPn_0647"
FT                   /product="L3 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18786"
FT                   /db_xref="GOA:Q9Z7Q7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q7"
FT                   /protein_id="AAD18786.1"
FT                   /translation="MLMDKFMRSHISVMGKKEGMIHIFDKDGSLVACSVIRVEPNVVTQ
FT                   IKTKESDGYFSLQIGAEEMNAPAHTITKRVSKPKLGHLRKAGGRVFRFLKEVRGSEEAL
FT                   NGVSLGDAFGLEVFEDVSSVDVRGISKGKGFQGVMKKFGFRGGPGSHGSGFHRHAGSIG
FT                   MRSTPGRCFPGSKRPSHMGAENVTVKNLEVIKVDLEKKVLLVKGAIPGARGSIVIVKHS
FT                   SRT"
FT   gene            complement(730602..731603)
FT                   /locus_tag="CPn_0648"
FT   CDS_pept        complement(730602..731603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0648"
FT                   /product="CT529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18787"
FT                   /db_xref="GOA:Q9Z7Q6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7Q6"
FT                   /protein_id="AAD18787.1"
FT                   /translation="MATNAIRSAGSAASKMLLPVAKEPAAVSSFAQKGIYCIQQFFTNP
FT                   GNKLAKFVGATKSLDKCFKLSKAVSDCVVGSLEEAGCTGDALTSARNAQGMLKTTREVV
FT                   ALANVLNGAVPSIVNSTQRCYQYTRQAFELGSKTKERKTPGEYSKMLLTRGDYLLAASR
FT                   EACTAVGATTYSATFGVLRPLMLINKLTAKPFLDKATVGNFGTAVAGIMTINHMAGVAG
FT                   AVGGIALEQKLFKRAKESLYNERCALENQQSQLSGDVILSAERALRKEHVATLKRNVLT
FT                   LLEKALELVVDGVKLIPLPITVACSAAISGALTAASAGIGLYSIWQKTKSGK"
FT   gene            complement(731707..732672)
FT                   /gene="fmt"
FT                   /locus_tag="CPn_0649"
FT   CDS_pept        complement(731707..732672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="CPn_0649"
FT                   /product="Methionyl tRNA Formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18788"
FT                   /db_xref="GOA:Q9Z7Q5"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q5"
FT                   /protein_id="AAD18788.1"
FT                   /translation="MNLKVVYFGTPTFAATVLQDLLHHKIQITAVVTRVDKPQKRSAQL
FT                   IPSPVKTIALTHGLPLLQPSKASDPQFIEELRAFNADVFIVVAYGAILRQIVLDIPRYG
FT                   CYNLHAGLLPAYRGAAPIQRCIMEGATESGNTVIRMDAGMDTGDMANITRVPIGPDMTS
FT                   GELADALASQGAEVLIKTLQQIESGQLQLVSQDAALATIAPKLSKEEGQVPWDKPAKEA
FT                   YAHIRGVTPAPGAWTLFSFSEKAPKRLMIRKASLLAEAGRYGAPGTVVVTDRQELAIAC
FT                   SEGAICLHEVQVEGKGSTNSKSFLNGYPAKKLKIVFTLNN"
FT   gene            complement(732662..733501)
FT                   /gene="lpxA"
FT                   /locus_tag="CPn_0650"
FT   CDS_pept        complement(732662..733501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="CPn_0650"
FT                   /product="Acyl-Carrier UDP-GlcNAc O-Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18789"
FT                   /db_xref="GOA:Q9Z7Q4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q4"
FT                   /protein_id="AAD18789.1"
FT                   /translation="MASIHPTAIIEPGAKIGKDVVIEPYVVIKATVTLCDNVVVKSYAY
FT                   IDGNTTIGKGTTIWPSAMIGNKPQDLKYQGEKTYVTIGENCEIREFAIITSSTFEGTTV
FT                   SIGNNCLIMPWAHVAHNCTIGNNVVLSNHAQLAGHVQVGDYAILGGMVGVHQFVRIGAH
FT                   AMVGALSGIRRDVPPYTIGSGNPYQLAGINKVGLQRRQVPFATRLALIKAFKKIYRADG
FT                   CFFESLEETLEEYGDIPEVKNFIEFCQSPSKRGIERSIDKQALEEESADKEGVLIES"
FT   gene            complement(733514..733975)
FT                   /gene="fabZ"
FT                   /locus_tag="CPn_0651"
FT   CDS_pept        complement(733514..733975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="CPn_0651"
FT                   /product="Myristoyl-Acyl Carrier Dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18790"
FT                   /db_xref="GOA:Q9Z7Q3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q3"
FT                   /protein_id="AAD18790.1"
FT                   /translation="MNQPSVIKLRELLDLLPHRYPFLLVDKVLSYDIEARSITAQKNVT
FT                   INEPFFMGHFPNAPIMPGVLILEALAQAAGVLIGLVLENDRNKRIALFLGIQKAKFRQA
FT                   VRPGDVLTLQADFSLISSKGGKAWAQARVDSQLVTEAELSFALVDKESI"
FT   gene            complement(733987..734835)
FT                   /gene="lpxC"
FT                   /locus_tag="CPn_0652"
FT   CDS_pept        complement(733987..734835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="CPn_0652"
FT                   /product="Myristoyl GlcNac Deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18791"
FT                   /db_xref="GOA:Q9Z7Q2"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q2"
FT                   /protein_id="AAD18791.1"
FT                   /translation="MLERTQRTLKREVRYSGVGIHLGKSSTLHLQPAQTNTGIVFQRQS
FT                   ASGNYENVPALLDHVYTTGRSTTLSRGSAVIATVEHLMAALRSNNIDNLIIQCSGEEIP
FT                   IGDGSSNVFVELIDQAGICEQEDKVSIARLTRPVYYQHQDIFLAAFPSDELKISYTLHY
FT                   PQSSTIGTQYKSLVINEESFRQEIAPCRTFALYNELCFLMEKGLIGGGCLDNAVVFKDD
FT                   GIISRGQLRFADEPVRHKILDLIGDLSLVGRPFVAHVLAVGSGHSSNIAFGKKILEALE
FT                   L"
FT   gene            complement(734865..736490)
FT                   /gene="cutE"
FT                   /locus_tag="CPn_0653"
FT   CDS_pept        complement(734865..736490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="CPn_0653"
FT                   /product="Apolipoprotein N-Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18792"
FT                   /db_xref="GOA:Q9Z7Q1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q1"
FT                   /protein_id="AAD18792.1"
FT                   /translation="MLRIFCFVISWCLIAFAQPDLSGFVSILGAACGYGFFWYSLEPLK
FT                   KPSLPLRTLFVSCFFWIFTIEGIHFSWMLSDQYIGKLIYLVWLTLITILSVLFSGFSCL
FT                   LVAIVRQKRTAFLWSLPGVWVAIEMLRFYGIFSGMSFDYLGWPMTASAYGRQFGGFLGW
FT                   AGQSFAVIAVNMSFYCLLLKKPHAKMLWVLTLLLPYTFGAIHYEYLKHAFQQDKRALRV
FT                   AVVQPAHPPIRPKLKSPIVVWEQLLQLVSPIQQPIDLLIFPEVVVPFGKHRQVYPYESC
FT                   AHLLSSFAPLPEGKAFLSNSDCATALSQHFQCPVIIGLERWVKKENVLYWYNSAEVISH
FT                   KGISVGYDKRILVPGGEYIPGGKFGSLICRQLFPKYALGCKRLPGRRSGVVQVRGLPRI
FT                   GITICYEETFGYRLQSYKRQGAELLVNLTNDGWYPESRLPKVHFLHGMLRNQEFGMPCV
FT                   RACQTGVTAAVDSLGRILKILPYDTRETKAPSGVLETSLPLFNYKTLYGYCGDYPMILI
FT                   AFCAVSYLGGGFLGYRLLAKKEIR"
FT   gene            complement(736500..736967)
FT                   /gene="yciA"
FT                   /locus_tag="CPn_0654"
FT   CDS_pept        complement(736500..736967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciA"
FT                   /locus_tag="CPn_0654"
FT                   /product="acyl-CoA Thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18793"
FT                   /db_xref="GOA:Q9Z7Q0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q0"
FT                   /protein_id="AAD18793.1"
FT                   /translation="MLKKKPVSFSCIDGHIYKIFPNDLNANNTVFGGLLMSLLDRLALV
FT                   VAERHTESVCVTAFVDALRFYAPAYMGENLICKAAVNRTWRTSLEVGVKVWAENIYKQE
FT                   RRHITSAYFTFVAVNEDNQPIPVHQIVPETPEEKRRYNEADRRRQARLELK"
FT   gene            complement(737098..737847)
FT                   /gene="dnaQ_2"
FT                   /locus_tag="CPn_0655"
FT   CDS_pept        complement(737098..737847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ_2"
FT                   /locus_tag="CPn_0655"
FT                   /product="DNA Polymerase III Epsilon Chain"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18794"
FT                   /db_xref="GOA:Q9Z7P9"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7P9"
FT                   /protein_id="AAD18794.1"
FT                   /translation="MSLLKDTVFTCLDCEMTGLDVKKDRIIEIAAVRFTFDSVISSIEF
FT                   LINPERVVSAESQRVHHISNAMLRDQPKIAEVFPQIKAFFKEGDYIVGHSVGFDLQVLA
FT                   QEMERIGETFLSKYTIIDTLRLAKEYGDSPNNSLESLAVHFNVPYDGNHRAMKDVEINI
FT                   NIFKHLCKRFRTLEQLKQVLAKPIKMKYMPLGKHKGRCFSEIPLAYLQWASKMDFDSDL
FT                   LFSIRHEIKHRQKGTGFSQVNNPFMEL"
FT   gene            737872..738051
FT                   /locus_tag="CPn_0656"
FT   CDS_pept        737872..738051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18795"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UM01"
FT                   /protein_id="AAD18795.1"
FT                   /translation="MFDILLTVEGFLCLTLYFASVQRMPCEQKRVPGNLYYYYIAAHSS
FT                   LCLSVCKDTMENKD"
FT   gene            complement(738048..738473)
FT                   /gene="yjeE"
FT                   /locus_tag="CPn_0657"
FT   CDS_pept        complement(738048..738473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeE"
FT                   /locus_tag="CPn_0657"
FT                   /product="YjeE hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18796"
FT                   /db_xref="GOA:Q9Z7P7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7P7"
FT                   /protein_id="AAD18796.1"
FT                   /translation="MGRYRRVSHSSQETLLLGTELGQVLVPGAVLLLFGDYGAGKTEFV
FT                   RGIVSGYLGDTIAEEVASPSFSILHVYGNEPKRLCHYDLYRIDQKNQEYIFQDAEEDDV
FT                   LCIEWADRLPKPRFCDTINIYITMQTNMEREIIIEKR"
FT   gene            complement(738452..739168)
FT                   /locus_tag="CPn_0658"
FT   CDS_pept        complement(738452..739168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0658"
FT                   /product="CT538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18797"
FT                   /db_xref="InterPro:IPR024484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P6"
FT                   /protein_id="AAD18797.1"
FT                   /translation="MDISGAVKQKLLQFLGKQKKPELLATYLFYLEQALSLRPVVFVRD
FT                   KIIFKTPEDAVRILEQDKKIWRETEIQISSEKPQVNENTKRIYICPFTGKVFADNVYAN
FT                   PQDAIYDWLSSCPQNMEKQGGVRIKRFLVSEDPDVIKEYAVPPKEPIIKTVFASAITGK
FT                   LFHSLPPLLEDFISSYLRPMTLEEVQNQTKFQLESSFLSLLQDALVEDKIAAFIESLAD
FT                   DTAFHVYISQWVDTEE"
FT   gene            739403..739486
FT                   /locus_tag="CPn_t22"
FT   tRNA            739403..739486
FT                   /locus_tag="CPn_t22"
FT                   /product="tRNA-Leu"
FT   gene            739533..739841
FT                   /gene="trxA"
FT                   /locus_tag="CPn_0659"
FT   CDS_pept        739533..739841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="CPn_0659"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18798"
FT                   /db_xref="GOA:Q9Z7P5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P5"
FT                   /protein_id="AAD18798.1"
FT                   /translation="MVKIISSENFDSFIASGLVLVDFFAEWCGPCRMLTPILENLAAEL
FT                   PHVTIGKINIDENSKPAETYEVSSIPTLILFKDGNEVARVVGLKDKEFLTNLINKHA"
FT   gene            complement(739857..740327)
FT                   /gene="spoU_2"
FT                   /locus_tag="CPn_0660"
FT   CDS_pept        complement(739857..740327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU_2"
FT                   /locus_tag="CPn_0660"
FT                   /product="rRNA Methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18799"
FT                   /db_xref="GOA:Q9Z7P4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7P4"
FT                   /protein_id="AAD18799.1"
FT                   /translation="MRVVLHCPDIPQNTGNIGRTCVALGAELILVRPLGFSLADKFVKR
FT                   AGMDYWDKLQLTVVDSIEEALHDVPEDQIFCLSTKGSASYTEFSLPSSGTYVFGSESKG
FT                   LPKEILKKYYKNCLRIPMQQDIRSLNLATSVGIVLYEVVRQKTVALQKNPTV"
FT   gene            complement(740324..741100)
FT                   /gene="mip"
FT                   /locus_tag="CPn_0661"
FT   CDS_pept        complement(740324..741100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mip"
FT                   /locus_tag="CPn_0661"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18800"
FT                   /db_xref="GOA:Q9Z7P3"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P3"
FT                   /protein_id="AAD18800.1"
FT                   /translation="MNRRWNLVLATVALALSVASCDVRSKDKDKDQGSLVEYKDNKDTN
FT                   DIELSDNQKLSRTFGHLLARQLRKSEDMFFDIAEVAKGLQAELVCKSAPLTETEYEEKM
FT                   AEVQKLVFEKKSKENLSLAEKFLKENSKNAGVVEVQPSKLQYKIIKEGAGKAISGKPSA
FT                   LLHYKGSFINGQVFSSSEGNNEPILLPLGQTIPGFALGMQGMKEGETRVLYIHPDLAYG
FT                   TAGQLPPNSLLIFEINLIQASADEVAAVPQEGNQGE"
FT   gene            complement(741169..742923)
FT                   /gene="aspS"
FT                   /locus_tag="CPn_0662"
FT   CDS_pept        complement(741169..742923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="CPn_0662"
FT                   /product="Aspartyl tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18801"
FT                   /db_xref="GOA:Q9Z7P2"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P2"
FT                   /protein_id="AAD18801.1"
FT                   /translation="MKYRTHRCNELTSNHIGENVQLAGWVHRYRNHGGVVFIDLRDRFG
FT                   ITQIVCREDEQPELHQRLDAVRSEWVLSVRGKVCPRLAGMENPNLATGHIEVEVASFEV
FT                   LSKSQNLPFSIADDHINVNEELRLEYRYLDMRRGDIIEKLLCRHQVMLACRNFMDAQGF
FT                   TEIVTPVLGKSTPEGARDYLVPSRIYPGKFYALPQSPQLFKQLLMVGGLDRYFQIATCF
FT                   RDEDLRADRQPEFAQIDIEMSFGDTQDLLPIIEQLVATLFATQGIEIPLPLAKMTYQEA
FT                   KDSYGTDKPDLRFDLKLKDCRDYAKRSSFSIFLDQLAHGGTIKGFCVPGGATMSRKQLD
FT                   GYTEFVKRYGAMGLVWIKNQEGKVASNIAKFMDEEVFHELFAYFDAKDQDILLLIAAPE
FT                   SVANQSLDHLRRLIAKERELYSDNQYNFVWITDFPLFSLEDGKIVAEHHPFTAPLEEDI
FT                   PLLETDPLAVRSSSYDLVLNGYEIASGSQRIHNPDLQSQIFTILKISPESIQEKFGFFI
FT                   KALSFGTPPHLGIALGLDRLVMVLTAAESIREVIAFPKTQKASDLMMNAPSEIMSSQLK
FT                   ELSIKVAF"
FT   gene            complement(742898..744190)
FT                   /gene="hisS"
FT                   /locus_tag="CPn_0663"
FT   CDS_pept        complement(742898..744190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="CPn_0663"
FT                   /product="Histidyl tRNA Synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18802"
FT                   /db_xref="GOA:Q9Z7P1"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P1"
FT                   /protein_id="AAD18802.1"
FT                   /translation="MTVTLPKGVFDIFPYLADAKQLWRHTSLWHSVEKAIHTVCMLYGF
FT                   CEIRTPIFEKSEVFLHVGEESDVVKKEVYSFLDRKGRSMTLRPEGTAAVVRSFLEHGAS
FT                   HRSDNKFYYILPMFRYERQQAGRYRQHHQFGVEAIGVRHPLRDAEVLALLWDFYSRVGL
FT                   QHMQIQLNFLGGSETRFRYDKVLRAYLKESMGELSALSQQRFSTNVLRILDSKEPEDQE
FT                   IIRQAPPILDYVSDEDLKYFNEILDALRVLEIPYAINPRLVRGLDYYSDLVFEATTTFQ
FT                   EVSYALGGGGRYDGLISAFGGASLPACGFGVGLERAIQTLLAQKRIEPQFPHKLRLIPM
FT                   EPDADQFCLEWSQHLRRLGIPTEVDWSHKKVKGALKAASTEQVSFVCLIGERELISQQL
FT                   VIKNMSLRKEFFGTKEEVEQRLLYEIQNTPL"
FT   gene            complement(744554..744757)
FT                   /locus_tag="CPn_0664"
FT   CDS_pept        complement(744554..744757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18803"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7P0"
FT                   /protein_id="AAD18803.1"
FT                   /translation="MKKLIALIGIFLVPIKGNTNKEHDAHATVLKAARAKYNLFFVQDV
FT                   FPVHEVIEPISPDCLVHYEGWV"
FT   gene            745001..746368
FT                   /gene="uhpC"
FT                   /locus_tag="CPn_0665"
FT   CDS_pept        745001..746368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="CPn_0665"
FT                   /product="Hexosphosphate Transport"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18804"
FT                   /db_xref="GOA:Q9Z7N9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7N9"
FT                   /protein_id="AAD18804.1"
FT                   /translation="MNVWTKFFQPPKHIKEIEDQEVVKKKYKYWRIRIFYSMFIGYIFY
FT                   YFTRKSFTFAMPTLIADLGFDKAQLGIIGSTLYFSYGISKFVSGVMSDQSNPRYFMAIG
FT                   LMITGLTNIFFGMSSSIVLFALWWGLNGWFQGWGWPPCARLLTHWYAKSERGTWWSVWS
FT                   TSHNIGGALIPILTGFIIDYSGWRGAMYVPGILCIGMGLVLINRLRDTPQSLGLPPIEK
FT                   YKRDPHHAHHEGKSASEGTEEIERELSTREILFTYVLTNQWLWFLAAASFFIYIVRMAV
FT                   NDWSALFLIETKHYAAVKANFCVSLFEIGGLFGMLVAGWLSDKISKGNRGPMNVLFSLG
FT                   LLFAILGMWFSRSHNQWWVDGTLLFVIGFFLYGPQMMIGLAAAELSHKKAAGTASGFTG
FT                   WFAYFGATFAGYPLGKVTDVWGWKGFFIALLACASIALLLFLPTWNATEKNTRSKA"
FT   gene            746388..750110
FT                   /gene="dnaE"
FT                   /locus_tag="CPn_0666"
FT   CDS_pept        746388..750110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="CPn_0666"
FT                   /product="DNA Polymerase III Alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18805"
FT                   /db_xref="GOA:Q9Z7N8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7N8"
FT                   /protein_id="AAD18805.1"
FT                   /translation="MTWIPLHCHSQYSVLDAMSSIKDFVAKGQEFGIPALALTDHGNLY
FT                   GAVDFYKECTQKGIQPIIGCECYIAPGSRFDKKKEKRSRAAHHLILLCKNEQGYRNLCI
FT                   LTSLAFTEGFYYFPRIDKDLLRQYSEGLICLSGCLSSSVSDAALKSPEALLLELQWFQD
FT                   LFKDDYFTEVQLHKMSEESIAGFKEEWLKQEYYSLIEKQIKVNTAVLEASKRLGIPTVA
FT                   TNDIHYINANDWQAHEILLNVQSGETVRIAKQNTHIPNPKRKVYRSREYYFKSPAQMAE
FT                   LFKDIPEVISNTLEVAKRCDFTFDFSKKHYPIYVPESLKTLNSYTEEDRYQASAVFLKQ
FT                   LAEEALPKKYSSEVLAHIAKKFPHRDPIDIVKERMDMEMAIIIPKGMCDYLLIVWDIIH
FT                   WAKANGIPVGPGRGSGAGSVLLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICM
FT                   AGRERVINYAIERHGKDNVAQIITFGTMKAKMAVKDVGRTLDMALSKVNHIAKHIPDLN
FT                   TTLSKALETDPDLHQLYINDAESAQVIDMALCLEGSIRNTGVHAAGVIICGDQLTNHIP
FT                   ICISKDSTMITTQYSMKPVESVGMLKVDLLGLKTLTSINIAMSAIEKKTGQSLAMATLP
FT                   LDDATTFSLLHQGKTMGIFQMESKGMQELAKNLRPDLFEEIIAMGALYRPGPMDMIPSF
FT                   INRKHGKEIIEYDHPLMESILKETYGIMVYQEQVMQIAGALASYSLGEGDVLRRAMGKK
FT                   DFQQMEQEREKFCKRACNNGIDPELATVIFDKMEKFAAYGFNKSHAAAYGLITYTTAYL
FT                   KANYPKEWLAALLTCDSDDIEKIGKLIREAQSMGIPILPPHINVSSNHFVATDEGIRFA
FT                   MGAIKGIGRGLIESIVEERDHHGPYESIRDFIQRSDLKKVSKKSIESLIDAGCFDCFDS
FT                   NRDLLLASVEPLYEAIAKDKKEAASGVMTFFTLGAMDRKNEVPICLPKDIPTRSKKELL
FT                   KKEKELLGIYLTEHPMDTVRDHLSRLSVVLAGEFENLPHGSVVRTVFIIDKVTTKISSK
FT                   AQKKFAVLRVSDGIDSYELPIWPDMYEEQQELLEEDRLIYAILVLDKRSDSLRISCRWM
FT                   KDLSIVNENIIYECDQAFDRIKNQVQKMSFTMSTSGKETKAKGNKPNENGHTQALAPVT
FT                   LSLDLNELRHSHLCILKKIVQKHPGSRTLVLVFTQDNERVASMSPDDAYFVCEDIEELR
FT                   QELVTADLPVRVITV"
FT   gene            complement(750174..751058)
FT                   /locus_tag="CPn_0667"
FT   CDS_pept        complement(750174..751058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18806"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7N7"
FT                   /protein_id="AAD18806.1"
FT                   /translation="MKKLILYFAAFVASLFCGVFLWDRVPCAQKIMRLAADHSSEVFSK
FT                   SCRFVRKISGFEELQVFERHVSPEQALALFPEYRDGKSFVELAFIPHTLMHVRFSKEEP
FT                   VKKHIISQEGEILWSLVNGEMVLHTGTWTCSKGFRECLLLHAGKQDMRVIQTLATLGGT
FT                   TSRESLAQALALKNIRAERVIKECQKKKLIFASGNQIGTHFQQFQPIRGCTTTLNNNPV
FT                   WLQKPRHAAVFPAQYSEDRVRHLVKMIFGDNFLIVRSSMVYVPVYKISLVSADNSVRVE
FT                   YINAVTGKSFQDL"
FT   gene            751209..752165
FT                   /locus_tag="CPn_0668"
FT   CDS_pept        751209..752165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0668"
FT                   /product="CT547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18807"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X5V4"
FT                   /protein_id="AAD18807.1"
FT                   /translation="MKFLLYVPLLLVLVSTGCDAKPVSFEPFSGKLSTQRFEPQHSAEE
FT                   YFSQGQEFLKKGNFRKALLCFGIITHHFPRDILRNQAQYLIGVCYFTQDHPDLADKAFA
FT                   SYLQLPDAEYSEELFQMKYAIAQRFAQGKRKRICRLEGFPKLMNADEDALRIYDEILTA
FT                   FPSKDLGAQALYSKAALLIVKNDLTEATKTLKKLTLQFPLHILSSEAFVRLSEIYLQQA
FT                   KKEPHNLQYLHFAKLNEEAMKKQHPNHPLNEVVSANVGAMREHYARGLYATGRFYEKKK
FT                   KAEAANIYYRTAITNYPDTLLVAKCQKRLDRISKHTS"
FT   gene            752179..752778
FT                   /locus_tag="CPn_0669"
FT   CDS_pept        752179..752778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0669"
FT                   /product="CT548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18808"
FT                   /db_xref="GOA:Q9Z7N5"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7N5"
FT                   /protein_id="AAD18808.1"
FT                   /translation="MRLFSLGTIYLFFSLALSSCCGYSILNSPYHLSSLGKSLLQERIF
FT                   IAPIKEDPHGQLCSALTYELSKRSFAISGRSSCAGYTLKVELLNGIDKNIGFTYAPNKL
FT                   GDKTHRHFIVSNEGRLSLSAKVQLINNDTQEVLIDQCVARESVDFDFEPDLGTANAHEF
FT                   ALGQFEMHSEAIKSARRILSIRLAETIAQQVYYDLF"
FT   gene            752765..753199
FT                   /gene="rsbW"
FT                   /locus_tag="CPn_0670"
FT   CDS_pept        752765..753199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="CPn_0670"
FT                   /product="sigma regulatory factor-histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18809"
FT                   /db_xref="GOA:A0A0F7XJI4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XJI4"
FT                   /protein_id="AAD18809.1"
FT                   /translation="MTFFEGETVFPAVLSELHSMLDLIKRAGKQSKCPQEKLLKLELAC
FT                   EELLVNIISYAYQGENSPGTIAISCISHRGDLEVVIKDHGPSFNPLAVSINIQEDLPLE
FT                   QRKLGGLGIFLAKSSVDEFLYAREDHCNIVHLKMLNGQHS"
FT   gene            complement(753202..753630)
FT                   /locus_tag="CPn_0671"
FT   CDS_pept        complement(753202..753630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0671"
FT                   /product="CT550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18810"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7N3"
FT                   /protein_id="AAD18810.1"
FT                   /translation="MSLDFFEEFYHQSILNTGTSFPEGYLNIAEILSYPHCTDANTDFL
FT                   CSQSDNDFIIAESKDKLTLFNADFAIWLVPELVQGQAVTRGYIAVSQGEGNYEPEMAFE
FT                   ASGQYNQSSLILEALQLYLKDIKDTENALRSFRFNNDH"
FT   gene            753741..755051
FT                   /gene="dacF"
FT                   /locus_tag="CPn_0672"
FT   CDS_pept        753741..755051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacF"
FT                   /locus_tag="CPn_0672"
FT                   /product="D-Ala-D-Ala Carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18811"
FT                   /db_xref="GOA:Q9Z7N2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7N2"
FT                   /protein_id="AAD18811.1"
FT                   /translation="MKRPFFTYLCIIFYGSCASLSLHAGLSFPEVRGATAAVVHADSGK
FT                   VFYDKDIDAVIYPASMTKIATALFILKHYPTVLDTLIKVKQDAIASITPQAKKQSGYRS
FT                   PPHWLETDGSTIQLHLREELLGWDLFHALLVCSANDAANVLAMACCGSVEKFMDKLNFF
FT                   LKEEIGCTHTHFNNPHGLHHPNHYTTTRDLISIMRCALKEPPFRGVISTTSYKIGATNL
FT                   HGERILSPTNKLLLPGSTYHYPPALGGKTGTTKTAGKNLIMAAEKNNRLLVTIATGYSG
FT                   PVSDLYQDVIALCETVFNEPLLRKELVPPSDCLQLEIANLGKLSCPLPEGLYYDFYASE
FT                   DREPLSVSFIAHADAFPIEQGDLLGHWVFYDDEGKKISSQPFYAPCRFERTIKPWKLYM
FT                   KRVFTSYRTYMSITMLLMYFRIRKHRKYKNLKHYSKI"
FT   gene            755287..755466
FT                   /locus_tag="CPn_0673"
FT   CDS_pept        755287..755466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0673"
FT                   /product="CT552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7N1"
FT                   /protein_id="AAD18812.1"
FT                   /translation="MSIALNREEVWDNPHHLMFILMQFQQFSGEQDRFGSFLEATIRDR
FT                   VSFLVLQEKIATLK"
FT   gene            complement(755574..756668)
FT                   /gene="fmu"
FT                   /locus_tag="CPn_0674"
FT   CDS_pept        complement(755574..756668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmu"
FT                   /locus_tag="CPn_0674"
FT                   /product="RNA Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18813"
FT                   /db_xref="GOA:Q9Z7N0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7N0"
FT                   /protein_id="AAD18813.1"
FT                   /translation="MVPFRQHHAYQLLKQLHTSAISEADRVSYYFKQNRSLGSKDRQWI
FT                   QNIIFNILRHRRLLETLILDSGEQVTPEALVAKVNEGVLENLDSYSAIPWPVRYSISDD
FT                   LAHFLVQDYGEEQAEEIAKIWLTEAPITIRVNTDKISVKELQEKLEYPSSPGELPEALH
FT                   FSKRHPLQSTEAFRRGFFEIQDENSQRISQGISLTDKDIVLDFCAGAGGKSLIFAQKAK
FT                   HVVINDSRKAILQTAKHRLLRAGARNFSLADQLRLGSFSVVIVDAPCSGTGVFRRHPEH
FT                   KWQFSKKLLLNYVRVQKSILKQASAYVGPRGRLVYITCSLLKEENEAHVAYMHSLGWKE
FT                   VHRKTLPLQVGKGDAFFTSHFQKI"
FT   gene            complement(756765..757919)
FT                   /locus_tag="CPn_0675"
FT   CDS_pept        complement(756765..757919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0675"
FT                   /product="CT696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18814"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M9"
FT                   /protein_id="AAD18814.1"
FT                   /translation="MILDFQFSIGYYLRVLELAIRDGTRILAYDRKRLLLDAWPVNDPL
FT                   PTNYDTSVSTIRQVIHELFSWSAISYSISSRLLAIIELRLHEEKPQTGWLYRLFFPSKY
FT                   HIKKAIVDKLCMFKSLILFESKRPVDKIVQAANKVFSKGKSNFSSWEDFTHEVTVSEVQ
FT                   TPLAGEVQRRLAADASLQMIIEALTTLLEGHTAYLPLSLELLNQFIGEKAQPLKTLSEK
FT                   SYVLLRELIQLFSLSAEDFQTIIMSIISDSLSEVLANSLIGNQPLTFHGKTFVGLWQET
FT                   ALASPEDSKLALGFLAEVLRKVIVEKKLHVSKSDNTTPEEVGNIYSIRDQNPALWDKMI
FT                   TMLLMRWLLDYDRDIGIALRKAAEYYNPHPSFWRQFLRLWQRRP"
FT   gene            complement(758048..759217)
FT                   /locus_tag="CPn_0676"
FT   CDS_pept        complement(758048..759217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0676"
FT                   /product="Similarity to CT695"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18815"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7M8"
FT                   /protein_id="AAD18815.1"
FT                   /translation="MGTPISGNDGDRNTISDPLEESAAEEGDSDLEDRVSESATQVIET
FT                   IADTGIPEATPSEGTNSDLNSDLVDRVEYEARGSLLTTMLARIRKAVSQIWMHVKTKRH
FT                   PKEQGVRSLGDIPCDLLKATRLPKETAEPPYFYALETALASCRSFFFHVFLRLFTLLRR
FT                   QHPEAPLDLCGTDPISPEAAVAFALILRSCCKWVATDAVQEGLPLEVIEEAGMYNAFSL
FT                   EATTTVEEVSKRLSELLYSDKRIDGLANVRGITKIITSPYLGAGQCVSVVDNLKTYDLG
FT                   RNYTQVLACASQIDEFADKGENEALVMKDILYLVRQDRSKELGDFLMMWSEEHASEVNY
FT                   DVVLAILEVNLPILEEDYRSHPLAYQKKLNYVICQFFCSERLTSIEPKD"
FT   gene            complement(759253..760401)
FT                   /locus_tag="CPn_0677"
FT   CDS_pept        complement(759253..760401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18816"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7M7"
FT                   /protein_id="AAD18816.1"
FT                   /translation="MGINPSGNRSPDDVWVRGAQGDSSSTQGTGATNSNLGAHNVTTST
FT                   SQPQVASKAKQLWQTVREFFLGKKSPDSSQGASGPAMQSPSGPTIRPTRPAPPPPTTGG
FT                   ANAKRPATHGKGRAPQPPTAGSSSGSEQPTAMSSEVAKLVSELKDAVHSHAESQKVLKK
FT                   VSQELQTKWTDWENNRGPDYLLHGYRVIARALQQTYTEQSMLIEGTSSTGPVPQAVTVA
FT                   KDAVTQTVRGAIKNLENPKPGNDPDGVLMQVVISLGIEGPTLDPGESIQNFLETRVSDF
FT                   GGDDSDIDYTSDIARLGSALDRVRENHPNEMPRIWIALARELGAAVHSHATSVRIANAG
FT                   KNHTRDVVRMANESSRLLQGMKVLSVGAWANTMTVLIGDLFE"
FT   gene            complement(760679..761320)
FT                   /locus_tag="CPn_0678"
FT   CDS_pept        complement(760679..761320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18817"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7M6"
FT                   /protein_id="AAD18817.1"
FT                   /translation="MSVNPSGNSKNDLWITGAHDQHPDVKESGVTSANLGSHRVTASGG
FT                   RQGLLARIKEAVTGFFSRMSFFRSGAPRGSQQPSAPSADTVRSPLPGGDARATEGAGRN
FT                   LIKKGYQPGMKVTIPQVPGGGAQRSSGSTTLKPTRPAPPPPKTGGTNAKRPATHGKGPA
FT                   PQPPKTGGTNAKRAATHGKGPAPQPPKGILKQPGQSGTSGKKRVSWSDED"
FT   gene            complement(761722..762930)
FT                   /gene="pgk"
FT                   /locus_tag="CPn_0679"
FT   CDS_pept        complement(761722..762930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="CPn_0679"
FT                   /product="Phosphoglycerate Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18818"
FT                   /db_xref="GOA:Q9Z7M5"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M5"
FT                   /protein_id="AAD18818.1"
FT                   /translation="MDKLTVQDLSPEEKKVLVRVDFNVPMQDGKILDDIRIRSAMPTIN
FT                   YLLKKHAAVILMSHLGRPKGQGFQEEYSLQPVVDVLEGYLGHHVPLAPDCVGEVARQAV
FT                   AQLSPGRVLLLENLRFHIGEEHPEKDPTFAAELSSYGDFYVNDAFGTSHRKHASVYVVP
FT                   QAFPGRAAAGLLMEKELEFLGRHLLTSPKRPFTAILGGAKISSKIGVIEALLNQVDYLL
FT                   LAGGMGFTFLQALGKSLGNSLVEKSALDLARNVLKIAKSRNVTIVLPSDVKAAENLQSK
FT                   EYSVISIDQGIPPHLQGFDIGPRTTEEFIRIINQSATVFWNGPVGVYEVPPFDSGSIAI
FT                   ANALGNHPSAVTVVGGGDAAAVVALAGCSTKVSHVSTGGGASLEFLEQGFLPGTEVLSP
FT                   SKS"
FT   gene            complement(762968..764248)
FT                   /gene="ygo4"
FT                   /locus_tag="CPn_0680"
FT   CDS_pept        complement(762968..764248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygo4"
FT                   /locus_tag="CPn_0680"
FT                   /product="Phosphate Permease"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18819"
FT                   /db_xref="GOA:Q9Z7M4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M4"
FT                   /protein_id="AAD18819.1"
FT                   /translation="MLPLIIFVLLCGFYTSWNIGANDVANAVGPSVGSGVLTLRQAVVI
FT                   AAIFEFFGALLLGDRVAGTIESSIVSVTNPMIASGDYMYGMTAALLATGVWLQLASFFG
FT                   WPVSTTHSIVGAVIGFGLVLGKGTIIYWNSVGIILISWILSPFMGGCVAYLIFSFIRRH
FT                   IFYKNDPVLAMVRVAPFLAALVIMTLGTVMISGGVILKVSSTPWAVSGVLVCGLLSYII
FT                   TFYYVHTKHCSYISDTPKKGSLTYRLKERGGNYGRKYLVVERIFAYLQIIVACFMAFAH
FT                   GSNDVANAIAPVAGVLRQAYPASYTSYTLIRLMAFGGIGLVIGLAIWGWRVIETVGCKI
FT                   TELTPSRGFSVGMGSALTIALASILGLPISTTHVVVGAVLGIGLARGIRAINLNIIKDI
FT                   VLSWFITLPAGALLSILFFFALRALFH"
FT   gene            complement(764255..764929)
FT                   /locus_tag="CPn_0681"
FT   CDS_pept        complement(764255..764929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0681"
FT                   /product="CT691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18820"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M3"
FT                   /protein_id="AAD18820.1"
FT                   /translation="MQTLARLFGQSPFAPLQAHLEMVVSCVEYMLPIFTALRDGRYEEL
FT                   LEMAKLVSDKEYQADCIKNDMRNHLPAGLFMPISRAGILEIISIQDSIADTAEDVAILL
FT                   TIRRLNFYPSMETLFFRFLEKNLEAFELTMTLLHEFNQLLESSFGGRKADKARLLVGRV
FT                   AKSEHESDVLQRELMQIFFSDDFIIPEKEFYLWLQVIRRTAGISDSSEKLAHRINMTLE
FT                   EK"
FT   gene            764984..765958
FT                   /gene="dppD"
FT                   /locus_tag="CPn_0682"
FT   CDS_pept        764984..765958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="CPn_0682"
FT                   /product="ABC ATPase Dipeptide Transport"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18821"
FT                   /db_xref="GOA:Q9Z7M2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7M2"
FT                   /protein_id="AAD18821.1"
FT                   /translation="MASNPILQIEDLSITLAKQRQQYPIVQSLSFTINEGQTLAIIGES
FT                   GSGKSVSAHAILRLLPCPPFSVSGQVNFQGHNLLTASRSIQKKIIGTEISMIFQNPQAS
FT                   LNPVFTIEQQFREIIHTHLALTAEVAKEKMLYALEETGFHDPRLCLNLYPHQLSGGMLQ
FT                   RICIAMALLCSPKLLIADEPTTALDVSVQYQILQLLKTLQKKTGMSLLIITHNMGVVAE
FT                   TADDVLVLYAGRMVECAPAVQMFHNPSHPYTRDLLASRPSLQPQQLGSFNPIPGQPPHY
FT                   TAFPSGCRYHPRCSKILNRCSAEAPEIYPVREGHKVRCWLYDD"
FT   gene            765948..766922
FT                   /gene="dppF_2"
FT                   /locus_tag="CPn_0683"
FT   CDS_pept        765948..766922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF_2"
FT                   /locus_tag="CPn_0683"
FT                   /product="ABC ATPase Dipeptide Transport"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18822"
FT                   /db_xref="GOA:Q9Z7M1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7M1"
FT                   /protein_id="AAD18822.1"
FT                   /translation="MTTNFPQPLIQATSLTKHYYKRSFWFQGKTIASRPVDDVSFSLYS
FT                   RRAVGLIGESGSGKSTLALALAGLLPLTSGFLTFNGTPIKLHSKHGRHQLRSQVRLVFQ
FT                   NPQASLNPRKTILDSLGHSLLYHKLVPKEKVLATVREYLELVGLSEEYFYRYPHQLSGG
FT                   QQQRVSIARALLGVPQLIICDEIVSALDLSIQAQILNMLAELQKKLSLTYLFISHDLAV
FT                   VRSFCTEVFIMYKGQIVEKGNTKRIFSDPQHPYTRMLLNAQLPETPDQRQSKPIFQEYH
FT                   KDSEESCSTGCYFYNRCPQKQEACKSEIIPNQGDAHHTYRCIH"
FT   gene            complement(767178..768038)
FT                   /gene="parB"
FT                   /locus_tag="CPn_0684"
FT   CDS_pept        complement(767178..768038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="CPn_0684"
FT                   /product="Chromosome Partitioning Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18823"
FT                   /db_xref="GOA:Q9Z7M0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M0"
FT                   /protein_id="AAD18823.1"
FT                   /translation="MTEEISKDTIIEVAIDDIRVSPFQPRRVFSNEELQELIASIKAVG
FT                   LIHPPVVREICTGDRVLYYELIAGERRWRAMQLAGATTIPVILKHVIADGTAAEATLIE
FT                   NIQRVNLNPIEMAEAFKRLIHVFGLTQDKVAYKVGKKRSTVANYLRLLALSKTIQESLL
FT                   QGQITLGHAKVILTLEDPILREKLNEIIIQEHLAVREAELIAKQLISEEGSSIELKPTP
FT                   LDMAESSKQHEELQQRLSDLCGYKVQIKTRGSKATVSFHLQNTQDLQKLEAWLSSHGTL
FT                   SESLS"
FT   gene            768068..768220
FT                   /locus_tag="CPn_0685"
FT   CDS_pept        768068..768220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18824"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7XAX5"
FT                   /protein_id="AAD18824.1"
FT                   /translation="MDLQAFEILDVQGMLTDQRKHIQMLHKHNSIEIFLSNMVVEVKLF
FT                   FKTLK"
FT   gene            complement(768173..768361)
FT                   /locus_tag="CPn_0686"
FT   CDS_pept        complement(768173..768361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18825"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7L8"
FT                   /protein_id="AAD18825.1"
FT                   /translation="MMRGGRLFRVYQELFFFSSVYVCEQRRPRKLYPSLQHLNFPIEKP
FT                   RFLLKGFKKELHFYNHV"
FT   gene            768564..769217
FT                   /locus_tag="CPn_0687"
FT   CDS_pept        768564..769217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0687"
FT                   /product="CT482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18826"
FT                   /db_xref="GOA:Q9Z7L7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7L7"
FT                   /protein_id="AAD18826.1"
FT                   /translation="MQKLVHNIWKKFYSFSSAIAICIVLASFLSLKIVSNTYKHSQAKR
FT                   NSILLLTRAAEVAVSQGFLPSKSALSSLEQAYHLGGESMKPYAGFLASCFYIHNEPLRG
FT                   AYYAGLAYNNSQALQLPHPIQKLLKEISEAQADQLYDVALSKSYQLLQTANSSPEYPTL
FT                   SFLTLLRVIELKELLHQDVSQDFAALKSSPLFHQFERMYSDGEWTLSKRFGKKG"
FT   gene            769382..770140
FT                   /locus_tag="CPn_0688"
FT   CDS_pept        769382..770140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0688"
FT                   /product="CT481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18827"
FT                   /db_xref="GOA:Q9Z7L6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7L6"
FT                   /protein_id="AAD18827.1"
FT                   /translation="MLIVLAFRQVFFSHSRSQLDRLKNYLRLLKQNFAITLPKERTSKG
FT                   HSLMLTFDFASFDFYTNIFPFLEEQKIPAVVGVASRYIPSNAAQDLHPSHRLKPSETLA
FT                   FQDEIFSNYMPFCCQNELIEMAKSPYIQLASSGFAIRNLMNNPPYLTTEILLSRHHIET
FT                   ITGAKPLAFLFPFGKSDPTSRKLAADHYPYSFLLGNTINRKLKTHNIYRLDIKPMQYVC
FT                   PSLFQSSRYLKNWIKEKSKQLYLKKQLPKR"
FT   gene            complement(770184..771404)
FT                   /gene="yfhO_1"
FT                   /locus_tag="CPn_0689"
FT   CDS_pept        complement(770184..771404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhO_1"
FT                   /locus_tag="CPn_0689"
FT                   /product="NifS-related Aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18828"
FT                   /db_xref="GOA:Q9Z7L5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7L5"
FT                   /protein_id="AAD18828.1"
FT                   /translation="MKNLKEDFPIFAAKAKENEPFIYLDSAATTQKPQQVIDAVANFYT
FT                   SSYATVNRAIYSSSRNVTEAYAAVREKVRKWVSAASDSEIVFTRGTTAGLNLLAISVND
FT                   LWIPKGGVVLVSEAEHHANVLSWEIACRRRGSLVKKIRVHDSGLIDLDDLEKLLNEGAQ
FT                   FVSIPHVSNVTGCVQPLQQVAELVHRYDAYLAVDGAQGAPHLPIDVQLWDVDFYVFSSH
FT                   KIYGPTGIGVLYGKKDLLDQLPPVEGGGDMVAIYDHQNPEYLPAPMKFEAGTPNIAGVL
FT                   GLGAALDYLDGLSAKFIYDKEIALTTYLHKELLEIPGVEILGPSIEEPRGALIGMTIDG
FT                   AHPLDLGFLLDLRGIAVRTGHQCAQPAMERWNVGHVLRVSLGIYNDEDDIDQFILVLQD
FT                   SLDKIRR"
FT   gene            complement(771433..772680)
FT                   /locus_tag="CPn_0690"
FT   CDS_pept        complement(771433..772680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0690"
FT                   /product="ABC Transporter Membrane Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18829"
FT                   /db_xref="GOA:Q9Z7L4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7L4"
FT                   /protein_id="AAD18829.1"
FT                   /translation="MLVSIETFSSIASGSPVQKAAEACYTQYSKQPSSKEVLSSFSWIQ
FT                   ELSLFPDRYNLATGASELIKQHWLHNNHSLAFECILINGKYEPSLSQLPEGVIVCGIDE
FT                   ARGSLSSFMQGFDVNKHPLAFLNAVCSEDRGVVIYIPEEMQTSDPIFVRHISFPTVSDH
FT                   DVIFSPRIVVILGQRASAQIQISHDVDLEMVGSSKTIVNGVTELFVGEGADLTVFMVPG
FT                   YSEEDTLSWSTIATVEKDAICRMTQNLLESCQGFGWFDNTSYIVGKKGHAESLVLVQSP
FT                   RKTWVNNLMSHDAEETVSRQNIKSILYSGHFLFEGTISISSQGDLSDANQKHDTLLLSS
FT                   EARVSTFPRLEIETDEVKASHGATVGPLDPQQIFYMRSRGMTEAEAQEKLIHGFLKQGL
FT                   VSDTFLGSSFQLNQTS"
FT   gene            complement(772682..773452)
FT                   /gene="abcX"
FT                   /locus_tag="CPn_0691"
FT   CDS_pept        complement(772682..773452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcX"
FT                   /locus_tag="CPn_0691"
FT                   /product="ABC Transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18830"
FT                   /db_xref="GOA:Q9Z7L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7L3"
FT                   /protein_id="AAD18830.1"
FT                   /translation="MLKIKHLHASCNDVKILDDFNLNIQPGTMHVIMGPNGAGKSTLAK
FT                   ILAGDESVLVSSGEIALQEQNLLSMLPEERSRAGLFVGFQMPPEIPGVNNKMFLRDAYN
FT                   ARRRANQEGDISIDEFNTLLSTVLETYEYNATTDLFLDRNVNEGFSGGERKRNEICQML
FT                   VLEPEMVLLDEPDSGLDVDALRLICRVLEKYRELHPTSSLCIVTHNPKLGNLIRPDVVH
FT                   LLLDGRVALSGDVSLMHELEAKSYQEVTKRVAWR"
FT   gene            complement(773458..774912)
FT                   /locus_tag="CPn_0692"
FT   CDS_pept        complement(773458..774912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0692"
FT                   /product="ABC Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18831"
FT                   /db_xref="GOA:Q9Z7L2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7L2"
FT                   /protein_id="AAD18831.1"
FT                   /translation="MGESVKVFLEEREDYPYGFVTPIESQGLTRGLSEETIEEIAALRN
FT                   EPQFIIDFRLQAYRYWKQLHEPAWARLHYGPIAYDDIVYFSSPKQKKPLGRLEDADPEI
FT                   LDTFKKLGIPLDEQKRLLNVENVAVDLVFDSVSIGTTFKEALEKAGVIFCSLGEAIQEH
FT                   PNLVKKYLGSVVSHRDNFFAALNAAVFSDGSFVYVPKGVKCPMDISTYFRINNKEAGQF
FT                   ERTLIVVEDGGYASYLEGCTAPAYSSNQLHAAVVELVAHEHAVIRYSTVQNWYAGDKKT
FT                   GKGGIYNFVTKRGLCAGYRSKISWSQVEVGAAITWKYPSCILKGDESVGEFYSVALTSG
FT                   KMQADTGTKMLHVGKRTTSTVISKGISSDESKNTFRSLVSLGKKAEHSSNYTQCDSMLI
FT                   GKASGAYTDPKIVVENSTSSIEHEATTSKLREDQLLYLRSRGLSPEEAVSLVIHGFCRE
FT                   IIEQLPLEFAQEASKLLLIKLENSVG"
FT   gene            complement(775237..776256)
FT                   /locus_tag="CPn_0693"
FT   CDS_pept        complement(775237..776256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0693"
FT                   /product="TPR Repeats-CT683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18832"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7L1"
FT                   /protein_id="AAD18832.1"
FT                   /translation="MEEAAKHLAKEFLCSGINLFLSGEYEQAEKRLKETLELDSTAALA
FT                   YCYLGIIALETGRVSEALNWCSKGLASEPGDSYLRYCYGVALDRGNQYEAAIEQYSAYV
FT                   ALHPDDVECWFSLGSVYHRLKRLQEALDCFDKILALDPWNPQSLYNKAVILSEMDDEAE
FT                   SIRLLEVAVAKNPLYWKAWVKLGFLLSRSKRWDKATEAYERVVQLRPDLSDGHYNLGLC
FT                   YLTLDKTRLALKAFQEALFLNAEDADAHFYVGLAHLDLKQMREAYEAFNSALSINLEHE
FT                   RAHYLLGYLHHMQGETDKATKELLFLQKKDSTFAPLLQKTVVSDPSSMQFERRLDTIS"
FT   gene            complement(776327..779599)
FT                   /gene="pbp2"
FT                   /locus_tag="CPn_0694"
FT   CDS_pept        complement(776327..779599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp2"
FT                   /locus_tag="CPn_0694"
FT                   /product="PBP2-transglycolase/transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18833"
FT                   /db_xref="GOA:A0A0F7X196"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7X196"
FT                   /protein_id="AAD18833.1"
FT                   /translation="MKRPKKFPIYLSIAQKTNRLLSGIVIAFAVIALRLWYLAVVEHEQ
FT                   KLEEAYKPQIRVLPQYVERATICDRFGKTLAVNQLQYDVSVAYGAIRDLPTRAWRVDEH
FT                   GHKQLIPVRKHYIMCLSELLSQELHLDREAIEDAIHAKASVLGSVPYLVAANVSERTYL
FT                   KLKMLSKDWPGLHVEAVVRRHYPQESVASDILGYVGPISLQEYKRVTQELSQLRECVRA
FT                   YEEGEDPKLPEGLASIDQVRALLESVESNAYSLNALVGKMGVEACWDSKLRGKIGKKPI
FT                   LVDRRGNFIQEMEGAVPEAPGTKLQLTLSAELQAYADALLLEYEKTETFRSAKSLKKRE
FT                   KLPPLFPWIKGGAIIALDPNNGEILAMASSPRYRNNDFVNAKVAEDSKAVRSSIYRWLE
FT                   NKEHIAEIYDRKVPLIRERRNPLTGLCYEEILPLTFDCFLDFLFPENSVIKLQLKRNSF
FT                   VGQAIEVQNLVTRLLSLFPYEEGTCPCSAIFDAVFPNEEGHILIQEVISLQEQKWIMEC
FT                   LNQHKADIEELKEALDQVFNELPANYDKILYTDILRLIVDPERFSPVLPSEVHRLSLSE
FT                   FTELQGRYVVLRSAFSTILEDAFIEVHFKSWRKSEFLQYLAAKRQEEALRKQRYPTPYV
FT                   DYLEEEKTRQYKMFCQEHLDTFLAYLFSKTPYKEGLEPYYDILDLWINELDNGAHRALS
FT                   WHEHYLFLKERVSHLSEHLPALFSTFREFNELQRPLLGKYPISIVRNKRQTEQDLAASF
FT                   YPVYGYGYLRPHAYGQAATLGSIFKLVSAYSVLSQRILWGHNEEPANPLVIIDKNSFGY
FT                   RSSKPHVGFFKDGTPIPTFFRGGSLPGNDFMGRGFIDLVSALEMSSNPYFSLLVGEGLG
FT                   DPEDLADAASLFGFGEKTGLGLPGEYAGRVPHDLAYNRSGLYATAIGQHTLVVTPLQTA
FT                   VMLASLVNGGVVYVPKLLLGEWEGEHVSYLSSKKKRTIFMPDAVVEVLKTGMRNVIWGQ
FT                   YGTARAIQSQFPPQLLSRIIGKTSTAESIMRVGLDREYGTMKMKDIWFAAVGFSDQDLS
FT                   LPTIVVIVYLRLGEFGRDAAPMAVKMIDMWEKIQQRESFLRG"
FT   gene            780216..781385
FT                   /gene="ompA"
FT                   /locus_tag="CPn_0695"
FT   CDS_pept        780216..781385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompA"
FT                   /locus_tag="CPn_0695"
FT                   /product="Major Outer Membrane Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18834"
FT                   /db_xref="GOA:P27455"
FT                   /db_xref="InterPro:IPR000604"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27455"
FT                   /protein_id="AAD18834.1"
FT                   /translation="MKKLLKSALLSAAFAGSVGSLQALPVGNPSDPSLLIDGTIWEGAA
FT                   GDPCDPCATWCDAISLRAGFYGDYVFDRILKVDAPKTFSMGAKPTGSAAANYTTAVDRP
FT                   NPAYNKHLHDAEWFTNAGFIALNIWDRFDVFCTLGASNGYIRGNSTAFNLVGLFGVKGT
FT                   TVNANELPNVSLSNGVVELYTDTSFSWSVGARGALWECGCATLGAEFQYAQSKPKVEEL
FT                   NVICNVSQFSVNKPKGYKGVAFPLPTDAGVATATGTKSATINYHEWQVGASLSYRLNSL
FT                   VPYIGVQWSRATFDADNIRIAQPKLPTAVLNLTAWNPSLLGNATALSTTDSFSDFMQIV
FT                   SCQINKFKSRKACGVTVGATLVDADKWSLTAEARLINERAAHVSGQFRF"
FT   gene            complement(781610..781680)
FT                   /locus_tag="CPn_t23"
FT   tRNA            complement(781610..781680)
FT                   /locus_tag="CPn_t23"
FT                   /product="tRNA-Gly"
FT   gene            781769..782602
FT                   /gene="rs2"
FT                   /locus_tag="CPn_0696"
FT   CDS_pept        781769..782602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rs2"
FT                   /locus_tag="CPn_0696"
FT                   /product="S2 Ribosomal Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18835"
FT                   /db_xref="GOA:Q9Z7K9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K9"
FT                   /protein_id="AAD18835.1"
FT                   /translation="MESQSCKLTIKDLMSAGAHFGHQTRRWNPKMKLYIFEEKNGLYII
FT                   NLAKTLQQLRNALPHIRKVIQDNKTVLFVGTKKQAKCVIREAAIEAGEFFIAERWLGGM
FT                   LTNMTTIRNSIKTLDKIEKDLSRNQAYLTKKEAALLAKRHQKLLRNLEGIRYMKKAPGL
FT                   LVVVDPSYEKIAVAEAKKLGIPVLALVDTNCDPTPIDHVIPCNDDSLKSIRLIINVIKE
FT                   NIIEAKHKLGIEIVSPVKSLEVPDLSAFESSQDDESDEENREEDLLAKKFDGEAN"
FT   gene            782602..783450
FT                   /gene="tsf"
FT                   /locus_tag="CPn_0697"
FT   CDS_pept        782602..783450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="CPn_0697"
FT                   /product="Elongation Factor TS"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18836"
FT                   /db_xref="GOA:Q9Z7K8"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K8"
FT                   /protein_id="AAD18836.1"
FT                   /translation="MSDFSMETLKTLRQQTGVGLTKCKEALEACGGNLEEAVVYLRKLG
FT                   LASAGKKEHRETKEGIIAAKTDANGTALIEVNVETDFVANNAVFREFVSNLLNDILKYK
FT                   VDTVEALSQAASSQDPSLSVDELRAVTMQTVGENIRISRVAYFPKATNSTVGIYSHGNG
FT                   KTVALTMLSGSSTADSLAKDIAMHVVAAQPQFLSKESVPAEAIAKEKEVIASQIQGKPQ
FT                   EVIEKIVTGKLNTFFQEACLLEQPFIKNADLSIQSLIDDFSKTSGSSVAIEQFILWKIG
FT                   A"
FT   gene            783458..784204
FT                   /gene="pyrH"
FT                   /locus_tag="CPn_0698"
FT   CDS_pept        783458..784204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="CPn_0698"
FT                   /product="UMP Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18837"
FT                   /db_xref="GOA:Q9Z7K7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K7"
FT                   /protein_id="AAD18837.1"
FT                   /translation="MAKQTRRVLFKISGEALSKDSSNRIDEMRLSRLVSELRAVRNNDI
FT                   EIALVIGGGNILRGLAEQKELQINRVSADQMGMLATLINGMAVADALKAEDIPCLLTST
FT                   LSCPQLADLYTPQKSIEALDQGKILICTTGAGSPYLTTDTGAALRACELNVDVLIKATM
FT                   HVDGVYDKDPRLFPDAVKYDFVSYKDFLSNQLGVMDASAISLCMDSHIPIRVFSFLQHS
FT                   LEKALFDPTIGTLVSEDVNHVCSPRH"
FT   gene            784182..784724
FT                   /gene="rrf"
FT                   /locus_tag="CPn_0699"
FT   CDS_pept        784182..784724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /locus_tag="CPn_0699"
FT                   /product="Ribosome Releasing Factor"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18838"
FT                   /db_xref="GOA:Q9Z7K6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K6"
FT                   /protein_id="AAD18838.1"
FT                   /translation="MSVLQDTEKKMAAALDFFHKEVKSFRTGKAHPALVETVVVDVYGT
FT                   TMRLSDIASISVADLRQLVISPYDGNNASAIAKGIIAANLNLQPEVEGSIIRIKVPEPT
FT                   ADYRQEMIKQLRRKCEEAKINVRNIRREANDKLKKDSALTEDVVKGNEKKIQELTDKFC
FT                   KQLDELTKQKEAEIASI"
FT   gene            complement(784822..784896)
FT                   /locus_tag="CPn_t24"
FT   tRNA            complement(784822..784896)
FT                   /locus_tag="CPn_t24"
FT                   /product="tRNA-Glu"
FT   gene            complement(784922..784994)
FT                   /locus_tag="CPn_t25"
FT   tRNA            complement(784922..784994)
FT                   /locus_tag="CPn_t25"
FT                   /product="tRNA-Lys"
FT   gene            785097..785612
FT                   /locus_tag="CPn_0700"
FT   CDS_pept        785097..785612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPn_0700"
FT                   /product="CT676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPn_0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAD18839"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z7K5"
FT                   /protein_id="