(data stored in SCRATCH3701 zone)

EMBL: AE004091

ID   AE004091; SV 2; circular; genomic DNA; STD; PRO; 6264404 BP.
XX
AC   AE004091; AE004440-AE004968;
XX
PR   Project:PRJNA331;
XX
DT   11-JUL-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Pseudomonas aeruginosa PAO1, complete genome.
XX
KW   .
XX
OS   Pseudomonas aeruginosa PAO1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-6264404
RX   DOI; 10.1038/35023079.
RX   PUBMED; 10984043.
RA   Stover C.K., Pham X.Q., Erwin A.L., Mizoguchi S.D., Warrener P.,
RA   Hickey M.J., Brinkman F.S., Hufnagle W.O., Kowalik D.J., Lagrou M.,
RA   Garber R.L., Goltry L., Tolentino E., Westbrock-Wadman S., Yuan Y.,
RA   Brody L.L., Coulter S.N., Folger K.R., Kas A., Larbig K., Lim R., Smith K.,
RA   Spencer D., Wong G.K., Wu Z., Paulsen I.T., Reizer J., Saier M.H.,
RA   Hancock R.E., Lory S., Olson M.V.;
RT   "Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic
RT   pathogen";
RL   Nature 406(6799):959-964(2000).
XX
RN   [2]
RP   1-6264404
RX   DOI; 10.1093/nar/gki047.
RX   PUBMED; 15608211.
RA   Winsor G.L., Lo R., Sui S.J., Ung K.S., Huang S., Cheng D., Ching W.K.,
RA   Hancock R.E., Brinkman F.S.;
RT   "Pseudomonas aeruginosa Genome Database and PseudoCAP: facilitating
RT   community-based, continually updated, genome annotation";
RL   Nucleic Acids Res. 33(Database issue):D338-D343(2005).
XX
RN   [3]
RP   1-6264404
RX   DOI; 10.1093/nar/gkn861.
RX   PUBMED; 18978025.
RA   Winsor G.L., Van Rossum T., Lo R., Khaira B., Whiteside M.D., Hancock R.E.,
RA   Brinkman F.S.;
RT   "Pseudomonas Genome Database: facilitating user-friendly, comprehensive
RT   comparisons of microbial genomes";
RL   Nucleic Acids Res. 37(Database issue):D483-D488(2009).
XX
RN   [4]
RP   1-6264404
RG   Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
RA   Stover C.K., Pham X.-Q.T., Erwin A.L., Mizoguchi S.D., Warrener P.,
RA   Hickey M.J., Brinkman F.S.L., Hufnagle W.O., Kowalik D.J., Lagrou M.,
RA   Garber R.L., Goltry L., Tolentino E., Westbrock-Wadman S., Yuan Y.,
RA   Brody L.L., Coulter S.N., Folger K.R., Kas A., Larbig K., Lim R.M.,
RA   Smith K.A., Spencer D.H., Wong G.K.-S., Wu Z., Paulsen I.T., Reizer J.,
RA   Saier M.H., Hancock R.E.W., Lory S., Olson M.V.;
RT   ;
RL   Submitted (16-MAY-2000) to the INSDC.
RL   Department of Medicine and Genetics, University of Washington Genome
RL   Center, University Of Washington, Box 352145, Seattle, WA 98195, USA
XX
RN   [5]
RP   1-6264404
RG   Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
RA   Ung K.S., Hancock R.E., Brinkman F.S.;
RT   ;
RL   Submitted (04-FEB-2003) to the INSDC.
RL   Department of Molecular Biology and Biochemistry, Simon Fraser University,
RL   8888 University Dr., Burnaby, British Columbia V5A 1S6, Canada
XX
RN   [6]
RC   Sequence update by submitter
RP   1-6264404
RG   Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
RA   Winsor G.L., Hancock R.E., Brinkman F.S.;
RT   ;
RL   Submitted (05-JUL-2006) to the INSDC.
RL   Department of Molecular Biology and Biochemisry, Simon Fraser University,
RL   8888 University Dr., Burnaby, British Columbia V5A 1S6, Canada
XX
RN   [7]
RC   Protein update by submitter
RP   1-6264404
RG   Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
RA   Winsor G.L., Hancock R.E., Brinkman F.S.;
RT   ;
RL   Submitted (02-OCT-2008) to the INSDC.
RL   Department of Molecular Biology and Biochemisry, Simon Fraser University,
RL   8888 University Dr., Burnaby, British Columbia V5A 1S6, Canada
XX
RN   [8]
RC   Protein update by submitter
RP   1-6264404
RG   Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
RA   Winsor G.L., Hancock R.E., Brinkman F.S.;
RT   ;
RL   Submitted (08-SEP-2010) to the INSDC.
RL   Department of Molecular Biology and Biochemisry, Simon Fraser University,
RL   8888 University Dr., Burnaby, British Columbia V5A 1S6, Canada
XX
DR   MD5; 7f8b730b8a08ebf1eeb7f0de561f0a91.
DR   BioSample; SAMN02603714.
DR   CABRI; LMBP 5157.
DR   EnsemblGenomes-Gn; EBG00001435404.
DR   EnsemblGenomes-Gn; EBG00001435405.
DR   EnsemblGenomes-Gn; EBG00001435406.
DR   EnsemblGenomes-Gn; EBG00001435407.
DR   EnsemblGenomes-Gn; EBG00001435408.
DR   EnsemblGenomes-Gn; EBG00001435409.
DR   EnsemblGenomes-Gn; EBG00001435410.
DR   EnsemblGenomes-Gn; EBG00001435411.
DR   EnsemblGenomes-Gn; EBG00001435412.
DR   EnsemblGenomes-Gn; EBG00001435413.
DR   EnsemblGenomes-Gn; EBG00001435414.
DR   EnsemblGenomes-Gn; EBG00001435415.
DR   EnsemblGenomes-Gn; EBG00001435416.
DR   EnsemblGenomes-Gn; EBG00001435417.
DR   EnsemblGenomes-Gn; EBG00001435418.
DR   EnsemblGenomes-Gn; EBG00001435419.
DR   EnsemblGenomes-Gn; EBG00001435420.
DR   EnsemblGenomes-Gn; EBG00001435421.
DR   EnsemblGenomes-Gn; EBG00001435422.
DR   EnsemblGenomes-Gn; EBG00001435423.
DR   EnsemblGenomes-Gn; EBG00001435424.
DR   EnsemblGenomes-Gn; EBG00001435425.
DR   EnsemblGenomes-Gn; EBG00001435426.
DR   EnsemblGenomes-Gn; EBG00001435427.
DR   EnsemblGenomes-Gn; EBG00001435428.
DR   EnsemblGenomes-Gn; EBG00001435429.
DR   EnsemblGenomes-Gn; EBG00001435430.
DR   EnsemblGenomes-Gn; EBG00001435431.
DR   EnsemblGenomes-Gn; EBG00001435432.
DR   EnsemblGenomes-Gn; EBG00001435433.
DR   EnsemblGenomes-Gn; EBG00001435434.
DR   EnsemblGenomes-Gn; EBG00001435435.
DR   EnsemblGenomes-Gn; EBG00001435436.
DR   EnsemblGenomes-Gn; EBG00001435437.
DR   EnsemblGenomes-Gn; EBG00001435438.
DR   EnsemblGenomes-Gn; EBG00001435439.
DR   EnsemblGenomes-Gn; EBG00001435440.
DR   EnsemblGenomes-Gn; EBG00001435441.
DR   EnsemblGenomes-Gn; EBG00001435442.
DR   EnsemblGenomes-Gn; EBG00001435443.
DR   EnsemblGenomes-Gn; EBG00001435444.
DR   EnsemblGenomes-Gn; EBG00001435445.
DR   EnsemblGenomes-Gn; EBG00001435446.
DR   EnsemblGenomes-Gn; EBG00001435447.
DR   EnsemblGenomes-Gn; EBG00001435448.
DR   EnsemblGenomes-Gn; EBG00001435449.
DR   EnsemblGenomes-Gn; EBG00001435450.
DR   EnsemblGenomes-Gn; EBG00001435451.
DR   EnsemblGenomes-Gn; EBG00001435452.
DR   EnsemblGenomes-Gn; EBG00001435453.
DR   EnsemblGenomes-Gn; EBG00001435454.
DR   EnsemblGenomes-Gn; EBG00001435455.
DR   EnsemblGenomes-Gn; EBG00001435456.
DR   EnsemblGenomes-Gn; EBG00001435457.
DR   EnsemblGenomes-Gn; EBG00001435458.
DR   EnsemblGenomes-Gn; EBG00001435459.
DR   EnsemblGenomes-Gn; EBG00001435460.
DR   EnsemblGenomes-Gn; EBG00001435461.
DR   EnsemblGenomes-Gn; EBG00001435462.
DR   EnsemblGenomes-Gn; EBG00001435463.
DR   EnsemblGenomes-Gn; EBG00001435464.
DR   EnsemblGenomes-Gn; EBG00001435465.
DR   EnsemblGenomes-Gn; EBG00001435466.
DR   EnsemblGenomes-Gn; EBG00001435467.
DR   EnsemblGenomes-Gn; EBG00001435468.
DR   EnsemblGenomes-Gn; EBG00001435469.
DR   EnsemblGenomes-Gn; EBG00001435470.
DR   EnsemblGenomes-Gn; EBG00001435471.
DR   EnsemblGenomes-Gn; EBG00001435472.
DR   EnsemblGenomes-Gn; EBG00001435473.
DR   EnsemblGenomes-Gn; EBG00001435474.
DR   EnsemblGenomes-Gn; EBG00001435475.
DR   EnsemblGenomes-Gn; EBG00001435476.
DR   EnsemblGenomes-Gn; EBG00001435477.
DR   EnsemblGenomes-Gn; EBG00001435478.
DR   EnsemblGenomes-Gn; EBG00001435479.
DR   EnsemblGenomes-Gn; EBG00001435480.
DR   EnsemblGenomes-Gn; EBG00001435481.
DR   EnsemblGenomes-Gn; EBG00001435482.
DR   EnsemblGenomes-Gn; EBG00001435483.
DR   EnsemblGenomes-Gn; EBG00001435484.
DR   EnsemblGenomes-Gn; EBG00001435485.
DR   EnsemblGenomes-Gn; EBG00001435486.
DR   EnsemblGenomes-Gn; EBG00001435487.
DR   EnsemblGenomes-Gn; EBG00001435488.
DR   EnsemblGenomes-Gn; EBG00001435489.
DR   EnsemblGenomes-Gn; EBG00001435490.
DR   EnsemblGenomes-Gn; EBG00001435491.
DR   EnsemblGenomes-Gn; EBG00001435492.
DR   EnsemblGenomes-Gn; EBG00001435493.
DR   EnsemblGenomes-Gn; EBG00001435494.
DR   EnsemblGenomes-Gn; EBG00001435495.
DR   EnsemblGenomes-Gn; EBG00001435496.
DR   EnsemblGenomes-Gn; EBG00001435497.
DR   EnsemblGenomes-Gn; EBG00001435498.
DR   EnsemblGenomes-Gn; EBG00001435499.
DR   EnsemblGenomes-Gn; EBG00001435500.
DR   EnsemblGenomes-Gn; EBG00001435501.
DR   EnsemblGenomes-Gn; EBG00001435502.
DR   EnsemblGenomes-Gn; EBG00001435503.
DR   EnsemblGenomes-Gn; EBG00001435504.
DR   EnsemblGenomes-Gn; EBG00001435505.
DR   EnsemblGenomes-Gn; EBG00001435506.
DR   EnsemblGenomes-Gn; EBG00001435507.
DR   EnsemblGenomes-Gn; EBG00001435508.
DR   EnsemblGenomes-Gn; EBG00001435509.
DR   EnsemblGenomes-Gn; EBG00001435510.
DR   EnsemblGenomes-Gn; EBG00001435511.
DR   EnsemblGenomes-Gn; EBG00001435512.
DR   EnsemblGenomes-Gn; EBG00001435513.
DR   EnsemblGenomes-Gn; EBG00001435514.
DR   EnsemblGenomes-Gn; EBG00001435515.
DR   EnsemblGenomes-Gn; EBG00001435516.
DR   EnsemblGenomes-Gn; EBG00001435517.
DR   EnsemblGenomes-Gn; EBG00001435518.
DR   EnsemblGenomes-Gn; EBG00001435519.
DR   EnsemblGenomes-Gn; EBG00001435520.
DR   EnsemblGenomes-Gn; EBG00001435521.
DR   EnsemblGenomes-Gn; EBG00001435522.
DR   EnsemblGenomes-Gn; EBG00001435523.
DR   EnsemblGenomes-Gn; EBG00001435524.
DR   EnsemblGenomes-Gn; EBG00001435525.
DR   EnsemblGenomes-Gn; EBG00001435526.
DR   EnsemblGenomes-Gn; EBG00001435527.
DR   EnsemblGenomes-Gn; EBG00001435528.
DR   EnsemblGenomes-Gn; EBG00001435529.
DR   EnsemblGenomes-Gn; EBG00001435530.
DR   EnsemblGenomes-Gn; EBG00001435531.
DR   EnsemblGenomes-Gn; EBG00001435532.
DR   EnsemblGenomes-Gn; EBG00001435533.
DR   EnsemblGenomes-Gn; PA0263.1.
DR   EnsemblGenomes-Gn; PA0527.1.
DR   EnsemblGenomes-Gn; PA0574.1.
DR   EnsemblGenomes-Gn; PA0668.1.
DR   EnsemblGenomes-Gn; PA0668.2.
DR   EnsemblGenomes-Gn; PA0668.3.
DR   EnsemblGenomes-Gn; PA0668.4.
DR   EnsemblGenomes-Gn; PA0668.5.
DR   EnsemblGenomes-Gn; PA0714.1.
DR   EnsemblGenomes-Gn; PA0729.1.
DR   EnsemblGenomes-Gn; PA0826.2.
DR   EnsemblGenomes-Gn; PA0836.1.
DR   EnsemblGenomes-Gn; PA0887.1.
DR   EnsemblGenomes-Gn; PA0905.1.
DR   EnsemblGenomes-Gn; PA0905.2.
DR   EnsemblGenomes-Gn; PA0905.3.
DR   EnsemblGenomes-Gn; PA0922.1.
DR   EnsemblGenomes-Gn; PA0976.1.
DR   EnsemblGenomes-Gn; PA1013.1.
DR   EnsemblGenomes-Gn; PA1030.1.
DR   EnsemblGenomes-Gn; PA1112.1.
DR   EnsemblGenomes-Gn; PA1324.1.
DR   EnsemblGenomes-Gn; PA1530.1.
DR   EnsemblGenomes-Gn; PA1781.1.
DR   EnsemblGenomes-Gn; PA1796.1.
DR   EnsemblGenomes-Gn; PA1796.2.
DR   EnsemblGenomes-Gn; PA1796.3.
DR   EnsemblGenomes-Gn; PA1796.4.
DR   EnsemblGenomes-Gn; PA1804.1.
DR   EnsemblGenomes-Gn; PA2570.1.
DR   EnsemblGenomes-Gn; PA2581.1.
DR   EnsemblGenomes-Gn; PA2583.1.
DR   EnsemblGenomes-Gn; PA2603.1.
DR   EnsemblGenomes-Gn; PA2736.1.
DR   EnsemblGenomes-Gn; PA2744.1.
DR   EnsemblGenomes-Gn; PA2775.1.
DR   EnsemblGenomes-Gn; PA2819.1.
DR   EnsemblGenomes-Gn; PA2819.2.
DR   EnsemblGenomes-Gn; PA2819.3.
DR   EnsemblGenomes-Gn; PA2852.1.
DR   EnsemblGenomes-Gn; PA2942.1.
DR   EnsemblGenomes-Gn; PA2958.1.
DR   EnsemblGenomes-Gn; PA3031.1.
DR   EnsemblGenomes-Gn; PA3094.1.
DR   EnsemblGenomes-Gn; PA3094.2.
DR   EnsemblGenomes-Gn; PA3094.3.
DR   EnsemblGenomes-Gn; PA3133.1.
DR   EnsemblGenomes-Gn; PA3133.2.
DR   EnsemblGenomes-Gn; PA3133.3.
DR   EnsemblGenomes-Gn; PA3133.4.
DR   EnsemblGenomes-Gn; PA3139.1.
DR   EnsemblGenomes-Gn; PA3262.1.
DR   EnsemblGenomes-Gn; PA3262.2.
DR   EnsemblGenomes-Gn; PA3304.1.
DR   EnsemblGenomes-Gn; PA3305.1.
DR   EnsemblGenomes-Gn; PA3366.1.
DR   EnsemblGenomes-Gn; PA3368.1.
DR   EnsemblGenomes-Gn; PA3621.1.
DR   EnsemblGenomes-Gn; PA3824.1.
DR   EnsemblGenomes-Gn; PA4270.1.
DR   EnsemblGenomes-Gn; PA4272.1.
DR   EnsemblGenomes-Gn; PA4276.1.
DR   EnsemblGenomes-Gn; PA4277.1.
DR   EnsemblGenomes-Gn; PA4277.2.
DR   EnsemblGenomes-Gn; PA4277.3.
DR   EnsemblGenomes-Gn; PA4280.1.
DR   EnsemblGenomes-Gn; PA4280.2.
DR   EnsemblGenomes-Gn; PA4280.3.
DR   EnsemblGenomes-Gn; PA4280.4.
DR   EnsemblGenomes-Gn; PA4280.5.
DR   EnsemblGenomes-Gn; PA4406.1.
DR   EnsemblGenomes-Gn; PA4421.1.
DR   EnsemblGenomes-Gn; PA4451.1.
DR   EnsemblGenomes-Gn; PA4524.1.
DR   EnsemblGenomes-Gn; PA4541.1.
DR   EnsemblGenomes-Gn; PA4541.2.
DR   EnsemblGenomes-Gn; PA4541.3.
DR   EnsemblGenomes-Gn; PA4581.1.
DR   EnsemblGenomes-Gn; PA4669.1.
DR   EnsemblGenomes-Gn; PA4673.1.
DR   EnsemblGenomes-Gn; PA4690.1.
DR   EnsemblGenomes-Gn; PA4690.2.
DR   EnsemblGenomes-Gn; PA4690.3.
DR   EnsemblGenomes-Gn; PA4690.4.
DR   EnsemblGenomes-Gn; PA4690.5.
DR   EnsemblGenomes-Gn; PA4704.1.
DR   EnsemblGenomes-Gn; PA4704.2.
DR   EnsemblGenomes-Gn; PA4726.1.
DR   EnsemblGenomes-Gn; PA4726.11.
DR   EnsemblGenomes-Gn; PA4726.2.
DR   EnsemblGenomes-Gn; PA4746.1.
DR   EnsemblGenomes-Gn; PA4746.2.
DR   EnsemblGenomes-Gn; PA4758.1.
DR   EnsemblGenomes-Gn; PA4802.1.
DR   EnsemblGenomes-Gn; PA4937.1.
DR   EnsemblGenomes-Gn; PA4937.2.
DR   EnsemblGenomes-Gn; PA5149.1.
DR   EnsemblGenomes-Gn; PA5160.1.
DR   EnsemblGenomes-Gn; PA5181.1.
DR   EnsemblGenomes-Gn; PA5227.1.
DR   EnsemblGenomes-Gn; PA5316.1.
DR   EnsemblGenomes-Gn; PA5369.1.
DR   EnsemblGenomes-Gn; PA5369.2.
DR   EnsemblGenomes-Gn; PA5369.3.
DR   EnsemblGenomes-Gn; PA5369.4.
DR   EnsemblGenomes-Gn; PA5369.5.
DR   EnsemblGenomes-Tr; EBT00001813379.
DR   EnsemblGenomes-Tr; EBT00001813380.
DR   EnsemblGenomes-Tr; EBT00001813381.
DR   EnsemblGenomes-Tr; EBT00001813382.
DR   EnsemblGenomes-Tr; EBT00001813383.
DR   EnsemblGenomes-Tr; EBT00001813384.
DR   EnsemblGenomes-Tr; EBT00001813385.
DR   EnsemblGenomes-Tr; EBT00001813386.
DR   EnsemblGenomes-Tr; EBT00001813387.
DR   EnsemblGenomes-Tr; EBT00001813388.
DR   EnsemblGenomes-Tr; EBT00001813389.
DR   EnsemblGenomes-Tr; EBT00001813390.
DR   EnsemblGenomes-Tr; EBT00001813391.
DR   EnsemblGenomes-Tr; EBT00001813392.
DR   EnsemblGenomes-Tr; EBT00001813393.
DR   EnsemblGenomes-Tr; EBT00001813394.
DR   EnsemblGenomes-Tr; EBT00001813395.
DR   EnsemblGenomes-Tr; EBT00001813396.
DR   EnsemblGenomes-Tr; EBT00001813397.
DR   EnsemblGenomes-Tr; EBT00001813398.
DR   EnsemblGenomes-Tr; EBT00001813399.
DR   EnsemblGenomes-Tr; EBT00001813400.
DR   EnsemblGenomes-Tr; EBT00001813401.
DR   EnsemblGenomes-Tr; EBT00001813402.
DR   EnsemblGenomes-Tr; EBT00001813403.
DR   EnsemblGenomes-Tr; EBT00001813404.
DR   EnsemblGenomes-Tr; EBT00001813405.
DR   EnsemblGenomes-Tr; EBT00001813406.
DR   EnsemblGenomes-Tr; EBT00001813407.
DR   EnsemblGenomes-Tr; EBT00001813408.
DR   EnsemblGenomes-Tr; EBT00001813409.
DR   EnsemblGenomes-Tr; EBT00001813410.
DR   EnsemblGenomes-Tr; EBT00001813411.
DR   EnsemblGenomes-Tr; EBT00001813412.
DR   EnsemblGenomes-Tr; EBT00001813413.
DR   EnsemblGenomes-Tr; EBT00001813414.
DR   EnsemblGenomes-Tr; EBT00001813415.
DR   EnsemblGenomes-Tr; EBT00001813416.
DR   EnsemblGenomes-Tr; EBT00001813417.
DR   EnsemblGenomes-Tr; EBT00001813418.
DR   EnsemblGenomes-Tr; EBT00001813419.
DR   EnsemblGenomes-Tr; EBT00001813420.
DR   EnsemblGenomes-Tr; EBT00001813421.
DR   EnsemblGenomes-Tr; EBT00001813422.
DR   EnsemblGenomes-Tr; EBT00001813423.
DR   EnsemblGenomes-Tr; EBT00001813424.
DR   EnsemblGenomes-Tr; EBT00001813425.
DR   EnsemblGenomes-Tr; EBT00001813426.
DR   EnsemblGenomes-Tr; EBT00001813427.
DR   EnsemblGenomes-Tr; EBT00001813428.
DR   EnsemblGenomes-Tr; EBT00001813429.
DR   EnsemblGenomes-Tr; EBT00001813430.
DR   EnsemblGenomes-Tr; EBT00001813431.
DR   EnsemblGenomes-Tr; EBT00001813432.
DR   EnsemblGenomes-Tr; EBT00001813433.
DR   EnsemblGenomes-Tr; EBT00001813434.
DR   EnsemblGenomes-Tr; EBT00001813435.
DR   EnsemblGenomes-Tr; EBT00001813436.
DR   EnsemblGenomes-Tr; EBT00001813437.
DR   EnsemblGenomes-Tr; EBT00001813438.
DR   EnsemblGenomes-Tr; EBT00001813439.
DR   EnsemblGenomes-Tr; EBT00001813440.
DR   EnsemblGenomes-Tr; EBT00001813441.
DR   EnsemblGenomes-Tr; EBT00001813442.
DR   EnsemblGenomes-Tr; EBT00001813443.
DR   EnsemblGenomes-Tr; EBT00001813444.
DR   EnsemblGenomes-Tr; EBT00001813445.
DR   EnsemblGenomes-Tr; EBT00001813446.
DR   EnsemblGenomes-Tr; EBT00001813447.
DR   EnsemblGenomes-Tr; EBT00001813448.
DR   EnsemblGenomes-Tr; EBT00001813449.
DR   EnsemblGenomes-Tr; EBT00001813450.
DR   EnsemblGenomes-Tr; EBT00001813451.
DR   EnsemblGenomes-Tr; EBT00001813452.
DR   EnsemblGenomes-Tr; EBT00001813453.
DR   EnsemblGenomes-Tr; EBT00001813454.
DR   EnsemblGenomes-Tr; EBT00001813455.
DR   EnsemblGenomes-Tr; EBT00001813456.
DR   EnsemblGenomes-Tr; EBT00001813457.
DR   EnsemblGenomes-Tr; EBT00001813458.
DR   EnsemblGenomes-Tr; EBT00001813459.
DR   EnsemblGenomes-Tr; EBT00001813460.
DR   EnsemblGenomes-Tr; EBT00001813461.
DR   EnsemblGenomes-Tr; EBT00001813462.
DR   EnsemblGenomes-Tr; EBT00001813463.
DR   EnsemblGenomes-Tr; EBT00001813464.
DR   EnsemblGenomes-Tr; EBT00001813465.
DR   EnsemblGenomes-Tr; EBT00001813466.
DR   EnsemblGenomes-Tr; EBT00001813467.
DR   EnsemblGenomes-Tr; EBT00001813468.
DR   EnsemblGenomes-Tr; EBT00001813469.
DR   EnsemblGenomes-Tr; EBT00001813470.
DR   EnsemblGenomes-Tr; EBT00001813471.
DR   EnsemblGenomes-Tr; EBT00001813472.
DR   EnsemblGenomes-Tr; EBT00001813473.
DR   EnsemblGenomes-Tr; EBT00001813474.
DR   EnsemblGenomes-Tr; EBT00001813475.
DR   EnsemblGenomes-Tr; EBT00001813476.
DR   EnsemblGenomes-Tr; EBT00001813477.
DR   EnsemblGenomes-Tr; EBT00001813478.
DR   EnsemblGenomes-Tr; EBT00001813479.
DR   EnsemblGenomes-Tr; EBT00001813480.
DR   EnsemblGenomes-Tr; EBT00001813481.
DR   EnsemblGenomes-Tr; EBT00001813482.
DR   EnsemblGenomes-Tr; EBT00001813483.
DR   EnsemblGenomes-Tr; EBT00001813484.
DR   EnsemblGenomes-Tr; EBT00001813485.
DR   EnsemblGenomes-Tr; EBT00001813486.
DR   EnsemblGenomes-Tr; EBT00001813487.
DR   EnsemblGenomes-Tr; EBT00001813488.
DR   EnsemblGenomes-Tr; EBT00001813489.
DR   EnsemblGenomes-Tr; EBT00001813490.
DR   EnsemblGenomes-Tr; EBT00001813491.
DR   EnsemblGenomes-Tr; EBT00001813492.
DR   EnsemblGenomes-Tr; EBT00001813493.
DR   EnsemblGenomes-Tr; EBT00001813494.
DR   EnsemblGenomes-Tr; EBT00001813495.
DR   EnsemblGenomes-Tr; EBT00001813496.
DR   EnsemblGenomes-Tr; EBT00001813497.
DR   EnsemblGenomes-Tr; EBT00001813498.
DR   EnsemblGenomes-Tr; EBT00001813499.
DR   EnsemblGenomes-Tr; EBT00001813500.
DR   EnsemblGenomes-Tr; EBT00001813501.
DR   EnsemblGenomes-Tr; EBT00001813502.
DR   EnsemblGenomes-Tr; EBT00001813503.
DR   EnsemblGenomes-Tr; EBT00001813504.
DR   EnsemblGenomes-Tr; EBT00001813505.
DR   EnsemblGenomes-Tr; EBT00001813506.
DR   EnsemblGenomes-Tr; EBT00001813507.
DR   EnsemblGenomes-Tr; EBT00001813508.
DR   EnsemblGenomes-Tr; PA0263.1-1.
DR   EnsemblGenomes-Tr; PA0527.1-1.
DR   EnsemblGenomes-Tr; PA0574.1-1.
DR   EnsemblGenomes-Tr; PA0668.1-1.
DR   EnsemblGenomes-Tr; PA0668.2-1.
DR   EnsemblGenomes-Tr; PA0668.3-1.
DR   EnsemblGenomes-Tr; PA0668.4-1.
DR   EnsemblGenomes-Tr; PA0668.5-1.
DR   EnsemblGenomes-Tr; PA0714.1-1.
DR   EnsemblGenomes-Tr; PA0729.1-1.
DR   EnsemblGenomes-Tr; PA0826.2-1.
DR   EnsemblGenomes-Tr; PA0836.1-1.
DR   EnsemblGenomes-Tr; PA0887.1-1.
DR   EnsemblGenomes-Tr; PA0905.1-1.
DR   EnsemblGenomes-Tr; PA0905.2-1.
DR   EnsemblGenomes-Tr; PA0905.3-1.
DR   EnsemblGenomes-Tr; PA0922.1-1.
DR   EnsemblGenomes-Tr; PA0976.1-1.
DR   EnsemblGenomes-Tr; PA1013.1-1.
DR   EnsemblGenomes-Tr; PA1030.1-1.
DR   EnsemblGenomes-Tr; PA1112.1-1.
DR   EnsemblGenomes-Tr; PA1324.1-1.
DR   EnsemblGenomes-Tr; PA1530.1-1.
DR   EnsemblGenomes-Tr; PA1781.1-1.
DR   EnsemblGenomes-Tr; PA1796.1-1.
DR   EnsemblGenomes-Tr; PA1796.2-1.
DR   EnsemblGenomes-Tr; PA1796.3-1.
DR   EnsemblGenomes-Tr; PA1796.4-1.
DR   EnsemblGenomes-Tr; PA1804.1-1.
DR   EnsemblGenomes-Tr; PA2570.1-1.
DR   EnsemblGenomes-Tr; PA2581.1-1.
DR   EnsemblGenomes-Tr; PA2583.1-1.
DR   EnsemblGenomes-Tr; PA2603.1-1.
DR   EnsemblGenomes-Tr; PA2736.1-1.
DR   EnsemblGenomes-Tr; PA2744.1-1.
DR   EnsemblGenomes-Tr; PA2775.1-1.
DR   EnsemblGenomes-Tr; PA2819.1-1.
DR   EnsemblGenomes-Tr; PA2819.2-1.
DR   EnsemblGenomes-Tr; PA2819.3-1.
DR   EnsemblGenomes-Tr; PA2852.1-1.
DR   EnsemblGenomes-Tr; PA2942.1-1.
DR   EnsemblGenomes-Tr; PA2958.1-1.
DR   EnsemblGenomes-Tr; PA3031.1-1.
DR   EnsemblGenomes-Tr; PA3094.1-1.
DR   EnsemblGenomes-Tr; PA3094.2-1.
DR   EnsemblGenomes-Tr; PA3094.3-1.
DR   EnsemblGenomes-Tr; PA3133.1-1.
DR   EnsemblGenomes-Tr; PA3133.2-1.
DR   EnsemblGenomes-Tr; PA3133.3-1.
DR   EnsemblGenomes-Tr; PA3133.4-1.
DR   EnsemblGenomes-Tr; PA3139.1-1.
DR   EnsemblGenomes-Tr; PA3262.1-1.
DR   EnsemblGenomes-Tr; PA3262.2-1.
DR   EnsemblGenomes-Tr; PA3304.1-1.
DR   EnsemblGenomes-Tr; PA3305.1-1.
DR   EnsemblGenomes-Tr; PA3366.1-1.
DR   EnsemblGenomes-Tr; PA3368.1-1.
DR   EnsemblGenomes-Tr; PA3621.1-1.
DR   EnsemblGenomes-Tr; PA3824.1-1.
DR   EnsemblGenomes-Tr; PA4270.1-1.
DR   EnsemblGenomes-Tr; PA4272.1-1.
DR   EnsemblGenomes-Tr; PA4276.1-1.
DR   EnsemblGenomes-Tr; PA4277.1-1.
DR   EnsemblGenomes-Tr; PA4277.2-1.
DR   EnsemblGenomes-Tr; PA4277.3-1.
DR   EnsemblGenomes-Tr; PA4280.1-1.
DR   EnsemblGenomes-Tr; PA4280.2-1.
DR   EnsemblGenomes-Tr; PA4280.3-1.
DR   EnsemblGenomes-Tr; PA4280.4-1.
DR   EnsemblGenomes-Tr; PA4280.5-1.
DR   EnsemblGenomes-Tr; PA4406.1-1.
DR   EnsemblGenomes-Tr; PA4421.1-1.
DR   EnsemblGenomes-Tr; PA4451.1-1.
DR   EnsemblGenomes-Tr; PA4524.1-1.
DR   EnsemblGenomes-Tr; PA4541.1-1.
DR   EnsemblGenomes-Tr; PA4541.2-1.
DR   EnsemblGenomes-Tr; PA4541.3-1.
DR   EnsemblGenomes-Tr; PA4581.1-1.
DR   EnsemblGenomes-Tr; PA4669.1-1.
DR   EnsemblGenomes-Tr; PA4673.1-1.
DR   EnsemblGenomes-Tr; PA4690.1-1.
DR   EnsemblGenomes-Tr; PA4690.2-1.
DR   EnsemblGenomes-Tr; PA4690.3-1.
DR   EnsemblGenomes-Tr; PA4690.4-1.
DR   EnsemblGenomes-Tr; PA4690.5-1.
DR   EnsemblGenomes-Tr; PA4704.1-1.
DR   EnsemblGenomes-Tr; PA4704.2-1.
DR   EnsemblGenomes-Tr; PA4726.1-1.
DR   EnsemblGenomes-Tr; PA4726.11-1.
DR   EnsemblGenomes-Tr; PA4726.2-1.
DR   EnsemblGenomes-Tr; PA4746.1-1.
DR   EnsemblGenomes-Tr; PA4746.2-1.
DR   EnsemblGenomes-Tr; PA4758.1-1.
DR   EnsemblGenomes-Tr; PA4802.1-1.
DR   EnsemblGenomes-Tr; PA4937.1-1.
DR   EnsemblGenomes-Tr; PA4937.2-1.
DR   EnsemblGenomes-Tr; PA5149.1-1.
DR   EnsemblGenomes-Tr; PA5160.1-1.
DR   EnsemblGenomes-Tr; PA5181.1-1.
DR   EnsemblGenomes-Tr; PA5227.1-1.
DR   EnsemblGenomes-Tr; PA5316.1-1.
DR   EnsemblGenomes-Tr; PA5369.1-1.
DR   EnsemblGenomes-Tr; PA5369.2-1.
DR   EnsemblGenomes-Tr; PA5369.3-1.
DR   EnsemblGenomes-Tr; PA5369.4-1.
DR   EnsemblGenomes-Tr; PA5369.5-1.
DR   EuropePMC; PMC1175016; 15985546.
DR   EuropePMC; PMC127520; 11976128.
DR   EuropePMC; PMC135229; 12142426.
DR   EuropePMC; PMC135364; 12218019.
DR   EuropePMC; PMC135457; 12446641.
DR   EuropePMC; PMC1386717; 16423288.
DR   EuropePMC; PMC168958; 12824359.
DR   EuropePMC; PMC179861; 12904354.
DR   EuropePMC; PMC1932541; 17517839.
DR   EuropePMC; PMC2228313; 17915007.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2668417; 19201795.
DR   EuropePMC; PMC2813009; 20008172.
DR   EuropePMC; PMC2892462; 20504315.
DR   EuropePMC; PMC2918963; 20562273.
DR   EuropePMC; PMC2934948; 20566763.
DR   EuropePMC; PMC2937370; 20622068.
DR   EuropePMC; PMC2976230; 20817796.
DR   EuropePMC; PMC303451; 14679232.
DR   EuropePMC; PMC3067716; 21227987.
DR   EuropePMC; PMC309951; 14660376.
DR   EuropePMC; PMC3111181; 21673888.
DR   EuropePMC; PMC3165259; 21705548.
DR   EuropePMC; PMC3256650; 22037403.
DR   EuropePMC; PMC3318375; 22271862.
DR   EuropePMC; PMC3330761; 22566756.
DR   EuropePMC; PMC3375315; 22719254.
DR   EuropePMC; PMC3427078; 22869726.
DR   EuropePMC; PMC3494270; 22821013.
DR   EuropePMC; PMC3497882; 22950599.
DR   EuropePMC; PMC3509433; 23143799.
DR   EuropePMC; PMC3553811; 23230295.
DR   EuropePMC; PMC3557286; 23382903.
DR   EuropePMC; PMC3592358; 17381274.
DR   EuropePMC; PMC3638308; 23611906.
DR   EuropePMC; PMC3679898; 23705883.
DR   EuropePMC; PMC3693891; 23742765.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC3817154; 23948732.
DR   EuropePMC; PMC3817763; 24353667.
DR   EuropePMC; PMC3820363; 17526836.
DR   EuropePMC; PMC383159; 15066830.
DR   EuropePMC; PMC3948848; 24614163.
DR   EuropePMC; PMC4109851; 25057820.
DR   EuropePMC; PMC4155085; 25168460.
DR   EuropePMC; PMC4187922; 25070098.
DR   EuropePMC; PMC4244539; 25505462.
DR   EuropePMC; PMC427722; 15184137.
DR   EuropePMC; PMC4291382; 25367914.
DR   EuropePMC; PMC4394780; 25712351.
DR   EuropePMC; PMC4542158; 26290475.
DR   EuropePMC; PMC4673735; 26645211.
DR   EuropePMC; PMC4694141; 26459101.
DR   EuropePMC; PMC4710005; 26754847.
DR   EuropePMC; PMC4739549; 26841043.
DR   EuropePMC; PMC4796923; 26405829.
DR   EuropePMC; PMC4821235; 26962050.
DR   EuropePMC; PMC4824433; 27055243.
DR   EuropePMC; PMC4888284; 27257541.
DR   EuropePMC; PMC4957987; 27547539.
DR   EuropePMC; PMC4960238; 27507963.
DR   EuropePMC; PMC5054682; 27713502.
DR   EuropePMC; PMC5075095; 27600046.
DR   EuropePMC; PMC5217972; 28060939.
DR   EuropePMC; PMC5358918; 28223461.
DR   EuropePMC; PMC549560; 15698474.
DR   EuropePMC; PMC5551671; 28642945.
DR   EuropePMC; PMC5561291; 28667108.
DR   EuropePMC; PMC5666152; 29089424.
DR   EuropePMC; PMC5700319; 28993328.
DR   EuropePMC; PMC5718518; 29211780.
DR   EuropePMC; PMC5732189; 29321769.
DR   EuropePMC; PMC5785013; 29370270.
DR   EuropePMC; PMC5840502; 29229490.
DR   EuropePMC; PMC5910555; 29678129.
DR   EuropePMC; PMC5971611; 29581123.
DR   EuropePMC; PMC6016177; 29992165.
DR   EuropePMC; PMC6126813; 30188914.
DR   EuropePMC; PMC6136817; 30212579.
DR   EuropePMC; PMC6188897; 30281587.
DR   EuropePMC; PMC6193480; 30364310.
DR   EuropePMC; PMC6220265; 30405166.
DR   EuropePMC; PMC6506614; 31086830.
DR   EuropePMC; PMC6588701; 31227753.
DR   EuropePMC; PMC6594737; 30918162.
DR   EuropePMC; PMC99098; 11752244.
DR   GOA; P0C348.
DR   GOA; P22609.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01372; CRISPR-DR59.
DR   RFAM; RF01665; P13.
DR   RFAM; RF01668; P10.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01670; P17.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01672; P2.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01677; P35.
DR   RFAM; RF01678; P37.
DR   RFAM; RF01679; P36.
DR   RFAM; RF01680; P5.
DR   RFAM; RF01681; P4.
DR   RFAM; RF01682; P8.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; AE004091.
DR   SILVA-SSU; AE004091.
DR   StrainInfo; 154131; 0.
DR   UniProtKB/Swiss-Prot; P0C348; RF2_PSEAE.
DR   UniProtKB/Swiss-Prot; P22609; PILC_PSEAE.
DR   UniProtKB/Swiss-Prot; P58040; YF7A_PSEAE.
DR   UniProtKB/Swiss-Prot; Q03381; REGB_PSEAE.
XX
CC   On or before Jul 7, 2006 this sequence version replaced gi:9945818,
CC   gi:9945828, gi:9945843, gi:9945853, gi:9945863, gi:9945872,
CC   gi:9945886, gi:9945902, gi:9945917, gi:9945928, gi:9945943,
CC   gi:9945958, gi:9945968, gi:9945978, gi:9945990, gi:9946002,
CC   gi:9946013, gi:9946024, gi:9946031, gi:9946043, gi:9946055,
CC   gi:9946066, gi:9946077, gi:9946086, gi:9946099, gi:9946107,
CC   gi:9946120, gi:9946133, gi:9946144, gi:9946152, gi:9946164,
CC   gi:9946176, gi:9946188, gi:9946199, gi:9946210, gi:9946221,
CC   gi:9946234, gi:9946248, gi:9946261, gi:9946272, gi:9946284,
CC   gi:9946293, gi:9946303, gi:9946313, gi:9946320, gi:9946332,
CC   gi:9946345, gi:9946361, gi:9946372, gi:9946385, gi:9946398,
CC   gi:9946412, gi:9946421, gi:9946436, gi:9946446, gi:9946459,
CC   gi:9946468, gi:9946478, gi:9946491, gi:9946508, gi:9946522,
CC   gi:9946537, gi:9946547, gi:9946553, gi:9946568, gi:9946572,
CC   gi:9946584, gi:9946596, gi:9946611, gi:9946622, gi:9946634,
CC   gi:9946646, gi:9946657, gi:9946669, gi:9946679, gi:9946687,
CC   gi:9946699, gi:9946710, gi:9946725, gi:9946736, gi:9946745,
CC   gi:9946758, gi:9946768, gi:9946783, gi:9946795, gi:9946805,
CC   gi:9946819, gi:9946828, gi:9946838, gi:9946851, gi:9946865,
CC   gi:9946882, gi:9946896, gi:9946910, gi:9946924, gi:9946936,
CC   gi:9946945, gi:9946960, gi:9946974, gi:9946985, gi:9947008,
CC   gi:9947024, gi:9947034, gi:9947047, gi:9947060, gi:9947070,
CC   gi:9947079, gi:9947089, gi:9947102, gi:9947110, gi:9947122,
CC   gi:9947135, gi:9947150, gi:9947164, gi:9947174, gi:9947183,
CC   gi:9947194, gi:9947204, gi:9947217, gi:9947228, gi:9947240,
CC   gi:9947253, gi:9947263, gi:9947274, gi:9947283, gi:9947294,
CC   gi:9947308, gi:9947316, gi:9947327, gi:9947339, gi:9947350,
CC   gi:9947360, gi:9947372, gi:9947382, gi:9947391, gi:9947404,
CC   gi:9947415, gi:9947430, gi:9947444, gi:9947455, gi:9947468,
CC   gi:9947482, gi:9947492, gi:9947506, gi:9947516, gi:9947525,
CC   gi:9947536, gi:9947551, gi:9947563, gi:9947574, gi:9947587,
CC   gi:9947599, gi:9947609, gi:9947619, gi:9947630, gi:9947644,
CC   gi:9947658, gi:9947671, gi:9947687, gi:9947702, gi:9947712,
CC   gi:9947724, gi:9947739, gi:9947751, gi:9947762, gi:9947771,
CC   gi:9947780, gi:9947789, gi:9947797, gi:9947810, gi:9947825,
CC   gi:9947834, gi:9947846, gi:9947856, gi:9947868, gi:9947880,
CC   gi:9947890, gi:9947901, gi:9947912, gi:9947920, gi:9947929,
CC   gi:9947938, gi:9947948, gi:9947961, gi:9947973, gi:9947983,
CC   gi:9947995, gi:9948007, gi:9948018, gi:9948028, gi:9948041,
CC   gi:9948050, gi:9948061, gi:9948070, gi:9948079, gi:9948085,
CC   gi:9948093, gi:9948105, gi:9948116, gi:9948129, gi:9948139,
CC   gi:9948150, gi:9948163, gi:9948178, gi:9948185, gi:9948199,
CC   gi:9948213, gi:9948226, gi:9948237, gi:9948246, gi:9948267,
CC   gi:9948277, gi:9948287, gi:9948298, gi:9948311, gi:9948321,
CC   gi:9948332, gi:9948338, gi:9948352, gi:9948361, gi:9948372,
CC   gi:9948382, gi:9948395, gi:9948405, gi:9948415, gi:9948426,
CC   gi:9948438, gi:9948444, gi:9948446, gi:9948460, gi:9948470,
CC   gi:9948483, gi:9948492, gi:9948501, gi:9948512, gi:9948522,
CC   gi:9948532, gi:9948548, gi:9948560, gi:9948573, gi:9948580,
CC   gi:9948587, gi:9948598, gi:9948607, gi:9948617, gi:9948627,
CC   gi:9948636, gi:9948646, gi:9948654, gi:9948665, gi:9948678,
CC   gi:9948688, gi:9948701, gi:9948710, gi:9948719, gi:9948730,
CC   gi:9948750, gi:9948760, gi:9948770, gi:9948782, gi:9948792,
CC   gi:9948806, gi:9948813, gi:9948825, gi:9948838, gi:9948851,
CC   gi:9948864, gi:9948876, gi:9948890, gi:9948904, gi:9948916,
CC   gi:9948927, gi:9948940, gi:9948952, gi:9948965, gi:9948977,
CC   gi:9948986, gi:9948999, gi:9949009, gi:9949021, gi:9949032,
CC   gi:9949041, gi:9949054, gi:9949067, gi:9949083, gi:9949100,
CC   gi:9949108, gi:9949119, gi:9949130, gi:9949143, gi:9949154,
CC   gi:9949171, gi:9949186, gi:9949194, gi:9949204, gi:9949216,
CC   gi:9949227, gi:9949239, gi:9949252, gi:9949265, gi:9949275,
CC   gi:9949284, gi:9949294, gi:9949308, gi:9949317, gi:9949336,
CC   gi:9949350, gi:9949362, gi:9949378, gi:9949388, gi:9949400,
CC   gi:9949413, gi:9949424, gi:9949433, gi:9949446, gi:9949456,
CC   gi:9949466, gi:9949476, gi:9949489, gi:9949500, gi:9949520,
CC   gi:9949533, gi:9949544, gi:9949556, gi:9949566, gi:9949580,
CC   gi:9949593, gi:9949604, gi:9949611, gi:9949624, gi:9949633,
CC   gi:9949650, gi:9949662, gi:9949672, gi:9949684, gi:9949692,
CC   gi:9949701, gi:9949712, gi:9949722, gi:9949735, gi:9949749,
CC   gi:9949761, gi:9949772, gi:9949786, gi:9949799, gi:9949809,
CC   gi:9949822, gi:9949835, gi:9949846, gi:9949857, gi:9949873,
CC   gi:9949882, gi:9949895, gi:9949904, gi:9949917, gi:9949931,
CC   gi:9949939, gi:9949950, gi:9949963, gi:9949981, gi:9949999,
CC   gi:9950011, gi:9950021, gi:9950035, gi:9950044, gi:9950055,
CC   gi:9950067, gi:9950076, gi:9950086, gi:9950097, gi:9950106,
CC   gi:9950116, gi:9950125, gi:9950134, gi:9950147, gi:9950159,
CC   gi:9950168, gi:9950181, gi:9950200, gi:9950214, gi:9950223,
CC   gi:9950236, gi:9950250, gi:9950265, gi:9950277, gi:9950284,
CC   gi:9950296, gi:9950306, gi:9950315, gi:9950327, gi:9950337,
CC   gi:9950347, gi:9950360, gi:9950370, gi:9950382, gi:9950394,
CC   gi:9950405, gi:9950414, gi:9950422, gi:9950434, gi:9950442,
CC   gi:9950451, gi:9950481, gi:9950489, gi:9950500, gi:9950507,
CC   gi:9950517, gi:9950528, gi:9950537, gi:9950550, gi:9950560,
CC   gi:9950571, gi:9950587, gi:9950598, gi:9950606, gi:9950621,
CC   gi:9950633, gi:9950654, gi:9950668, gi:9950678, gi:9950692,
CC   gi:9950708, gi:9950716, gi:9950731, gi:9950740, gi:9950752,
CC   gi:9950760, gi:9950769, gi:9950785, gi:9950793, gi:9950807,
CC   gi:9950819, gi:9950829, gi:9950839, gi:9950849, gi:9950857,
CC   gi:9950869, gi:9950878, gi:9950888, gi:9950901, gi:9950912,
CC   gi:9950926, gi:9950939, gi:9950947, gi:9950954, gi:9950968,
CC   gi:9950982, gi:9950991, gi:9951001, gi:9951014, gi:9951025,
CC   gi:9951037, gi:9951049, gi:9951063, gi:9951076, gi:9951083,
CC   gi:9951094, gi:9951107, gi:9951115, gi:9951126, gi:9951134,
CC   gi:9951147, gi:9951162, gi:9951173, gi:9951184, gi:9951195,
CC   gi:9951206, gi:9951217, gi:9951230, gi:9951241, gi:9951251,
CC   gi:9951264, gi:9951274, gi:9951286, gi:9951301, gi:9951308,
CC   gi:9951315, gi:9951326, gi:9951336, gi:9951346, gi:9951358,
CC   gi:9951372, gi:9951385, gi:9951395, gi:9951407, gi:9951415,
CC   gi:9951424, gi:9951437, gi:9951450, gi:9951462, gi:9951472,
CC   gi:9951482, gi:9951493, gi:9951505, gi:9951515, gi:9951526,
CC   gi:9951541, gi:9951553, gi:9951564, gi:9951575, gi:9951584,
CC   gi:9951596, gi:9951607, gi:9951615, gi:9951628, gi:9951639,
CC   gi:9951650, gi:9951665, gi:9951680, gi:9951690, gi:9951695,
CC   gi:9951705, gi:9951718, gi:9951727, gi:9951740, gi:9951749,
CC   gi:9951760, gi:9951770, gi:9951776, gi:9951791, gi:9951805,
CC   gi:9951814, gi:9951826, gi:9951838, gi:9951849, gi:9951861,
CC   gi:9951872, gi:9951884, gi:9951902, gi:12057214.
CC   -----------------------------------------------------------------
CC   This represents the Sept 08, 2010 version of the continually
CC   updated, reviewed, Pseudomonas aeruginosa PAO1 genome annotation
CC   from PseudoCap (see http://www.pseudomonas.com for the latest
CC   updates and links to alternate annotations). This update includes
CC   updated base pair coordinates and new features. PseudoCap is
CC   coordinated by Fiona S.L. Brinkman (Simon Fraser University,
CC   Canada) and Robert E.W. Hancock (University of British Columbia,
CC   Canada) with database development by Geoff Winsor (Simon Fraser
CC   University). We welcome submission through
CC   www.pseudomonas.com of any proposed changes.
CC   'Protein name confidence' is used to rate our confidence of the
CC   accuracy of the protein name.
CC   Class 1: Function experimentally demonstrated in P. aeruginosa.
CC   Class 2: Function of highly similar gene experimentally
CC   demonstrated in another organism (and gene context consistent in
CC   terms of pathways its involved in, if known).
CC   Class 3: Function proposed based on presence of conserved amino
CC   acid motif, structural feature or limited sequence similarity to an
CC   experimentally studied gene.
CC   Class 4: Homologs of previously reported genes of unknown function,
CC   or no similarity to any previously reported sequences.
CC   ------------------------------------------------------------------.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6264404
FT                   /organism="Pseudomonas aeruginosa PAO1"
FT                   /strain="PAO1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:208964"
FT   gene            483..2027
FT                   /gene="dnaA"
FT                   /locus_tag="PA0001"
FT   CDS_pept        483..2027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PA0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03391"
FT                   /db_xref="GOA:Q9I7C5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7C5"
FT                   /protein_id="AAG03391.1"
FT                   /translation="MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQTHVAPPPPVA
FT                   PPPAPVQPVSAAPVVVPREELPPVTTAPSVSSDPYEPEEPSIDPLAAAMPAGAAPAVRT
FT                   ERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNLKHGYNPLFLYGGVG
FT                   LGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLI
FT                   DDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVA
FT                   VEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGR
FT                   PITIELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAM
FT                   ALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLLRTLTT"
FT   gene            2056..3159
FT                   /gene="dnaN"
FT                   /locus_tag="PA0002"
FT   CDS_pept        2056..3159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PA0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03392"
FT                   /db_xref="GOA:Q9I7C4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:4TR8"
FT                   /db_xref="PDB:4TSZ"
FT                   /db_xref="PDB:6AMS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7C4"
FT                   /protein_id="AAG03392.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVN
FT                   GGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRG
FT                   IRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFI
FT                   LSDSNSSALVHEADNDDSAYVVMPMRL"
FT   gene            3169..4278
FT                   /gene="recF"
FT                   /locus_tag="PA0003"
FT   CDS_pept        3169..4278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PA0003"
FT                   /product="RecF protein"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03393"
FT                   /db_xref="GOA:Q9I7C3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7C3"
FT                   /protein_id="AAG03393.1"
FT                   /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHL
FT                   LGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQNAR
FT                   SAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRN
FT                   SWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSY
FT                   YRGWDKDRDLLEVLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQKLVVC
FT                   ALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLLK
FT                   DGWRTDTPVSMFHVEHGKVSQTTTIGSEA"
FT   gene            4275..6695
FT                   /gene="gyrB"
FT                   /locus_tag="PA0004"
FT   CDS_pept        4275..6695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PA0004"
FT                   /product="DNA gyrase subunit B"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03394"
FT                   /db_xref="GOA:Q9I7C2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7C2"
FT                   /protein_id="AAG03394.1"
FT                   /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVGETD
FT                   GSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFKYEGG
FT                   LKAFVEYLNTNKTAVNEVFHFNVQREEDGVGVEVALQWNDSFNENLLCFTNNIPQRDGG
FT                   THLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQMPELIERGYIYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDASLHVNEHAPG
FT                   LSGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLANESAMQGWLEKF
FT                   QARLTAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRDFFASNDYRSVSL
FT                   LGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQRYKGLGEMNPEQLW
FT                   ETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALAVSNLDV"
FT   gene            complement(7018..7791)
FT                   /gene="lptA"
FT                   /locus_tag="PA0005"
FT   CDS_pept        complement(7018..7791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptA"
FT                   /locus_tag="PA0005"
FT                   /product="lysophosphatidic acid acyltransferase, LptA"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03395"
FT                   /db_xref="GOA:Q9I7C1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7C1"
FT                   /protein_id="AAG03395.1"
FT                   /translation="MSTVQAIRTVLFYLLLSASAFVWGTLSFFIAPILPFRARYRFVVQ
FT                   NWCRFAIWLTRVVAGIRYEVRGLENIPEKPCVILSKHQSTWETFFLSGFFEPLSQVLKR
FT                   ELLYVPFFGWALALLKPIAIDRSQPKLALKQLAKQGDECLKKGAWVLIFPEGTRIPVGQ
FT                   MGKFSRGGTALAVNAGLPVLPIAHNAGQYWPKAGWAKYPGTIQVVIGPAMHAEGEGPRA
FT                   IAELNQRAEAWVSETMAEISPIQQRVSHPEPSVVS"
FT   gene            complement(7803..8339)
FT                   /locus_tag="PA0006"
FT   CDS_pept        complement(7803..8339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03396"
FT                   /db_xref="GOA:Q9I7C0"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7C0"
FT                   /protein_id="AAG03396.1"
FT                   /translation="MSRSLLILDRDGVINLDSDDYIKTLDEWIPIPSSIEAIARLSQAG
FT                   WTVAVATNQSGIARGYYDLAVLEAMHARLRELVAEQGGEVGLIVYCPHGPDDGCDCRKP
FT                   KPGMLRQIGEHYGVDLSGIWFVGDSIGDLEAARAVDCQPVLVKTGKGVRTLGKPLPEGT
FT                   LIFDDLAAVASALLQ"
FT   gene            8671..10377
FT                   /locus_tag="PA0007"
FT   CDS_pept        8671..10377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0007"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03397"
FT                   /db_xref="GOA:Q9I7B9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7B9"
FT                   /protein_id="AAG03397.1"
FT                   /translation="MKRLKKTLHLSSLSLASLALSSAALAAAPVMLDQGKEWTESHRQD
FT                   FYSRDQGSQVMPLPWLKALRQPDGTPFLADSLARYGYLPNPKAPAEGLPVGFTVAGTGA
FT                   RQMVGMTCSACHTRQIEVKGTAYRIDGGPAIVDFQAFLADLDRAVGPLTSDDAAFDAFA
FT                   KPILGANPPPGARDALLAAVKEWYEPYHTLIERALPKDTWGPARLDAVSMIFNRLTGLD
FT                   IGTAPPYLIPDNIKAADAPVRYPFLWNAARQNKTQWPGFAANGNDLLGLARNVGEVYGV
FT                   FATFHPQKSKFHLLGMDYLKINSANFHGLGKLEDLIKKIGPPKWPWAVDKHLARKGALI
FT                   FARKTDEGGCVECHGIRIKDLVLWDTPLRDVGSDSRQHAILDGQVQTGVMEGARMPFGQ
FT                   PLKATDGAFDVLAVAVAGSILQHFVPILGEKHDAKAAAVKPESVMTDETRQLLTAFQKP
FT                   VRTQADPYPYESRVLQGIWAAAPYLHNGSVPTLEELLKPAAERVESFPVGSAYDVDKVG
FT                   LAAQQTQFGSYVLKTTGCEQRDSGNSRCGHEYGTSLSAEEKRALLEYLKVL"
FT   gene            complement(10434..12488)
FT                   /gene="glyS"
FT                   /locus_tag="PA0008"
FT   CDS_pept        complement(10434..12488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PA0008"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03398"
FT                   /db_xref="GOA:Q9I7B8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7B8"
FT                   /protein_id="AAG03398.1"
FT                   /translation="MSAKDFLVELGTEELPPKALNSLGEAFLSGIEKGLKAAGLSYAAA
FT                   RFYAAPRRLAVLVEQLAVQQPDRTVNLDGPPLQAAFDASGNPTQAALGFAKKCGVDLQQ
FT                   IDKSGPKLRFIQTIAGQPAAGLLPGIVEASLNELPIPKRMRWAARREEFVRPTQWLVML
FT                   FGDDVVECEILAQKAGRESRGHRFHNPDNVRISSPAAYLEDLRGAHVLADFAERRELIA
FT                   KRVAELAAEQQGSAIVPPSLLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQK
FT                   YFCLLDANGKLLPRFITVANVESKAPENIVSGNEKVVRPRLTDAEFFFKQDKKQPLESF
FT                   NERLRNVVFQAQLGTVFEKAQRVSGLAAYIAERIGGNAQNASRAGILSKCDLATEMVGE
FT                   FPEMQGIAGYYYATHGGEAEDVALALNEQYMPRGAGAELPSTLTGAAVAVADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLVAAVNAAVEQYGDKVKAAGLAE
FT                   QVLDFVFDRLRARYEDEGVDVAVYQSVRALKPSSPLDFDQRVQAVQAFRQLPEAEALAA
FT                   ANKRVSNILAKSEDEVPPNVDASLLVEAAEKALGSAVANAESEVAPLAAARDYRAALAR
FT                   LAALREPVDTFFADVMVNVDDAAVRANRYALLAKLRGSFLGVADISLLG"
FT   gene            complement(12488..13435)
FT                   /gene="glyQ"
FT                   /locus_tag="PA0009"
FT   CDS_pept        complement(12488..13435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PA0009"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03399"
FT                   /db_xref="GOA:Q9I7B7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7B7"
FT                   /protein_id="AAG03399.1"
FT                   /translation="MSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSL
FT                   KAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLVWTDGPFGKVTYGDVFHQNEVEQSTFNFEHANVPKLF
FT                   ELFDFYESEANRLIALELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLAR
FT                   AVAQSYLQARARLGFPMATPELRDEVLAKLKEAE"
FT   gene            13540..14091
FT                   /gene="tag"
FT                   /locus_tag="PA0010"
FT   CDS_pept        13540..14091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="PA0010"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03400"
FT                   /db_xref="GOA:Q9I7B6"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7B6"
FT                   /protein_id="AAG03400.1"
FT                   /translation="MPRCFWCNDDPLYMAYHDEEWGVPQRDPDALFELLLLEGFQAGLS
FT                   WITVLKKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRAKLNAARQNAQAWLE
FT                   LDDPAGFLWSFVGGQPKINHFAGRAEVPAITPEAEAMSKALRKAGFNFVGPTICYAFMQ
FT                   ASGMVMDHTQDCDRYAQLVG"
FT   gene            14235..15122
FT                   /locus_tag="PA0011"
FT   CDS_pept        14235..15122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0011"
FT                   /product="probable 2-OH-lauroyltransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03401"
FT                   /db_xref="GOA:Q9I7B5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7B5"
FT                   /protein_id="AAG03401.1"
FT                   /translation="MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREV
FT                   VRINLSKCFPELSETELEKLVGQSLMDIGRTLTESACAWIWPPEKSLRYIREVEGMEVL
FT                   EEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQLGNR
FT                   VAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGK
FT                   ARGVFFHAVRLPDGSGYKVILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSM
FT                   KRFKNRPDGEKKWY"
FT   gene            15207..15473
FT                   /locus_tag="PA0012"
FT   CDS_pept        15207..15473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0012"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03402"
FT                   /db_xref="GOA:Q9I7B4"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7B4"
FT                   /protein_id="AAG03402.1"
FT                   /translation="MDNQRQYPRTPLKCRIRISHPLFGELMAQTRDLSDTGVYVKHPDL
FT                   TQLPTGSVVTGQVQDLPIDAPILQMEVVRVDAEGVGLRFLSEA"
FT   gene            15620..16273
FT                   /locus_tag="PA0013"
FT   CDS_pept        15620..16273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03403"
FT                   /db_xref="GOA:Q9I7B3"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7B3"
FT                   /protein_id="AAG03403.1"
FT                   /translation="MSASSPAAWRGTLAGLIAFHIFIIIASNYLVQLPITLFGWHTTWG
FT                   AFSFPFIFLATDLTVRLLGKGPARLVIARVMIPALIASYVVSVLFQEAAFRGFSALLEF
FT                   NTFVARISLASFLAYVLGQILDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFFVAF
FT                   WRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPQSNA"
FT   gene            complement(16335..16607)
FT                   /locus_tag="PA0014"
FT   CDS_pept        complement(16335..16607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0014"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03404"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7B2"
FT                   /protein_id="AAG03404.1"
FT                   /translation="MSKQERSVPSYVEYPYEQAILYVHRNASANEMLESVQERLRALLG
FT                   LLHALERIEVRTGLGVPIQRVAHILVTLGGDALTLLTAAHRATTS"
FT   gene            complement(16900..17217)
FT                   /locus_tag="PA0015"
FT   CDS_pept        complement(16900..17217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0015"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03405"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7B1"
FT                   /protein_id="AAG03405.1"
FT                   /translation="MMIEGLEKMLAKGVDNALLRFGLGKGYLDAGDAERAAEHLQRCVE
FT                   QDPKYSAGWKLLGKARQAAGDLAGARQAWEQGLATAATHGDKQAEKEMTVFLRKLDRAR
FT                   T"
FT   gene            complement(17366..18739)
FT                   /gene="trkA"
FT                   /locus_tag="PA0016"
FT   CDS_pept        complement(17366..18739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PA0016"
FT                   /product="potassium uptake protein TrkA"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03406"
FT                   /db_xref="GOA:Q9I7B0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7B0"
FT                   /protein_id="AAG03406.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREPAY
FT                   LTRTGLFDNEAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAYYGG
FT                   PLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIRAVMG
FT                   EMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDSTIVLNG
FT                   SASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSKVIGRSIN
FT                   EIKLPPGTTIGALVRDEEVLIAHGDTRIESGDHVLLFLVDKKYIRDVERLFQAGLTFF"
FT   gene            complement(18767..20071)
FT                   /locus_tag="PA0017"
FT   CDS_pept        complement(18767..20071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03407"
FT                   /db_xref="GOA:Q9I7A9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7A9"
FT                   /protein_id="AAG03407.1"
FT                   /translation="MNPRLAACQALAAVLAGRASLSGALPPQLDKVAPRDRGLTQELAF
FT                   GAARWQPRLQALAARLLQKPFKAADTDIHALLLIGLYQLLYTRIPPHAAIGETVGCADK
FT                   LKKGWAKGVLNAVLRRAQREGETLLAEVDRDPSARLGHPRWLLKALKQAWPEQLDALCA
FT                   ANNAHPPMTLRVNRRHGERDAYLAELAEAGIKARACDYSRDGIQLAAPRDVRELPGFAE
FT                   GRVSVQDEAAQLAAEQLESAPGQRVLDACCAPGGKTCHLLETQPELAEVVAVDLEESRL
FT                   VRVRENLQRLGLQASLVAADARATGEWWDGKPFQRILLDAPCSATGVIRRHPDIKLARK
FT                   PEDIAALAHLQGELLDALWPTLEVGGVLLYATCSVMPAENSDSIAAFLARTPGARELDL
FT                   PGPWGMKQPHGRQLLPQVEGHDGFYYAKLIKISAR"
FT   gene            complement(20068..21012)
FT                   /gene="fmt"
FT                   /locus_tag="PA0018"
FT   CDS_pept        complement(20068..21012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PA0018"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03408"
FT                   /db_xref="GOA:O85732"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="PDB:5UAI"
FT                   /db_xref="UniProtKB/Swiss-Prot:O85732"
FT                   /protein_id="AAG03408.1"
FT                   /translation="MSQALRIVFAGTPEFAAEHLKALLDTPHRIVAVYTQPDRPAGRGQ
FT                   KLMPSAVKSLALEHGLPVMQPQSLRNAEAQAELAALRADLMVVVAYGLILPQAVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMQMEAGLDTGPMLLKVSTPISAAD
FT                   TGGSLHDRLAALGPKAVIEAIAGLAAGTLHGEIQDDALATYAHKLNKDEARLDWSRPAV
FT                   ELERQVRAFTPWPVCHTSLADAPLKVLGASLGQGSGAPGTILEASRDGLLVACGEGALR
FT                   LTRLQLPGGKPLAFADLYNSRREQFAAGQVLGQ"
FT   gene            complement(21067..21573)
FT                   /gene="def"
FT                   /locus_tag="PA0019"
FT   CDS_pept        complement(21067..21573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PA0019"
FT                   /product="polypeptide deformylase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03409"
FT                   /db_xref="GOA:Q9I7A8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="PDB:1IX1"
FT                   /db_xref="PDB:1LRY"
FT                   /db_xref="PDB:1N5N"
FT                   /db_xref="PDB:1S17"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7A8"
FT                   /protein_id="AAG03409.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDR
FT                   PQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQ
FT                   HRQQA"
FT   gene            21712..22737
FT                   /locus_tag="PA0020"
FT   CDS_pept        21712..22737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0020"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03410"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7A7"
FT                   /protein_id="AAG03410.1"
FT                   /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISGK
FT                   FLRQPWKWPELWHANPQIQNPHLIYPGDTLSLVYVDGQPRLVLNRGESRGTIKLSPKIR
FT                   STPIAEAIPTIPLDKINSFLLANRIVDDEKTFTSAPYIVAGNAERIVSGTGDRIYARGK
FT                   FADGQPAYGIFRQGKVYIDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQEVRL
FT                   GDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGQRDGLAEGN
FT                   VLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYKKLSYALVLMASRPLSVTDRVQN
FT                   P"
FT   gene            22872..23960
FT                   /locus_tag="PA0021"
FT   CDS_pept        22872..23960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03411"
FT                   /db_xref="GOA:Q9I7A6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7A6"
FT                   /protein_id="AAG03411.1"
FT                   /translation="MKNHSPAELEARLRLHGLPELGPMRFLRLIEAFGSASSALAAPAS
FT                   AWRTLGVPAEAAAARRSPAVREAAGEALRWLEGLRRHLLMWDDPGYPALLAEVADAPPL
FT                   LYVEGAPETLERPQLAMVGSRRASPAGLGTARSFARSLAQGGFAITSGLALGIDGAAHE
FT                   GALEAGGATVAVLGTGLRRLYPRRHEALARRIVEGGGALVSELPLDSPPLPANFPRRNR
FT                   IISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIRDGALL
FT                   VESVGHVLEALRGWAQAEPAEAPAQPLPHPLLALLRAAPYTSEGLAAASGMTLPDVLAT
FT                   LSELELDGRVACEAGTWVHRSG"
FT   gene            24001..24558
FT                   /locus_tag="PA0022"
FT   CDS_pept        24001..24558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03412"
FT                   /db_xref="GOA:Q9I7A5"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I7A5"
FT                   /protein_id="AAG03412.1"
FT                   /translation="MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLA
FT                   LKARPVEKGLIVVAANIHQLDFLLEDLPDVWLDRLAGTWPGPNTWLVPHQERLPEWVTG
FT                   VHDSVAVRVTDHPLVQELCHLTGPLISTSANPAGRPAARTRLRVEQYFHDELDAILGGA
FT                   LGGRRNPSLIRDLVTGQVIRPA"
FT   gene            complement(24568..25545)
FT                   /gene="qor"
FT                   /locus_tag="PA0023"
FT   CDS_pept        complement(24568..25545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="PA0023"
FT                   /product="quinone oxidoreductase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03413"
FT                   /db_xref="GOA:P43903"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43903"
FT                   /protein_id="AAG03413.1"
FT                   /translation="MAKRIQFAAYGGPEVLEYRDYQPAEPGPREVRVRNRAIGLNFIDT
FT                   YYRSGLYPAPGLPSGLGSEGAGEVEAVGSEVTRFKVGDRVAYATGPLGAYSELHVLAEE
FT                   KLVHLPDGIDFEQAAAVMLKGLTTQYLLRQTYELRGGETILFHAAAGGVGLFACQWAKA
FT                   LGVQLIGTVSSPEKARLARQHGAWETIDYSHENVARRVLELTDGKKCPVVYDSVGKDTW
FT                   ETSLDCVAPRGLLVSFGNASGPVTGVNLGILSQKGSLYVTRPTLGSYADTPEKLQAMAD
FT                   ELFGLIERGDIRIEINQRFALAEAARAHTELAARRTTGSTVLLP"
FT   gene            25736..26653
FT                   /gene="hemF"
FT                   /locus_tag="PA0024"
FT   CDS_pept        25736..26653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PA0024"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03414"
FT                   /db_xref="GOA:P43898"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43898"
FT                   /protein_id="AAG03414.1"
FT                   /translation="MTDRIAAVKTYLLDLQDRICAALEAEDGKARFAEDAWERPAGGGG
FT                   RTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVP
FT                   TSHANVRFFCAEKEGEEPVWWFGGGFDLTPYYAHEEDCVHWHRVARDACAPFGADVYPR
FT                   YKEWCDRYFHLKHRNEPRGIGGLFFDDLNQWDFDTCFAFIRAIGDAYIDAYLPIVQRRK
FT                   HTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKP
FT                   EPGSEEARLTEYFLADRDWLAGQP"
FT   gene            26711..27535
FT                   /gene="aroE"
FT                   /locus_tag="PA0025"
FT   CDS_pept        26711..27535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PA0025"
FT                   /product="shikimate dehydrogenase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03415"
FT                   /db_xref="GOA:P43904"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43904"
FT                   /protein_id="AAG03415.1"
FT                   /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGEALVYDAQLAPLDDFPG
FT                   FARRFFEQGKGANVTVPFKEEAYRLVDELSERATRAGAVNTLIRLADGRLRGDNTDGAG
FT                   LLRDLTANAGVELRGKRVLLLGAGGAVRGVLEPFLGECPAELLIANRTARKAVDLAERF
FT                   ADLGAVHGCGFAEVEGPFDLIVNGTSASLAGDVPPLAQSVIEPGRTVCYDMMYAKEPTA
FT                   FNRWAAERGAARTLDGLGMLVEQAAEAFFLWRGVRPASAPVLETLRRQLATV"
FT   gene            27646..28632
FT                   /gene="plcB"
FT                   /locus_tag="PA0026"
FT   CDS_pept        27646..28632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="PA0026"
FT                   /product="phospholipase C, PlcB"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03416"
FT                   /db_xref="GOA:Q9I7A4"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7A4"
FT                   /protein_id="AAG03416.1"
FT                   /translation="MKTFARLAAGLCICAIASQANAWSQPTHKNIVKDALAFMNSSYAT
FT                   EEMRQAYRFYVSAAGSEAQAGEILGQAAFDVDDFKDTRLGGWWVGYEHAPLWGAASGIV
FT                   NYTSYWHFLNLARDGDSHGNPHGGYDYRYHKVDGGIADVDWYAMVYLYNRELKREDFDT
FT                   TEAHYRQGTRSDWQEHYGDFQTAAFQPIDNLATYWFEQFRAAPSLQTIGYALHATGDVA
FT                   QPHHVWITSANGHSSWEGWVDDHYASEKLNDPAAVANLVGRYDPSKSIRDLLTQTGQVA
FT                   YARPEPLYDTSYETRLRVAKELIPESIALTVTVLTKGANSFDAPTAL"
FT   gene            28613..29899
FT                   /locus_tag="PA0027"
FT   CDS_pept        28613..29899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0027"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03417"
FT                   /db_xref="GOA:Q9I7A3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7A3"
FT                   /protein_id="AAG03417.1"
FT                   /translation="MHRLLSDRARGWRRALCGIVLGLLAWSAHGVPAKAPQDLRIDGEV
FT                   LPGRSIDLLEQALSRVKFNTDPQQLRRGLVENRLLARAVEDQLTAQSRADLDASVEIEA
FT                   GNLLEQVYGRRYREDLGPYLRQPRALSAERLREVLAPRSRGLVENSLLLDETQRREAAG
FT                   VELIGWQFPGQPAQVLDLLSLYEGDNVQGQVELQQGNLAYLARQVQTRIRRDYLWYRLA
FT                   RDGFGPAERQGVRTLVRDKLVRHRYLHQIGLYSDFHHESDALRELAGKVSDKDAEAYYR
FT                   RNLERYRNVAQVQAAHIRLADQASADKVYAELRGGLAFDEAVRRYSLADDRDRDPPGDL
FT                   GLIRPQDGRLDLLRKTALIQKADTVSQPMRIDGAFEIVRVRSREDRQLPLDDRSVRFEV
FT                   NQAVAREQLAAQFETRLRNLLAGARVEGL"
FT   gene            29896..30498
FT                   /locus_tag="PA0028"
FT   CDS_pept        29896..30498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0028"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03418"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7A2"
FT                   /protein_id="AAG03418.1"
FT                   /translation="MKRWLGVALGCSGLAIALACAGVLLAPADMAASSSSPSPARTVAA
FT                   LPAVDDRPPPPAPVRSQAAAPAYEAEPPVAELDREQAIQFMQMLRDEGDPRSPPLGGLQ
FT                   PRQGATAQELADPKQYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSAEEI
FT                   DEARAALGQLEMMRDKLQRESPQLLPGDSAPTSPAAP"
FT   gene            complement(30502..32055)
FT                   /locus_tag="PA0029"
FT   CDS_pept        complement(30502..32055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0029"
FT                   /product="probable sulfate transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03419"
FT                   /db_xref="GOA:Q9I7A1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7A1"
FT                   /protein_id="AAG03419.1"
FT                   /translation="MWTRLLPFLAWLPGLHRGMLGREAWVGLNGAILALPQSMAYALIA
FT                   GLPAEYGLYAAMLPVAIACLWGSSRYLVSGPTAAISVLLFSSVAPLAPLGSPQYVQAVL
FT                   LLTFLAGAFQWLLGVLRVGSLVNFVSHSVMLGFTLGAALLIVLGQLPYLLGLAASGEGA
FT                   APGNGWRLLARFAEFDGPSLLVGGFSFALSLLVRRLRPRWPALLLGLLGGATLVWALPG
FT                   TFASVAHVQALSSALPGWSPLVFDSRSILDLLPAAVACGMLGLVTSLSIARALAARQGD
FT                   AFDANQEVRAQGLSNLLGPWLSASLSAGSFTRSGLNLEAGARSPLAGAFSALWVALLAV
FT                   LGARLIEHVPLPAMAAGILLIAWGLIDRPALRALYRSGRAECLVAGLTALATLLLPLQN
FT                   AIYAGVLASLVFYLRRTSTPRVLRQRNDEEEVLRIEGSIFFGACDYLQRLMRQCDRPRL
FT                   VLDARQVNFIDFAGAVLLQQEARRLHAEGRRLVLRHARPQVREALGRQADEGCRLHYEG
FT                   "
FT   gene            complement(32060..32983)
FT                   /locus_tag="PA0030"
FT   CDS_pept        complement(32060..32983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0030"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03420"
FT                   /db_xref="GOA:Q9I7A0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I7A0"
FT                   /protein_id="AAG03420.1"
FT                   /translation="MNRLPTCLLAATLFLGSASLYAEDPACARVRLADPGWSDIAVTNA
FT                   TAAFLLESLGYQVKIDTLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHDKFVASGQVERL
FT                   GRNLDGTRFTLAVPRYVWDAGVHRFEDLAAQGQRFNRKLYGIGSGAPANQSIQKMIDAN
FT                   QFGLGDWKLVESSEQAMLAELGRAEKRQRWLVFLGWTPHPMNIRHDLRYLEGGEQYFGD
FT                   RGQVYTLARKGYAAQCPNPARLLANLRFDLDMENRLMSDALEGTATPASATRAWLKANP
FT                   RVLEAWLQGVTSRDGGDALAAVRGQP"
FT   gene            complement(33000..34511)
FT                   /gene="betC"
FT                   /locus_tag="PA0031"
FT   CDS_pept        complement(33000..34511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betC"
FT                   /locus_tag="PA0031"
FT                   /product="choline sulfatase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03421"
FT                   /db_xref="GOA:Q9I799"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I799"
FT                   /protein_id="AAG03421.1"
FT                   /translation="MKTSPNILFIMADQMAAPLLPLHDPRSVLRMPHLSRLAERAVVFD
FT                   SAYCNSPLCAPSRFTLVSGRLPTRIGAWDNAADFAADTPTYAHYLRNLGYRTALSGKMH
FT                   FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPEVRPSWYHNMSSVLQAGPCVRTNQLDF
FT                   DEEVVFKARQYLYDHVRQHAGQPFCLTVSMTHPHDPYSIPASYWNLYRDEDIPLPRQRF
FT                   AQEEQDPHSQRLLKVIDLWDKPLPEERIRAARRAYFGACSYVDAQIGALLATLEKCGLA
FT                   DDTIVVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPARFAPRRIGASVSTVDLLP
FT                   TLVELAGGQVDPRLPLEGRSLLPHLRDGSGHDEVIGEYTAEGTLSPLMMIRRGDYKFIY
FT                   SEQDPCLLYDLRNDPQERENLAASPAHRGTFEAFLDEARRRWDIPAITRAVLDSQRRRR
FT                   LVAAALARGRLASWDHQPWVDASQQYMRNHIDLDDLERRARFPQP"
FT   gene            34624..35538
FT                   /locus_tag="PA0032"
FT   CDS_pept        34624..35538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0032"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03422"
FT                   /db_xref="GOA:Q9I798"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I798"
FT                   /protein_id="AAG03422.1"
FT                   /translation="MGERLMPLSLDLLRVFESAARQLSFTAAAEELGTTQPAVSQQIKR
FT                   LEKELATPLFQRVHRGIVLTDAGQLLLRHVAAGLETIDAGIAALGARQRHEVLQVATDY
FT                   AFAAYWLMPRLPRFHQAHPHLDVSLVTSERGLAGQRGDIDVAILFGDGRSKHGEAHRLF
FT                   REEVFPVCSPRLVEGLQLPLAKAHLARLPMLHLKPAQHARWFDWPALFEALAIDRQPIP
FT                   AVLSFDNYTLLIQAAIAGQGVAIGWRHLVDGLLEQGLLCRPIGESCLSRYGYYAVLPER
FT                   KRRQRLVDGFVDWLQAELQAGGA"
FT   gene            complement(35905..36270)
FT                   /locus_tag="PA0033"
FT   CDS_pept        complement(35905..36270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0033"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03423"
FT                   /db_xref="GOA:Q9I797"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I797"
FT                   /protein_id="AAG03423.1"
FT                   /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNNEDTRKLRRAQERE
FT                   QTQELNELAHRLAGMASLIHAHAVERACHQLEIACGESSVRKLADAVDDLVTALGELQC
FT                   ELHDWMTMTAPQGTAKS"
FT   gene            complement(36278..36901)
FT                   /locus_tag="PA0034"
FT   CDS_pept        complement(36278..36901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0034"
FT                   /product="probable two-component response regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03424"
FT                   /db_xref="GOA:P24908"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24908"
FT                   /protein_id="AAG03424.1"
FT                   /translation="MSKVLIVDDHPAIRLAVRLLFERDGFTIVGEADNGAEALQVARKK
FT                   SPDLAILDIGIPKIDGLEVIARLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVSKR
FT                   ENLSELLLAAKAVLAGYIHFPTGALRSINQQSRDNEARMLESLSDREMTVLQYLANGNT
FT                   NKAIAQQLFLSEKTVSTYKSRIMLKLNAHSLAGLIDFARRHELI"
FT   gene            complement(37087..37893)
FT                   /gene="trpA"
FT                   /locus_tag="PA0035"
FT   CDS_pept        complement(37087..37893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="PA0035"
FT                   /product="tryptophan synthase alpha chain"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03425"
FT                   /db_xref="GOA:P07344"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07344"
FT                   /protein_id="AAG03425.1"
FT                   /translation="MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGA
FT                   DVIELGMPFTDPMADGPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGYFN
FT                   PIHHYGVERFIAEAKEVGVDGLIVVDLPPEHNEDLCHPAQAAGIDFIRLTTPTTGDQRL
FT                   PTVLEGSSGFVYYVSVAGVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAA
FT                   VARLADGVVVGSALIDRIAKARDNAQAVKDVLALCGELAEGVRNAR"
FT   gene            complement(37890..39098)
FT                   /gene="trpB"
FT                   /locus_tag="PA0036"
FT   CDS_pept        complement(37890..39098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="PA0036"
FT                   /product="tryptophan synthase beta chain"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03426"
FT                   /db_xref="GOA:P07345"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07345"
FT                   /protein_id="AAG03426.1"
FT                   /translation="MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPA
FT                   FQEELAYFQRDYVGRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLA
FT                   RRMGKKRIIAETGAGMHGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVI
FT                   PVTAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQL
FT                   AEKEGRLPDSLVACIGGGSNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAASLNGGV
FT                   PGVLHGNRTFLLQDADGQIIDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSITDDEALE
FT                   AFHTCCRLEGIIPALESSHALAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTVMHHMQQE
FT                   SKA"
FT   gene            39202..40089
FT                   /gene="trpI"
FT                   /locus_tag="PA0037"
FT   CDS_pept        39202..40089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpI"
FT                   /locus_tag="PA0037"
FT                   /product="transcriptional regulator TrpI"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03427"
FT                   /db_xref="GOA:P11720"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11720"
FT                   /protein_id="AAG03427.1"
FT                   /translation="MSRDLPSLNALRAFEAAARLHSISLAAEELHVTHGAVSRQVRLLE
FT                   DDLGVALFGKDGRGVKLTDSGVRLRDACGDAFERLRGVCAELRRQTAEAPFVLGVPGSL
FT                   LARWFIPRLDQLNRALPDLRLQLSTSEGEFDPRRPGLDAMLWFAEPPWPADMQVFELAP
FT                   ERMGPVVSPRLAQETGLAQAPAARLLQEPLLHTASRPQAWPAWAASQGLAAEALRYGQG
FT                   FEHLYYLLEAAVAGLGVAIAPEPLVRDDLAAGRLAAPWGFIETDARLALWVPARLHDPR
FT                   AGRLAQWLREQLAG"
FT   gene            40190..40405
FT                   /locus_tag="PA0038"
FT   CDS_pept        40190..40405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0038"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03428"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I794"
FT                   /protein_id="AAG03428.1"
FT                   /translation="MSNHHTYKKIELVGSSKTSIEDAINNALAEAAKSIQHLEWFEVVD
FT                   TRGHIENGAVGHYQVTLKVGFRIANS"
FT   gene            40589..40816
FT                   /locus_tag="PA0039"
FT   CDS_pept        40589..40816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0039"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03429"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I793"
FT                   /protein_id="AAG03429.1"
FT                   /translation="MFMKKLMLAVGLFAVAGSAFAAKPCEELKAEIDAKIKANGVPAYT
FT                   LEIVDKGSVTDKKVVGTCDGGTKEIVYQRG"
FT   gene            41113..42801
FT                   /locus_tag="PA0040"
FT   CDS_pept        41113..42801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03430"
FT                   /db_xref="GOA:Q9I792"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I792"
FT                   /protein_id="AAG03430.1"
FT                   /translation="MALHRLAFIFLCLPLMASAAPFTSPGDRDLIRDRQQRLLDEQRKR
FT                   LEELQQLPGKGAPAAADASGGDERCFEIRRIELEGAGHLGESARRQLLAPYQGRCLGVG
FT                   QLNALLKAVTDHYLDRGYVTTRAYLPQQDLASGTLRIIVVEGRLEGLDSSALASPRELT
FT                   MSFPGRTGELLDLRELEQLVDQLSRLPSRQAQLELVPGSEVGGSRVRLKGERDKPWRVS
FT                   ATRNNDGDVSTGEQQMGLGLDWDSPLGLADQLNLRANRDAVTDRWRHSDSQSLFYSLPW
FT                   GWWTFTYGYSQSDYRTRNEASGFPFKLDGDSRSHQFRAERVLHRDGVSKTAMSLGLSHQ
FT                   RTNNYVEDTRLEDQSTRITETQLGFNHGRRIGSGFVNLDLGWQQGIGALGAQGRGHPQA
FT                   GDPNARYDKYSLTLSYLQPFQLWGERFSFDSLATGQRSEDVLFSPQRISLGGNSSVRGF
FT                   KDQTLTGDSGGYWRNQLRWRRAVEWAPLRPWLQEYGVAFAYDVGVIRHDRYNDGASGRM
FT                   SGNAIELDARGRYFAASVGFARSLERPSAIERREHPIYFRVDAFF"
FT   gene            42914..53521
FT                   /locus_tag="PA0041"
FT   CDS_pept        42914..53521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0041"
FT                   /product="probable hemagglutinin"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03431"
FT                   /db_xref="GOA:Q9I791"
FT                   /db_xref="InterPro:IPR006915"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="InterPro:IPR033806"
FT                   /db_xref="InterPro:IPR040559"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I791"
FT                   /protein_id="AAG03431.1"
FT                   /translation="MDIRSPLNQCIALSLAGILFLNPIVAAAAGLALDKAAGGNTGLGQ
FT                   AGNGVPIVNIATPNDAGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNLKG
FT                   QAAQVILNQVTGGNRSTLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTTGKP
FT                   IMDGQRLERFQVDGGDIVVEGAELNVGNLEQFDLITRSAKLNAKLYAKNLNIVTGRNDV
FT                   QADSLQATPRAADGSEKPQLAIDSSALGGMYAGAIRLVGTEQGVGVRLAGDMAASGGDI
FT                   RIDASGKLSLAQASSQGDLKIAAQAVELNGKTYAGGSAEIRSAEELVNRQSLAARERIV
FT                   LEAAHIDNAGVIEAGVEPDERRNARGDLELRSGTLRNAGSLVASRALEAKASQALDNQG
FT                   GSLKGATVRVDAGHLDNRGGKLLAEGELRVEASSLDNRQDGLLQSRDRAVVKTRGDLDN
FT                   RGGQVIGLNDLEVGAATLDNGQQGLLGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSL
FT                   DNRGGKLIGDDLLVVASGAIDNRLGLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLG
FT                   GLLDNRDEGNLLSQGAQRVTVGQLDNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLS
FT                   ATGGAFDNRDGGSASGKAGVRVEVASLRNDQGGKLLSDGRLDLAANAVGNAGGRIAAKG
FT                   DLQATLGSLAQQGGELVSEKTLKVAADTLDNSQSGLIAANGGIAIEARQVDNRAGEISS
FT                   TSKVAVNAREQLDNRGGKVIGDSGLRLTVQRLLNQAKGVLAGRDGLSLDGGELFNGDGG
FT                   RLDSQNSLSVSLGGVLDNQGGALVSEGSLTARAARLDNRGGTFSSAGALALTSQAALDN
FT                   QGGRLLSDAGVTLQGASLDNSRSGVISAKGAVDIRTGVLDNSRNGGIGSNAGITLVAAR
FT                   LDNGQQGRVSAKGLLDANLKGLDQRGGGVLISETGVTLDLNGGTLVNRDGGLIATPGAL
FT                   LLRQLGAVDNGAGGEISSDRAFTLAAASLDNRGGRLIGAANLTLRIAQALDNSLAGVIS
FT                   GAAGLDIAAARLDNSAKGTLASRAGIDLRVDGALDNHAEGTVSGARLTLASASLDNSGK
FT                   GLLSGNAGLSVATGALDNAEGGQLISQGVLDVSSADLDNRGGALSGKQSLRLSAANLDN
FT                   RGGLLTSDGELELTAGRVDSADGGEISARGDLRLTVERLVQRQGRLVGERGVSLDLRGG
FT                   DLDNQGGLISARGPLSIERLSVLDNRQGGEISSQQGFELLARRIDNGQQGRIISAGKLR
FT                   LDADALGNAGAGLLSGWQGLTVTGGSLDNSAGGTLSSKDGELAISLGGALDNHGQGALV
FT                   SKGAQRIDAASLDNAQGIVSGESDVTLSIAGKLDNGQGGLVSAQRALSFERDDTLLNNA
FT                   GGRINGGSLLLKGASLDNSDGQLISQGRLDAILGGALVNTGAARLASGGDLLLRSASVD
FT                   NRGGKLVSQGLLEISAGSLDNSASGTLASQAGMSLRLGGGALRNQQDGLIFSQAGALDV
FT                   QAGSLDNRQGTLQAQGDNRLRIGGALDNQGGRLDSRAGNLDLQSGSLDNGAGGVLNSAK
FT                   GWLKLVTGLFDNSAGVTQAQSLEIRAGQGVRNQQGHLSALGGDNRIVTADFDNQGGGLY
FT                   ASGLLSLDGQRFLNQGAAAGQGGKVGAGRIDFSLAGALANRFGQLESESELHLRAAAID
FT                   NSGGSLRALGRSGSTRLVAGGLNNAYGVLESANQDLDLQLGSLANAGGRILHTGNGTFG
FT                   LDSGQVIRAGGELTTNGLLDIRASEWTNSSVLQAGRLNLDIGTFRQTAEGKLLAVQSFT
FT                   GRGGDWSNDGLLASDGSFRLDLSGGYRGNGRATSLGDFALNAASLDLGNAASLAGGANV
FT                   TLGAGNLLVNRGRITAAGDLVASAASLNNYGTLGGGGNLRLNAPALLNERGLLFSGADM
FT                   TLRAGDITNLYGDVYSLGRLDIARDDAGNRAASLRNLSGVIESGKDFSLRASLIENRRA
FT                   VLESKSGLYTAKMEQTACIEGVNAGDCSGKRNAIWTITQRDKTEVTASSAMGQLLAGGD
FT                   FAIDGGTLNNLSSLIGSGGNLTANLEVLDNQGLETGELETIRVLRTARGGDIGGIDQKS
FT                   RNFTNLYWYQSANFDPARAGEIPAALNAILSDWSFEYEFPSKGPTPISSGDQSYAAVIQ
FT                   AAGDVTVNASTRIDNGVTRPGYTFVGSGRQVGDSAVGGSGVSVVVPLTSQLPPDLARRQ
FT                   VNPVTLPGFSLPQGDNGLFRLSSRFAEDGNGSAALGAGADRTQGGSGVSVGQQGAGNAA
FT                   GTWQGQGVRVDGLAGAANVQGQGGSTLGGSLPGVARVQGVPGNATPSASHKYLIETNPA
FT                   LTELKQFLNSDYLLSGLGMNPDDSKKRLGDGLYEQRLIRDAVVARTGQRYIDGLSSDEA
FT                   LFRYLMDNAIAYKDQLHLQLGVGLSAEQMAALTHDIVWLEEVEVNGEKVLAPVVYLAQA
FT                   EGRLAPNGALIQGRDVKLVSGGDLHNVGTLRARNDLSATADNLDNSGLIEAGKRLDLLA
FT                   GDSIRNRQGGVIAGRDVSLTALTGDVINERSVTRYDSALDGRTWERSFADSAARVEAAN
FT                   SLNVQAGRDIANLGGVLQSRGDLSLDAGRDVTVAAVEDRQGQTRWSTSRLQSVTQLGAE
FT                   VSAGRDLNVSAGRDLTAVASTLEARRDIALSAGRDVTLAAAANEEHAYSKTRKVTYQED
FT                   KVAQQGTRVDAGGDLAINAGQDLRLIASQASAGDEAYLVAGDKLELLAANDSNYYLYDK
FT                   KKKGDFGRKETRRDEVTDVKAVGSQISSGGDLTLLSGGDQTYQGAKLESGNDLAIVSGG
FT                   AVTFEAVKDLHQESHEKSKGDLAWNSAKGKGQTDETLRQTQIVAQGNLAIKAVEGLKID
FT                   LKHIDQKTVSQTIDAMVQADPQLAWLKEAEQRGDVDWRMVQEVHDSWKYSNSGMGPATQ
FT                   IAVAIAAAAIGGMAAAGALSGAGVGASSFAMGAGVGAAGSLSGTAAVSLINNKGDLGKV
FT                   LKDSFSSDSLKQIAIASLTGGLTAEYFDGILQTKTDPLTGKVTVDLSSLSGVGRFAANQ
FT                   AMQNATSTVLSQALGQGGSLNEALKSALYNSFAAAGFNFVGDIGQEYSLKPGDPSMVTM
FT                   HALMGGLAAQVSGGDFATGAAAAGANEALVAKLDQAFKSLSPENREAMVTMGSQLVGVL
FT                   AAAVRDPDVTGKALESAAWVAKNSTQYNFLNHQDVADLDNALQKCKSQGNCRQVEEEFK
FT                   ARSDENRRRLNGCVAVGNCAEIRAEIDAGSTALNELVARQETANPGGSDSDIAYGFLMG
FT                   RNVVDWTTAGQLHLEQTANLWWNGNPQWQKEVGAYLDQTGFNPFGIGVPAMGGAAGKVT
FT                   AKALMNALKAGELPKGEVAPGKANLPTIGALADAEAGMPYTHPVKLAAKATGTAGKIKI
FT                   EAGAIPDANEVRAGQGLSGLGYDVTHQTTASAKGIQGQRTADLHVDGLGSIDVYTPKNL
FT                   DPTKIVRAIEKKSNQAGGVLVQADLPSTDMSSIAARMWGKTNAQSIKTIFFQKPDGSLV
FT                   RFDRPAGGG"
FT   gene            56546..56941
FT                   /locus_tag="PA0042"
FT   CDS_pept        56546..56941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0042"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03432"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I790"
FT                   /protein_id="AAG03432.1"
FT                   /translation="MPVLALRLTALAALVISVSGCVMEAYGSRARSDAQSWIGLPIQDV
FT                   IKRFGEPERVTGDAARQKYVWKEYENYSHDYDYTYYEQGHGNTPNSSVLNQKTGTANQS
FT                   GYYTCIYEFFADASGRVVDATARGECR"
FT   gene            complement(57212..58594)
FT                   /locus_tag="PA0043"
FT   CDS_pept        complement(57212..58594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0043"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03433"
FT                   /db_xref="GOA:Q9I789"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I789"
FT                   /protein_id="AAG03433.1"
FT                   /translation="MGYWRQRRALGGRRTAVRAPRGRLLLWCAQARRHPLSRRMESSMT
FT                   LSLDLLLSLCTALAIGLLIGAERGWQERDHEDARQIAGIRTFSLAGLLGGFATLLAGEL
FT                   GSAVWVALLLALAALAVAGYVSDVRRGGDQGMTTEIALLMTFLLGSLALTEQRLLAAAG
FT                   GIVLTLLLSLKDKLHALLKRLTAEELSGTLKLLFISVVLLPVLPNQGYGPWAFFNPYLT
FT                   WWMVVLIAALGFSAYLAIRLIGSRKGLLLTAVLGGLVSSTVMTLTLARLRERMPDALLA
FT                   CALLATSALMFPRILVEIGAIHPALLKELALPFAATTLVYLGGTLFHALRGGRASQEAP
FT                   DEPGLRNPFELLPALRFAALLSAILLLVEVGRRLFGDAGIYAVALLSGLADVDAITLSL
FT                   ARAAQGELDPGVASRGIALAALSNSLVKAGLVVLVGGKRLALQTLPFSLAGLLVGALLI
FT                   LL"
FT   gene            58786..60159
FT                   /gene="exoT"
FT                   /locus_tag="PA0044"
FT   CDS_pept        58786..60159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoT"
FT                   /locus_tag="PA0044"
FT                   /product="exoenzyme T"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03434"
FT                   /db_xref="GOA:Q9I788"
FT                   /db_xref="InterPro:IPR003537"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="InterPro:IPR014773"
FT                   /db_xref="InterPro:IPR037168"
FT                   /db_xref="PDB:4JMF"
FT                   /db_xref="PDB:6GNN"
FT                   /db_xref="PDB:6JNP"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I788"
FT                   /protein_id="AAG03434.1"
FT                   /translation="MHIQSSQQNPSFVAELSQAVAGRLGQVEARQVATPREAQQLAQRQ
FT                   EAPKGEGLLSRLGAALARPFVAIIEWLGKLLGSRAHAATQAPLSRQDAPPAASLSAAEI
FT                   KQMMLQKALPLTLGGLGKASELATLTAERLAKDHTRLASGDGALRSLATALVGIRDGSR
FT                   IEASRTQAARLLEQSVGGIALQQWGTAGGAASQHVLSASPEQLREIAVQLHAVMDKVAL
FT                   LRHAVESEVKGEPVDKALADGLVEHFGLEAEQYLGEHPDGPYSDAEVMALGLYTNGEYQ
FT                   HLNRSLRQGRELDAGQALIDRGMSAAFEKSGPAEQVVKTFRGTQGRDAFEAVKEGQVGH
FT                   DAGYLSTSRDPGVARSFAGQGTITTLFGRSGIDVSEISIEGDEQEILYDKGTDMRVLLS
FT                   AKDGQGVTRRVLEEATLGERSGHGEGLLDALDLATGTDRSGKPQEQDLRLRMRGLDLA"
FT   gene            60656..61342
FT                   /locus_tag="PA0045"
FT   CDS_pept        60656..61342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0045"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03435"
FT                   /db_xref="GOA:Q9I787"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I787"
FT                   /protein_id="AAG03435.1"
FT                   /translation="MSHSAKKALLPLLAVATLAGLAGCATETSTALPVQQVESVNRPYS
FT                   GVRSPIAVGKFDNRSSYMRGIFSDGVDRLGGQAKTILITHLQQTNRFNVLDRDNMSEIQ
FT                   QEAAIKGQAQRLKGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVALNIVNI
FT                   STSEVVYSTQGAGEYALSNREVIGFGGTASYDSTLNGKVLDLAMREAVNKLVNAVDSGA
FT                   WKPQNQ"
FT   gene            61373..61726
FT                   /locus_tag="PA0046"
FT   CDS_pept        61373..61726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0046"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03436"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I786"
FT                   /protein_id="AAG03436.1"
FT                   /translation="MSKTITWTAALLGSMALAGCSGPKTLYQWEGYQAQVHEYFKGESK
FT                   EAQAQALEADLEKIRAKNGAVPPGYHAQLGLLYSSIGKDDQMVREFETEKALFPESATY
FT                   MDFLLNNARGGAR"
FT   gene            61879..62388
FT                   /locus_tag="PA0047"
FT   CDS_pept        61879..62388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0047"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03437"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I785"
FT                   /protein_id="AAG03437.1"
FT                   /translation="MKATYSMLSQVTFPLAEAGYYVVPVALADETFRQNGLTSAGDVHQ
FT                   VSPAKLREIYGADAALYVTVSDYGTRYMVISSATIVTASAKLVDLRSGTTLWTGSATAS
FT                   SEEGNGGNNGGLVGMLITAAVKQIINSSVEDAGYPIAGMTSARLLSAGQPGGLLYGPRS
FT                   PRYGSD"
FT   gene            complement(62403..62786)
FT                   /locus_tag="PA0048"
FT   CDS_pept        complement(62403..62786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0048"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03438"
FT                   /db_xref="GOA:Q9I784"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I784"
FT                   /protein_id="AAG03438.1"
FT                   /translation="MSFAQNLLRLRQQNALTQRQMAERLGITVSQLRHFETKGGHPSLV
FT                   VLQTIAGRFAVPLDWLVCERSERQALPEDLRLQFEAIGRLRLDERRAIRALLDDLIRQY
FT                   MAKRNAAAKPLPAACAEATETSP"
FT   gene            complement(63068..64729)
FT                   /locus_tag="PA0049"
FT   CDS_pept        complement(63068..64729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0049"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03439"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I783"
FT                   /protein_id="AAG03439.1"
FT                   /translation="MRYARHASRYSLFTLAVSAALLPGAGWAANGDLAGARKPPSVACS
FT                   WNREAALSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAFAKRLCAADG
FT                   RTPVTSYAKALKLVTEEGRALWRAAVDRAQGRRAIPAGALPASDDRMLYWTRLYMTRTL
FT                   RQWAPSFHLGKAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMIISGFDVFTLGT
FT                   PGTANTGLRNGNPSGATALALDGREFRLADGSLLRIEAYLLPVSYDPFNRGMQEDTLGP
FT                   WFRPGPRRVDASITISQGGANQFWLEAWNGRFHGSSAGNDGIVYCPADSALPNYVLPLG
FT                   SVTNPGTAPISLRGSGCNINPPRRWLGYDSASRWRQNLPAQFSKASLPVRQLLAADTWR
FT                   GIERPPGATSQAAEGFDVTWHTNYDFFPDCANPRTENVPTNGVMNAMPDPSLVLPPNRR
FT                   ICARNGGGGDYLSNESAYRNTVLRDAFRLEIPAGHIHVPVMNNYYTGVPASGGGARNDN
FT                   AISDARYEAYRSAIVAQTRALLVGVGNALAQGAQAD"
FT   gene            65339..65479
FT                   /locus_tag="PA0050"
FT   CDS_pept        65339..65479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0050"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03440"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I782"
FT                   /protein_id="AAG03440.1"
FT                   /translation="MKRKMLAASLLLWMFSLTAQADCAVLGPGEDPCAGPVLGPTVCEC
FT                   P"
FT   gene            66303..68135
FT                   /gene="phzH"
FT                   /locus_tag="PA0051"
FT   CDS_pept        66303..68135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phzH"
FT                   /locus_tag="PA0051"
FT                   /product="potential phenazine-modifying enzyme"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03441"
FT                   /db_xref="GOA:Q9I781"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I781"
FT                   /protein_id="AAG03441.1"
FT                   /translation="MCGLAGWVDYTRKLDDEFPAIFAMTDTLALRGPDAEGIWKHRNAL
FT                   LGHRRLAVIDLSGGVQPMSYRFPTGQEVTLVYTGEVYNHDALRERLRRAGHEFRTRSDT
FT                   EVVLHAYLQWGERCCEYLTGMFAFAVFDGRDGHLLLVRDRLGIKPLYYARHREGLLFGS
FT                   EIKSILAHPEFAARLDAVGLVDLLTLSRGTSQTPFREVQELLPGHLLSWRPNSQAKLRR
FT                   YWEVRRQEHADDLQSTVQRTRELVTRALGAQLHADVPVCSLLSGGLDSTALTGIAQRIA
FT                   KAEHGGDINSFSVDFVGQAEQFRSDDLRPDQDQPFALLAAQYIGSRHRTVLIDNAELVC
FT                   ERAREEVFRAKDVPFTFGDMDTSLHLMFGEIRRHSTVAISGEGADELFGGYGWFRDPQA
FT                   VAAARFPWASRVRLPAGFIDAGFNRRCDLLQYQQASYDDGLRQVEHLAGDSPEERRMRE
FT                   FSHLHLKRWMVLLLERKDRLSMCNGLEVRVPYTDHELVEYVYNVPWSIKSRDGEEKWLL
FT                   KRACADYVPEAVLKRRKSPYPTSANLGYERFLRGSVRRLLEDAVNPVFGIVSREFLAAE
FT                   LEHPEGYFNTQVSRHNLETALALEGWLRLYGLSA"
FT   gene            complement(68188..68616)
FT                   /locus_tag="PA0052"
FT   CDS_pept        complement(68188..68616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0052"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03442"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I780"
FT                   /protein_id="AAG03442.1"
FT                   /translation="MDLRPSHVHVFPPSRDLPAATSPHRETLLRSGCAWNGSLYLGYPL
FT                   GQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGCLM
FT                   NIIHRLIAGAEPVEALLFHAGVEGMPVGLGERGEMPDA"
FT   gene            69272..69526
FT                   /locus_tag="PA0053"
FT   CDS_pept        69272..69526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0053"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03443"
FT                   /db_xref="GOA:Q9I779"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I779"
FT                   /protein_id="AAG03443.1"
FT                   /translation="MNHCFANGNKRTAAAAATVFLLLNGIELTGPAQDFVDIMVALVTR
FT                   EASVQDLEDWMFYWHRPFDAYNLPDSDAFERMVARLGIG"
FT   gene            complement(69543..70091)
FT                   /locus_tag="PA0054"
FT   CDS_pept        complement(69543..70091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03444"
FT                   /db_xref="GOA:Q9I778"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I778"
FT                   /protein_id="AAG03444.1"
FT                   /translation="MDRKTLDDTSKFLSYVLRHQPEAIGLTLDGEGWADIDALIAGAAR
FT                   DGRALDRMLLGAVVENNDKKRFALSADGQRIRAVQGHSHAAVAIAYAPAVPPAVLYHGT
FT                   ASRFLDSIRERGLVPGSRHHVHLSARRATALEVGRRYGSPVLLEIDARDMHLAGHLFHQ
FT                   AENGVWLTERVPVRFIREA"
FT   gene            complement(70130..70636)
FT                   /locus_tag="PA0055"
FT   CDS_pept        complement(70130..70636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0055"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03445"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I777"
FT                   /protein_id="AAG03445.1"
FT                   /translation="MSLSIYQASIPTFLRTLGNLSAILKKAAAHAEAKNIDPRIFIDAR
FT                   LAPDMFPLARQVQIASDAAKGAGARLAGLEVPSYADTETTFDELQARIARTVEFLEGIR
FT                   EEQLDGAEERNVTLKVRGQEISFNGRDFLFGFALPNFFFHVTTAYAILRHNGVELGKMD
FT                   FLGGA"
FT   gene            complement(70702..71622)
FT                   /locus_tag="PA0056"
FT   CDS_pept        complement(70702..71622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0056"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03446"
FT                   /db_xref="GOA:Q9I776"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I776"
FT                   /protein_id="AAG03446.1"
FT                   /translation="MDRLTATRVFVEVIDSGSQTAAAERLDMSRAMVSRYLAELEEWVG
FT                   ARLLHRSTRRLSLTDAGAELLPQCREMLAVADAMQATGQTRRDSPRGTLRITSSLSFAQ
FT                   AWLTRAAAAFVERYPGTAIDLQVNSQVVNLVEERIDLALRIANQLDPNLIARRLGECRS
FT                   VICAAPDYLRRHGTPRRPEDLALHNCLTYSYFGRSLWQFERDGEPTSVPVGGSLSANES
FT                   TVLLEAAAAGAGISQQPLYSAAPLIRSGRLVALLPEWSPQVLGIHAVYASRRQMPPALR
FT                   ALLDFLVERMAADPHWDEAGPLALA"
FT   gene            71730..72617
FT                   /locus_tag="PA0057"
FT   CDS_pept        71730..72617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0057"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03447"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I775"
FT                   /protein_id="AAG03447.1"
FT                   /translation="MSRHGLLRSLFAAAALLGAAGVFAASAEPLRLEVYNPGEKAIFAV
FT                   SSELLVGQREAMLIDAQFSRADAEQLVKRIQASGKTLSTIYISHGDPDFYFGLDVLKAA
FT                   FPEAKILATAQTVAHIQATKDAKLAYWGPILKDNAPTSLVVPEPLKGDQLKLEGHALKV
FT                   VDLKGPSPDRTVLWIPSLKTVVGGVLVESGSHVWTADTQTQASRQAWVAMLDRIEALQP
FT                   RRVVPGHFTGEEPKGLDGVRFTRDYLKALEAELPKARDSAALVEAMKRRYPNLPGEEGL
FT                   ELSAKVLKGEMQWP"
FT   gene            72680..73384
FT                   /locus_tag="PA0058"
FT   CDS_pept        72680..73384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0058"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03448"
FT                   /db_xref="GOA:Q9I774"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:5HFG"
FT                   /db_xref="PDB:5HFI"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I774"
FT                   /protein_id="AAG03448.1"
FT                   /translation="MNDLTLHYLYDPLCGWCYGASPLLAAACEVTGLDVRLHGGGMMTD
FT                   ANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAAEA
FT                   LDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACSGEPLRAHFA
FT                   DSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDDWRAFLETQLRLAGGSGAVGG
FT                   AAAPLCRIDGCA"
FT   gene            73468..73923
FT                   /gene="osmC"
FT                   /locus_tag="PA0059"
FT   CDS_pept        73468..73923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PA0059"
FT                   /product="osmotically inducible protein OsmC"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03449"
FT                   /db_xref="GOA:Q9I773"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I773"
FT                   /protein_id="AAG03449.1"
FT                   /translation="MSIHSSGGVDMKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFN
FT                   TRFEGAPGTNPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAIT
FT                   AVHLVLRARVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
FT   gene            74034..74267
FT                   /locus_tag="PA0060"
FT   CDS_pept        74034..74267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03450"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I772"
FT                   /protein_id="AAG03450.1"
FT                   /translation="MKTIGLGIATLLFSATALAAPKPCEELKAEIETKIQSAGVTSYTL
FT                   EIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
FT   gene            complement(74279..74716)
FT                   /locus_tag="PA0061"
FT   CDS_pept        complement(74279..74716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0061"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03451"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I771"
FT                   /protein_id="AAG03451.1"
FT                   /translation="MRPLTRLVPLALLLLAGCAGPLPQPDPQMAWVELRSAPANTLLAE
FT                   RLDGERLSDGRYFQVTPGRHVLEVRFQYELYGGSGGGGGGFGEPVQINCYQQVVYDGFE
FT                   AGRRYRLEVRPQLRRALALLSDERGEVVARSNFQTSRCPPY"
FT   gene            complement(74773..75189)
FT                   /locus_tag="PA0062"
FT   CDS_pept        complement(74773..75189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0062"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I770"
FT                   /protein_id="AAG03452.1"
FT                   /translation="MRTLLLAGGLLVLSGCSLLMPTPDPNRAWVDLDTQPDADLAAVEV
FT                   DDKSWDRTRYFEVDPGTRELTVRYQFTVDPTNIGPVDSPLWRDCQLNLKFKDFSAGQRY
FT                   RLEAGHIGFRPWAKLYDQDNRELARGREGRCAKV"
FT   gene            75281..76408
FT                   /locus_tag="PA0063"
FT   CDS_pept        75281..76408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0063"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03453"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I769"
FT                   /protein_id="AAG03453.1"
FT                   /translation="MLVGRRAVRVLCYVPPMPRRLRHPLADLRLPRWVPCLALLALSGC
FT                   STVSYYGQLASGQFALLRAREPAAAVIADPQRDARLRERLAKAEKARQFASERLGLPDN
FT                   RSYRLYADIGRPYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYSEAAARAEAARQRA
FT                   LGDDVYVGGVQAYSTLGWFDDPILSSMLRWDDERLATLIFHELAHQKFYLRDDTAFNES
FT                   FATFVEQEGTRQWREYRGLPPADGREEKRREQFTALVLASRARLEALYAGPLDDAAKRA
FT                   GKAAEFQRLRREYAALSQREWGGESPFKAWIDAPFNNAKLLPFGLYDQWVAAFAVLFRQ
FT                   VGGNWPAFYARVRALGQLPLAERQAALQRLAAAAP"
FT   gene            complement(76416..77399)
FT                   /locus_tag="PA0064"
FT   CDS_pept        complement(76416..77399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0064"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03454"
FT                   /db_xref="GOA:Q9I768"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I768"
FT                   /protein_id="AAG03454.1"
FT                   /translation="MTDNPFATPTAPVQPPAREVPATTQPYAFIAVLALVTCLSFAVSL
FT                   GIQWYNDIGEIRQRFSEHLQLMAPHWFTGLVFYAAANLLVLHAYREKRQLVEFRPLALL
FT                   LIGYGLLNLVCGMLAGIGLAPLTLPFYQWVTAQSSYGVWLMAFNEAMSWVYLLLGSLLP
FT                   LGLVLLGSRVNSPRLAEGEEARVAAWQVALGAALCFATLCFKLMQFLPYALLRYDEPWL
FT                   YGLYLSGVALPAALLFGAVCTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVGGGLAL
FT                   LMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLATRWCYADQLAA"
FT   gene            complement(77432..78097)
FT                   /locus_tag="PA0065"
FT   CDS_pept        complement(77432..78097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0065"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03455"
FT                   /db_xref="GOA:Q9I767"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I767"
FT                   /protein_id="AAG03455.1"
FT                   /translation="MRDAALRYPNILFDLDGTLTDPREGITRSVQFALARLGIDEPDLA
FT                   RLEHFIGPPLLQCFMQTYGFDEARAWEAVNHYRERFRVTGLYENRVFDGIPELLEALVG
FT                   RGHTLYVATSKPGVFAREIARHFAFDRHFKAIYGSELDGTRTHKEELIRHLLDSEGLAA
FT                   EHCLMIGDRMHDLLGASRNGVACIGVGYGFGSEDELRAHQPTHYCADLAALRQVLESH"
FT   gene            complement(78090..78632)
FT                   /locus_tag="PA0066"
FT   CDS_pept        complement(78090..78632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03456"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I766"
FT                   /protein_id="AAG03456.1"
FT                   /translation="MTIRSYQGKTPLLGERVFVDPSAVLVGDIEIGADSSVWPLVVIRG
FT                   DMHRIRIGQRSSIQDGSVLHITHAGPFNPDGFPLSIGDEVTVGHKVLLHGCSIGNRVLV
FT                   GMGSIVMDGAVIEDEVILGAGSLVPPGKVLESGFLYVGSPAKKARPLSDKERGFFAYTA
FT                   GNYVKLKDLHIAEDYHA"
FT   gene            78710..80755
FT                   /gene="prlC"
FT                   /locus_tag="PA0067"
FT   CDS_pept        78710..80755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PA0067"
FT                   /product="oligopeptidase A"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03457"
FT                   /db_xref="GOA:Q9I765"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I765"
FT                   /protein_id="AAG03457.1"
FT                   /translation="MSANPLLQAYDLPPFSSIRPEHVKPAIERILADNRAAIARLLETQ
FT                   REQPTWKGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYEACLPELSAYSTELGQ
FT                   NRALFEAYEALAKSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQKRYAEVQSRLSE
FT                   LGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMKQAAEAKGLDGWLISLEFPSYY
FT                   AVMTYADDRALREEVYAAYCTRASDQGPNAGQNDNGPVMEEILDLRQELAGLLGFANYA
FT                   ELSLATKMAESSDQVLSFLRDLAVRSKPFAARDLEQLRAYAAEQGCTELQSWDAGYYAE
FT                   KLREARYSVSQEALRAYFPVDKVLSGLFAIVERLYGIQIRELHDFERWHADVRLFEILE
FT                   NGEHVGRFYFDLYARANKRGGAWMDGARDRRRDAQGRLIDPVAYLVCNFTPAVNGKPAL
FT                   LTHDEVTTLFHEFGHGLHHLLTRVEHAAASGINGVAWDAVELPSQFMENWCWEPEGLAL
FT                   ISAHYETGVALPQDLLEKMLAAKNFQSGMMMVRQLEFSLFDFELHATHGDGRSVLQVLE
FT                   GIRDEVAVMRPPAYNRFANSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGVFNPD
FT                   TGRAFREAILARGGSREPMLLFVDFRGREPSIDALLRHSGLVGEAA"
FT   gene            80752..81027
FT                   /locus_tag="PA0068"
FT   CDS_pept        80752..81027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0068"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03458"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I764"
FT                   /protein_id="AAG03458.1"
FT                   /translation="MSPAITRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYAD
FT                   TLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
FT   gene            81116..82174
FT                   /locus_tag="PA0069"
FT   CDS_pept        81116..82174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03459"
FT                   /db_xref="GOA:Q9I763"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I763"
FT                   /protein_id="AAG03459.1"
FT                   /translation="MSAPLPPRGRGTASNPLNRFAPTHSEAFDDGWEQDVPPIQLTEVR
FT                   EEIARTVISRNQSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGIDFETRLIAK
FT                   SNVASALEQELSKPGYRCAPINLGANTDPYQPLERERRLTRQVLEVLLRFRHPLTIVTK
FT                   GSLILRDLDLLRELAEQNLVAVMISLTTLDDELKRILEPRAAAPSARLRAIRTLSGNGI
FT                   PVGVLCSPMIPMVNDMELERLLQAARDAGARSAAYMLLRLPREVGPLFEEWLAAHYPQR
FT                   AEHVMSLVRQCRGGEVYDSRFGHRFRGQGPFADLLAQRFAVAMKRLGLDRREGFGLDCS
FT                   RFAVPGAQMALF"
FT   gene            complement(82404..83318)
FT                   /locus_tag="PA0070"
FT   CDS_pept        complement(82404..83318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0070"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03460"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I762"
FT                   /protein_id="AAG03460.1"
FT                   /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAE
FT                   YYPSCYEPVSHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGGAL
FT                   AGGAAGYYMEKQKQISDDRARIGSYGTDVDRSTVEINRSVAYAKSAQSCYQSQFKALLD
FT                   GRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENISNYTQAYEKDLQQVGVPR
FT                   AEVTKVAEAENRASTTKGGSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASQGQ
FT                   GMIREVCNSPDMGDWAPPSCAKA"
FT   gene            complement(83380..85092)
FT                   /locus_tag="PA0071"
FT   CDS_pept        complement(83380..85092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0071"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03461"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I761"
FT                   /protein_id="AAG03461.1"
FT                   /translation="MFEKAILPLALGACLAFAAPAWAEGDSPDNPKPLADDVALPLPCG
FT                   GEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLAPA
FT                   WQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDVPDG
FT                   MAARLPKVNLSRFDAERFGAVYSAWLLKNHPELLPVSGRGKNPEDGGIGFVRLPTEVEW
FT                   EFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLGDWAVYNQVAGGTGQAARLLPVGMKR
FT                   PNPLGLFDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTGMRREYP
FT                   LFAADGSEQRNETTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDDAQDPTKQ
FT                   LDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAETINNYNIR
FT                   LTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTRYTDAVIQAQ
FT                   FQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLASSGR"
FT   gene            complement(85085..86284)
FT                   /locus_tag="PA0072"
FT   CDS_pept        complement(85085..86284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0072"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03462"
FT                   /db_xref="GOA:Q9I760"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I760"
FT                   /protein_id="AAG03462.1"
FT                   /translation="MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYGL
FT                   VSTLTERLERAPSVREIIPVGGARYRAEDIAALAARADVAFAVPRTRQIAATADLSGGG
FT                   ETALSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGAAEKLGAQPGERIVARIGRRMDGQ
FT                   AQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVAAYGWPGKAGETPRAR
FT                   IYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVAALAIG
FT                   GAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMLLALFSAVFGLFLAGLLYAA
FT                   TAGALNHLFDNQSGEFVCRLLPSHYLTALLATLLCSVLAAASGGWRAARIEAAEGLRDV
FT                   "
FT   gene            complement(86284..87003)
FT                   /locus_tag="PA0073"
FT   CDS_pept        complement(86284..87003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0073"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03463"
FT                   /db_xref="GOA:Q9I759"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I759"
FT                   /protein_id="AAG03463.1"
FT                   /translation="MILRLHEVARSHGAGRQRYRLRVPALELRAGRQLAIVGPSGCGKS
FT                   TLLDLLALALAPDPGGRFEFLAGERPQDIAALWRDGRQDRLAALRRQHCGYVLQSGGLL
FT                   EFLDVRRNIGLPCALLGAPSAERVQALAERLEIGDQLDKKPAALSVGQRQRVAIARALA
FT                   HAPRLLLADEPTAALDPLNAERVMRLLVEQARERGACTVVATHDERLARAAGLEVLAIR
FT                   WQREADDSVGACLEEVG"
FT   gene            complement(87000..90098)
FT                   /gene="ppkA"
FT                   /locus_tag="PA0074"
FT   CDS_pept        complement(87000..90098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppkA"
FT                   /locus_tag="PA0074"
FT                   /product="serine/threonine protein kinase PpkA"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa."
FT                   /db_xref="EnsemblGenomes-Gn:PA0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03464"
FT                   /db_xref="GOA:Q9I758"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I758"
FT                   /protein_id="AAG03464.1"
FT                   /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAA
FT                   DPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPE
FT                   QGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQV
FT                   GFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEP
FT                   LPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGS
FT                   PRASNPPPAEPAPLPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPP
FT                   LPPAKPRAGGSRTPLIAAAAAAVLLAIGGGAWWLLGSGDAPSAADPAPLGQTPADKPQQ
FT                   QTPVADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYA
FT                   RKQVGGSPWLRVGASSNGEGDGWLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVE
FT                   RLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPA
FT                   QLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVRE
FT                   VIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSS
FT                   QVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNE
FT                   AEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVN
FT                   AFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIGYAMQMEFLGRRDPVR
FT                   APQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLIVDAAKRTQTSPKDFFQ
FT                   EIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWLSLSVAEQQD
FT                   FIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP"
FT   gene            complement(90106..90834)
FT                   /gene="pppA"
FT                   /locus_tag="PA0075"
FT   CDS_pept        complement(90106..90834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pppA"
FT                   /locus_tag="PA0075"
FT                   /product="PppA"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa."
FT                   /db_xref="EnsemblGenomes-Gn:PA0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03465"
FT                   /db_xref="GOA:Q9I757"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:6JKV"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I757"
FT                   /protein_id="AAG03465.1"
FT                   /translation="MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPEAGLWVVADGMGG
FT                   HAAGDFVSSLIVDTLRRIPAASSLPAYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLV
FT                   LLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSYVQELLDNALISEEEARHHPRANV
FT                   VTRAVGVHEQLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLSHSDPYAVVRSLV
FT                   HLGLTRGAPDNITALVVRAF"
FT   gene            complement(90844..91524)
FT                   /locus_tag="PA0076"
FT   CDS_pept        complement(90844..91524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0076"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03466"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="PDB:2QNU"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I756"
FT                   /protein_id="AAG03466.1"
FT                   /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELG
FT                   AAWLDAYLTSPLWRFAIAPGLLGGEAVTGVVMPSIDRVGRYFPLTVACLLPANADLGGL
FT                   VGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAV
FT                   TPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFP
FT                   GIPG"
FT   gene            complement(91521..94826)
FT                   /gene="icmF1"
FT                   /locus_tag="PA0077"
FT   CDS_pept        complement(91521..94826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmF1"
FT                   /locus_tag="PA0077"
FT                   /product="IcmF1"
FT                   /note="Product name confidence: Class 2: Function of highly
FT                   similar gene experimentally demonstrated in another
FT                   organism (and gene context consistent in terms of pathways
FT                   its involved in, if known)."
FT                   /db_xref="EnsemblGenomes-Gn:PA0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03467"
FT                   /db_xref="GOA:Q9I755"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I755"
FT                   /protein_id="AAG03467.1"
FT                   /translation="MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSER
FT                   RNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAV
FT                   LLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPIDGAFIAISLSDLLLGSDAERA
FT                   AHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALD
FT                   DGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLGE
FT                   FLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRS
FT                   YFIERLFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQS
FT                   YIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLG
FT                   EESASVYRKLLIAVFAPRLVTRIEEQLRSGGSSDFLYEGLKAYLMLGSPDHYDADFIKA
FT                   WISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDLVEDLRRQLQQLPVAQR
FT                   VYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYREVFLTA
FT                   SLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNV
FT                   TQAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSL
FT                   VGQEEEGAREQPRQVDSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSA
FT                   MAGASGDSLLGDAKNQVAAAASRVALSAERQPPVVQGLVKNVVNSTTSSMMGSVRNQLN
FT                   AAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFGAGGVMDSYFRQYLQPYVDTS
FT                   ASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPTVRFELKPVTMDAAISQ
FT                   FILDLDGQQLTYDHGPSRPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFRL
FT                   LDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL"
FT   gene            complement(95048..96397)
FT                   /locus_tag="PA0078"
FT   CDS_pept        complement(95048..96397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0078"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03468"
FT                   /db_xref="GOA:Q9I754"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="PDB:4B62"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I754"
FT                   /protein_id="AAG03468.1"
FT                   /translation="MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGD
FT                   PYTPPPMASLAPLSGRGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQ
FT                   FEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEK
FT                   VFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTR
FT                   GEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKR
FT                   IHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELF
FT                   ASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEV
FT                   ADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAEGAQ"
FT   gene            complement(96404..97738)
FT                   /locus_tag="PA0079"
FT   CDS_pept        complement(96404..97738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0079"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03469"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I753"
FT                   /protein_id="AAG03469.1"
FT                   /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGF
FT                   SELKLDDALLTQGKLAIVSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPL
FT                   KRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFESRAPVALGSQAFRLLTERDGLGEY
FT                   AAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALAGRVV
FT                   ASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQR
FT                   RPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLI
FT                   DNASFVLVVRADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPY
FT                   HAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
FT   gene            complement(97754..98218)
FT                   /locus_tag="PA0080"
FT   CDS_pept        complement(97754..98218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0080"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03470"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="PDB:3ZHN"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I752"
FT                   /protein_id="AAG03470.1"
FT                   /translation="MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQ
FT                   AAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDE
FT                   QTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP"
FT   gene            complement(98263..99756)
FT                   /gene="fha1"
FT                   /locus_tag="PA0081"
FT   CDS_pept        complement(98263..99756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fha1"
FT                   /locus_tag="PA0081"
FT                   /product="Fha1"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa."
FT                   /db_xref="EnsemblGenomes-Gn:PA0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03471"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I751"
FT                   /protein_id="AAG03471.1"
FT                   /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPER
FT                   LVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQ
FT                   LGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAFAEPAPTPHPAVTAHFQGGSPLDT
FT                   KPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPPPAGGAPLIPADW
FT                   DPFAELLGNTPAPSATPVAQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQP
FT                   QPQPASVAAPTPPASAAASAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLV
FT                   EGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRA
FT                   VADSFEDLKAHQLAVMAGVQAAIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWD
FT                   SFTELYAKILREAEDDFQELFGREFSRAYEEHSARLRRS"
FT   gene            100124..101158
FT                   /locus_tag="PA0082"
FT   CDS_pept        100124..101158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0082"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03472"
FT                   /db_xref="GOA:Q9I750"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I750"
FT                   /protein_id="AAG03472.1"
FT                   /translation="MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDA
FT                   VLPAEPPEWPRVRALASELFGRSKDLRVANLLLQSNVALDGLDGLADGLLLVRELLGQY
FT                   WDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAG
FT                   LQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGVAERVGSAQGLDL
FT                   GPLRQLLRQALQVFDLYGPQGAGESLAPGAEAVADEQVGAAPVAAVAAPAPRASGEIAN
FT                   REDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRG
FT                   PESE"
FT   gene            101247..101765
FT                   /locus_tag="PA0083"
FT   CDS_pept        101247..101765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03473"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="PDB:4UQY"
FT                   /db_xref="PDB:4UQZ"
FT                   /db_xref="PDB:5N8N"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I749"
FT                   /protein_id="AAG03473.1"
FT                   /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMAD
FT                   LAGKPAEPQAAVADRKFLEIDVDNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFESM
FT                   DDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEEMIMKAIKDPALLQALASAP
FT                   KPKDDEPQA"
FT   gene            101778..103274
FT                   /locus_tag="PA0084"
FT   CDS_pept        101778..103274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03474"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="PDB:5N8N"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I748"
FT                   /protein_id="AAG03474.1"
FT                   /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAV
FT                   RTLAEHALEQTSLISNDAIKSIESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYL
FT                   VNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCL
FT                   VGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTT
FT                   PEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWAN
FT                   SAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDR
FT                   REAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCR
FT                   FAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVE
FT                   EVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
FT   gene            103350..103838
FT                   /gene="hcp1"
FT                   /locus_tag="PA0085"
FT   CDS_pept        103350..103838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcp1"
FT                   /locus_tag="PA0085"
FT                   /product="Hcp1"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa."
FT                   /db_xref="EnsemblGenomes-Gn:PA0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03475"
FT                   /db_xref="GOA:Q9I747"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="PDB:1Y12"
FT                   /db_xref="PDB:6AP1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I747"
FT                   /protein_id="AAG03475.1"
FT                   /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGG
FT                   GGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKE
FT                   VLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA"
FT   gene            104006..104851
FT                   /locus_tag="PA0086"
FT   CDS_pept        104006..104851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0086"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03476"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="PDB:4UQX"
FT                   /db_xref="PDB:4UQY"
FT                   /db_xref="PDB:4UQZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I746"
FT                   /protein_id="AAG03476.1"
FT                   /translation="MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRS
FT                   QPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTYSTAIDCEALRREVF
FT                   AGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAPFAW
FT                   LADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVA
FT                   LLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
FT                   "
FT   gene            104853..105362
FT                   /locus_tag="PA0087"
FT   CDS_pept        104853..105362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0087"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03477"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I745"
FT                   /protein_id="AAG03477.1"
FT                   /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLNQLKASVL
FT                   RDLAWLFNTTSLFDHGPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATF
FT                   EPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQ
FT                   GERRRT"
FT   gene            105359..107218
FT                   /locus_tag="PA0088"
FT   CDS_pept        105359..107218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0088"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03478"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I744"
FT                   /protein_id="AAG03478.1"
FT                   /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPY
FT                   VERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGAL
FT                   SSGFSIERGASLRGQLGPDDQTACEYRTAHPVTLWPLEVAQADYFGNPAAVLGRLAASE
FT                   PRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVRAPDN
FT                   AWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRALR
FT                   RCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVI
FT                   VDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFRVRREPRVLSSK
FT                   QRRKGPRSTYVGSETFVALVDANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFT
FT                   LEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGAAALRELLRL
FT                   YGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDENAFRGTGVFLL
FT                   GAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
FT   gene            107182..108228
FT                   /locus_tag="PA0089"
FT   CDS_pept        107182..108228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0089"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03479"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I743"
FT                   /protein_id="AAG03479.1"
FT                   /translation="MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLG
FT                   HSVRLADDPLRLGQKPDCTFAPSTLASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTE
FT                   YARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAALSG
FT                   RGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQWLELP
FT                   ERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWVA
FT                   EYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPH
FT                   EHKEKEHE"
FT   gene            108221..110929
FT                   /gene="clpV1"
FT                   /locus_tag="PA0090"
FT   CDS_pept        108221..110929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpV1"
FT                   /locus_tag="PA0090"
FT                   /product="ClpV1"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa."
FT                   /db_xref="EnsemblGenomes-Gn:PA0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03480"
FT                   /db_xref="GOA:Q9I742"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="PDB:4UQW"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I742"
FT                   /protein_id="AAG03480.1"
FT                   /translation="MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQI
FT                   LQLPDSDLHQIVRQSGIDPARLAKDLTEALDRLPRGSTSITDLSSHVEEAVERGWVYGS
FT                   LMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAKLKVEALTERFDEYVGASPENGLS
FT                   ASDGFNAGAAPGEASGALAPSAMGKQEALKRFTVDLTEQARSGKLDPIVGRDEEIRQLV
FT                   DILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLLQAGAS
FT                   MKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLR
FT                   TVAATTWAEYKKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEKHHQVQILDE
FT                   ALEAAVRLSHRYIPARQLPDKSVSLLDTACARTAISLHAVPAEVDDSRRRIEALETELA
FT                   IIRRESAIGVATAERQRNAETLLAEERERLAALEQRWAEEKRLVDELLETRARLRAAAE
FT                   AVDAGGVPLGEGEVRLDEEQRQALHARLAELQAQLSALQGEEPLILPTVDYQAVASVVA
FT                   DWTGIPVGRMARNEIETVLNLDRHLKKRIIGQDHALEMIAKRIQTSRAGLDNPSKPIGV
FT                   FMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEG
FT                   GVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTT
FT                   NAGTEMIASLCADPELMPEPEAIAKSLREPLLKIFPPALLGRLVTIPYYPLSDDMLKAI
FT                   SRLQLGRIKKRVEATHKVPFEFDEGVVDLIVSRCTETESGGRMIDAILTNTLLPDMSRE
FT                   FLTRMLEGKPLAGVRISSRDNQFHYDFAEAE"
FT   gene            110976..112907
FT                   /gene="vgrG1"
FT                   /locus_tag="PA0091"
FT   CDS_pept        110976..112907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgrG1"
FT                   /locus_tag="PA0091"
FT                   /product="VgrG1"
FT                   /note="Product name confidence: Class 2: Function of highly
FT                   similar gene experimentally demonstrated in another
FT                   organism (and gene context consistent in terms of pathways
FT                   its involved in, if known)."
FT                   /db_xref="EnsemblGenomes-Gn:PA0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03481"
FT                   /db_xref="GOA:Q9I741"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="PDB:4MTK"
FT                   /db_xref="PDB:4UHV"
FT                   /db_xref="PDB:6H3L"
FT                   /db_xref="PDB:6H3N"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I741"
FT                   /protein_id="AAG03481.1"
FT                   /translation="MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPN
FT                   LPLEQLLGKPMSLSLELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTS
FT                   DCRIFQNQSVPEIIKQVFRNLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEG
FT                   IYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPG
FT                   SLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQA
FT                   QHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQF
FT                   ESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQ
FT                   SNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPY
FT                   ELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVG
FT                   HDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSV
FT                   VEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQA
FT                   MFPPPAKG"
FT   gene            complement(113022..113306)
FT                   /locus_tag="PA0092"
FT   CDS_pept        complement(113022..113306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0092"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03482"
FT                   /db_xref="GOA:Q9I740"
FT                   /db_xref="InterPro:IPR040818"
FT                   /db_xref="PDB:4ZUY"
FT                   /db_xref="PDB:4ZV0"
FT                   /db_xref="PDB:5JTK"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I740"
FT                   /protein_id="AAG03482.1"
FT                   /translation="MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRS
FT                   LDRSALHRLTLGSIAVKEFDETDPELSRALKDAYYVGIRTGRGLKVDLP"
FT   gene            complement(113303..114595)
FT                   /locus_tag="PA0093"
FT   CDS_pept        complement(113303..114595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0093"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03483"
FT                   /db_xref="GOA:Q9I739"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR028238"
FT                   /db_xref="PDB:4ZV0"
FT                   /db_xref="PDB:4ZV4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I739"
FT                   /protein_id="AAG03483.1"
FT                   /translation="MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGG
FT                   LAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDV
FT                   SATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIGGP
FT                   TERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLG
FT                   DLGDRLGPGYRDLFQGVAGMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNLD
FT                   HDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAP
FT                   QGNWYTLSPRVQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWS
FT                   VKGQSYPAKGGAQQLFSNEKGSFGLLPREGS"
FT   gene            complement(114611..115045)
FT                   /locus_tag="PA0094"
FT   CDS_pept        complement(114611..115045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0094"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03484"
FT                   /db_xref="GOA:Q9I738"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="PDB:1TU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I738"
FT                   /protein_id="AAG03484.1"
FT                   /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDAS
FT                   QGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVF
FT                   IERRPAVLITTLTTTPADLPHHEPAWKQAMQTLVPRPTPS"
FT   gene            115299..117524
FT                   /locus_tag="PA0095"
FT   CDS_pept        115299..117524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03485"
FT                   /db_xref="GOA:Q9I737"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I737"
FT                   /protein_id="AAG03485.1"
FT                   /translation="MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISE
FT                   NPDLPLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLT
FT                   RTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLME
FT                   QEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHMAREV
FT                   QSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEA
FT                   LQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVG
FT                   AQFESELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDR
FT                   HDQSNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQT
FT                   VPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDETH
FT                   WVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVGNNEKISIGANRTEDVG
FT                   SNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETISIGADR
FT                   SESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLV
FT                   TGAASIRMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN"
FT   gene            117552..118001
FT                   /locus_tag="PA0096"
FT   CDS_pept        117552..118001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0096"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03486"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I736"
FT                   /protein_id="AAG03486.1"
FT                   /translation="MSVEIHLPGATTALPARLDGVVIGVLLDVPDAAAPVVAYPGCPSE
FT                   HGLAAATTTQLSRADIGAQVALMFVAGDPRQPLLIGRIQRLPQEALAQLDGERLEFSAE
FT                   REIVLRCGKASITLTRAGKVIIRGAYLSSRSTGVNRIKGGSVQIN"
FT   gene            117931..119130
FT                   /locus_tag="PA0097"
FT   CDS_pept        117931..119130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0097"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03487"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I735"
FT                   /protein_id="AAG03487.1"
FT                   /translation="MAPIFPAAPPGSTGSRAVRCRSTERGGPDMELLNATPLAAAYNQG
FT                   LDAEGRESLVVIAKGSFDLPLDGREARLLDEQQTLLMVDEFYGEPGFSAPRRECEFVPF
FT                   KPFCDVLVLGSAQAPGGRPVQQLTAGIRVGRVSKALTVHGPRQWEPGLLGAGAGVAQPF
FT                   QSQDISYASAFGGSHASPDNPGFMDCYMANPAGCGWFPRSADTAEIVGTPMPATEKLGE
FT                   PVDSPHGRFTPMALGPLGRHWQARVGFAGRYDDAWLAERFPFLPADFDERYFQSAPADQ
FT                   WTDHLRGGEEVLLLNLTGEERAAFRVPRREVPVTFFLKKGGHETAQARIDTLLVDCDAR
FT                   RVEVTWRIRRPLKRNLFEIAQVLVGSKSAAWWRARELGKDYYPSLAALARSRQAEEDEA
FT                   "
FT   gene            119127..120164
FT                   /locus_tag="PA0098"
FT   CDS_pept        119127..120164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0098"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03488"
FT                   /db_xref="GOA:Q9I734"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I734"
FT                   /protein_id="AAG03488.1"
FT                   /translation="MSQALSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGGE
FT                   WLLAASVPLEQPWRGRAKLLKMAARAIDEALRGQPDLDCTELPLLLCVAEGDRPGRCAG
FT                   LDESFLRDLEGELGRRFHPSSALIARGRVGGAVALLNARKLIQGGCRQVLVAGVDSFVS
FT                   GPTLAAYEARERLLTSQNSNGFIPGEGAAAVLVAAPLHEEAPQLLCIGLGFGVEKATVE
FT                   SEDLPLRADGLSQAVRAALAEAGCGLEQMDYRLTDISGEQYYFKEASLTLSRNLRVLKP
FT                   KFDLWHPADCIGECGAAIGPALLAVALAASRKGYGDGPNVFCHLGNDAGERAAALLSYR
FT                   RVRAA"
FT   gene            120164..121324
FT                   /locus_tag="PA0099"
FT   CDS_pept        120164..121324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0099"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03489"
FT                   /db_xref="GOA:Q9I733"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="InterPro:IPR028917"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I733"
FT                   /protein_id="AAG03489.1"
FT                   /translation="MANEVYANNMEISCKAANGKSIAAFPDVCFTPPQAPPTPLGVPIP
FT                   YPNTGLSKDTTKGTRTIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYF
FT                   TSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPVWPYLDQATVDAGGGPCSNEVKKEKK
FT                   DCADFKPHGSKDACAGLGAGKPSGKKTSNEADRLADKVAARKCLTARRCALQPYKPNSC
FT                   CPQQTAHHLIEASALHDKGRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMHT
FT                   FQSAAAAKSRSGTLQLSNGSSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLD
FT                   NYHKQCGINARTPIKAVETGQTDVTAATQAIKTRNARLGATRSRVR"
FT   gene            121346..122266
FT                   /locus_tag="PA0100"
FT   CDS_pept        121346..122266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0100"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03490"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I732"
FT                   /protein_id="AAG03490.1"
FT                   /translation="MLKKLSPIFSNITGVVRYQDLAYVASVSDEIQEQNIAHSYVTEWD
FT                   CGTWCVAGEDDDMLPWEIVSATVVHEPVEQALFLGARGQVFCMGSGDIHEEQLPDGDDA
FT                   IGGRGNMRGVACIDGVAYACGMDRQVYRRFDENDWRAIDTGARPPAGSEAVVGFEAIGG
FT                   FGAREIYAVGWDGEIWQYDGKRWQPRESPTNLILTAICCAEDGSVYACGQAGTLLRGRN
FT                   DHWEIIAQDDVDEDLWSLAWFDGALYVSSATAVYTLVGGHLKEVDFGDEQPQRCFHLSA
FT                   ADGVLWSIAAKDIFSFDGQQWTRID"
FT   gene            122248..123495
FT                   /locus_tag="PA0101"
FT   CDS_pept        122248..123495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0101"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03491"
FT                   /db_xref="InterPro:IPR011959"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I731"
FT                   /protein_id="AAG03491.1"
FT                   /translation="MDAHRLSIAAIVDQHAEEAAFLALLRDYAVRAPHYDLEELAELDQ
FT                   RIEAHLDGLAIAGQAGHDALLEQLDAHAQGEAFALAVLAMQAGDDALIGRMRACLAASP
FT                   EARRGFAAALGWLDWDQARPWVERLLASPEPLFRAIGLAACGMHRHDPGPALLSALGHA
FT                   DPAVLARAARTAGELRRRDLMANIRAYRAHDDPSLRFWANWATAQMGDEEALGPLRAFA
FT                   GQPGPFQLPATMVLLAWQPRDTSMAWIRQLMQAADTRRIGIQATGLFGDPVAVPWLIQQ
FT                   MRDESLARVAGEAFSLITGADLALLDLELEALPDYDPGPNDDLDDDNVALDDDENLSWP
FT                   EAERVSAWWRDNGARFVAGRAYLLGEPLGEARCRQVLRDGQQRQRMAAACLLARFVPNL
FT                   PLFPTGAPVRRQLDLF"
FT   gene            123871..124599
FT                   /locus_tag="PA0102"
FT   CDS_pept        123871..124599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0102"
FT                   /product="probable carbonic anhydrase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03492"
FT                   /db_xref="GOA:Q9I730"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I730"
FT                   /protein_id="AAG03492.1"
FT                   /translation="MPDRMRGVKSDSPEQESADDALKRIVDGFQHFRREVFPEQQALFK
FT                   KLANSQRPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEY
FT                   AVLALGVHHIIVCGHSDCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDCGAS
FT                   HDTLGVLTEENVVAQLDHLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQGRFL
FT                   PLDGEHPVPMATPAPRYLSS"
FT   gene            124810..126381
FT                   /locus_tag="PA0103"
FT   CDS_pept        124810..126381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0103"
FT                   /product="probable sulfate transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03493"
FT                   /db_xref="GOA:Q9I729"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I729"
FT                   /protein_id="AAG03493.1"
FT                   /translation="MHVSKVFPSLRDTLPRDLMASVVVFLVALPLCMGIAIASGMPPAK
FT                   GLLTGIVGGLVVGFLAGSPLQVSGPAAGLAVLVFELVRTYGVAMLGPILLLAGAIQLLA
FT                   GRLRLGCWFRVTSPAVVYGMLAGIGILIVLSQLHVMLDLAPKASGLDNLLAFPQAAFAA
FT                   LGSLGMDSGLDAALLGLGTIAVMWGWDKLRPQRLRFLPGALLGVSLATLASLWLALDVR
FT                   RVEVPANLGEAIVWLRPADLLALADPSLLLAAVVVAFIASAETLLSAAAVDRLHDGPRS
FT                   DMDRELSAQGVGNMLCGLLGALPMTGVIVRSSANVNAGARTRASAIFHGLWLLAFVLLL
FT                   GSLLRQIPVASLAGVLVYTGVKLVDFKALGNLSRYGRMPMLVYAATALAIVFTDLLTGV
FT                   LVGFALTLLKLVLKAARLKIALRYTGEHEAELRLSGAATFLKVPALSRVLDEVKPGTTL
FT                   HVPMDNLSYVDHACMELLEDWGRMAPVQGSRLVIEPRALKRRLEGRLRGSVGLGGARNG
FT                   GAVSPG"
FT   gene            126518..127114
FT                   /locus_tag="PA0104"
FT   CDS_pept        126518..127114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0104"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03494"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I728"
FT                   /protein_id="AAG03494.1"
FT                   /translation="MVDGFVQPVGEGLADQLVGHQVGYGGVQWDQCLAEVGDVAVVHFF
FT                   HQAVRQVGFVEQGVEAVVAGEQRRRGEEELLGDLQHRLDPFLDAGFAGHAVGGVEQVRY
FT                   LFDVGVDEAGEYVFRVLALRLDGAMQVGQAAGYQISQVTVAGFAEVRLLDEFTEGSGVH
FT                   GVSHTTGMVKKRRNIAGGARRLRRDCHNRFVVMRG"
FT   gene            127378..128502
FT                   /gene="coxB"
FT                   /locus_tag="PA0105"
FT   CDS_pept        127378..128502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="PA0105"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03495"
FT                   /db_xref="GOA:Q9I727"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I727"
FT                   /protein_id="AAG03495.1"
FT                   /translation="MLRHPRVWMGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHMT
FT                   IFWICVVIGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAVPA
FT                   TRTLIHIYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQDQIHNRQAKDEHYL
FT                   LEVDEPLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPGIYRG
FT                   QCAELCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVARGDKV
FT                   YHTICAACHQAEGQGMPPMFPALKGSKIVTGPKEHHLEVVFNGVPGTAMAAFGKQLNEV
FT                   DLAAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
FT   gene            128512..130104
FT                   /gene="coxA"
FT                   /locus_tag="PA0106"
FT   CDS_pept        128512..130104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="PA0106"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03496"
FT                   /db_xref="GOA:Q9I726"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I726"
FT                   /protein_id="AAG03496.1"
FT                   /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSFM
FT                   MFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPL
FT                   MIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHSVTF
FT                   FIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAG
FT                   VVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAIIPTFAR
FT                   KPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTGVKVFNW
FT                   VTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLV
FT                   PGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFIGMNLAFFPMHFVGLAGMPRRIP
FT                   DYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRGGKPAPAKPWDGAEGLEWSIPSP
FT                   APYHTFSTPPEVK"
FT   gene            130115..130669
FT                   /locus_tag="PA0107"
FT   CDS_pept        130115..130669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03497"
FT                   /db_xref="GOA:Q9I725"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I725"
FT                   /protein_id="AAG03497.1"
FT                   /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPLYDVMCRALGINGK
FT                   TAGSAYSGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARNPS
FT                   DKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDVRHV
FT                   TLAYTLFDITARKPPVPVAGR"
FT   gene            130680..131567
FT                   /gene="coIII"
FT                   /locus_tag="PA0108"
FT   CDS_pept        130680..131567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coIII"
FT                   /locus_tag="PA0108"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03498"
FT                   /db_xref="GOA:Q9I724"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I724"
FT                   /protein_id="AAG03498.1"
FT                   /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHKESH
FT                   GPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAAFF
FT                   GALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWKLPL
FT                   INTILLVTSSFTVTFAHHALKKNKRGPLKAWLALTVLLGIAFLILQAEEYVHAYNELGL
FT                   TLGAGIYGSTFFMLTGFHGAHVTLGALILGIMLIRILRGHFDAEHHFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVI"
FT   gene            complement(131583..131792)
FT                   /locus_tag="PA0109"
FT   CDS_pept        complement(131583..131792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0109"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03499"
FT                   /db_xref="GOA:Q9I723"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I723"
FT                   /protein_id="AAG03499.1"
FT                   /translation="MLKVAIVLLLLATLVSLFSGLFFLVKDQGHGSRVVNSLTVRVVLA
FT                   AATLVLVAWGFYSGELNSHAPWHF"
FT   gene            131808..132602
FT                   /locus_tag="PA0110"
FT   CDS_pept        131808..132602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0110"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03500"
FT                   /db_xref="GOA:Q9I722"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I722"
FT                   /protein_id="AAG03500.1"
FT                   /translation="MGGFMQYSQRLGEAGRNDRRSMRGAFRPGLLPTLVVLGLLPVLLW
FT                   LGTWQLQRADEKRALLASYEARRGAEPVSPGQLEGLRDPAYVRVRLHGRFDERHTLLLD
FT                   NRLRNGQAGVEVLQPFYDQASGLWLLVNRGWVAWTDRRSPPTLETPDRVLLLDAWTYLP
FT                   PPGGLHLADAPAGGWPRLVTQLDIPALWQAFGRAGLPWEIRLEPGDASFDTDWPLVSMP
FT                   PERHTGYAVQWFALATALLALYLYLGVRRAREKNHESRDSDA"
FT   gene            132577..133155
FT                   /locus_tag="PA0111"
FT   CDS_pept        132577..133155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0111"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03501"
FT                   /db_xref="GOA:Q9I721"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I721"
FT                   /protein_id="AAG03501.1"
FT                   /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWVP
FT                   QGRSYSGALIGNGQTPADLGVQGRSQGEQWQLLVTAPGTCGEDCQQLVYLARQINIALG
FT                   REASRAGHALAASGELPADFANLVRQDYPRLQRYGLDPALYDKAGGGERPLLWVVDPHG
FT                   NLVLRYDAKANGKKLLKDVQLLLKLSHIG"
FT   gene            133220..134293
FT                   /locus_tag="PA0112"
FT   CDS_pept        133220..134293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0112"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03502"
FT                   /db_xref="GOA:Q9I720"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I720"
FT                   /protein_id="AAG03502.1"
FT                   /translation="MSGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPGC
FT                   YGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVRRG
FT                   RDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALRLSG
FT                   RFAARRYPAATRGLAGLALLLVIGQIALGGWVSSNYAAVACIDLPTCHGEWWPRMDFAN
FT                   GFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVWPTALM
FT                   LLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRAPAPSPQ
FT                   RVRRTLPPAQGSRLKAA"
FT   gene            134319..135233
FT                   /locus_tag="PA0113"
FT   CDS_pept        134319..135233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0113"
FT                   /product="probable cytochrome c oxidase assembly factor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03503"
FT                   /db_xref="GOA:Q9I719"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I719"
FT                   /protein_id="AAG03503.1"
FT                   /translation="MATVIDRHSQPTWRDFLELTKPKVVVLMLITSLIGMLLATKAPLD
FT                   GFVPWQVLIFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTHKRPLAEGRVSPSMALGFA
FT                   LLLALAGMAVLLAFTNPLTAWLTLASLLGYAALYTGFLKRATPQNIVIGGLAGAAPPLL
FT                   GWVAITGHLSAEPLLLVLIIFAWTPPHFWALCIHRKDEYAKADIPMLPVTHGERYTKLH
FT                   ILLYTLVLFAVSLMPFVIHMSGLVYLLCALALGARFLDWAWALYCDSRPHAAIKTFKYS
FT                   IVYLFLLFMALLVDHYLPLKLLL"
FT   gene            135259..135894
FT                   /gene="senC"
FT                   /locus_tag="PA0114"
FT   CDS_pept        135259..135894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="senC"
FT                   /locus_tag="PA0114"
FT                   /product="SenC"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PA0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03504"
FT                   /db_xref="GOA:Q9I718"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I718"
FT                   /protein_id="AAG03504.1"
FT                   /translation="MTRVNKTVLVLVALVALVLGLTVHKVLTAQRQADPTVLLDAGIVI
FT                   LPQTRKVPALEFTNQDGQAVSTASLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKLPQ
FT                   EVRDDLQVVFVSVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANAMSIPYIPAD
FT                   TSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
FT   gene            complement(135934..136386)
FT                   /locus_tag="PA0115"
FT   CDS_pept        complement(135934..136386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03505"
FT                   /db_xref="GOA:Q9I717"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:1XEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I717"
FT                   /protein_id="AAG03505.1"
FT                   /translation="MSLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLDL
FT                   VGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQAA
FT                   ERLWLDTPVYLSAQAHLQAYYGRYGFVAVTEVYLEDDIPHIGMRRA"
FT   gene            136518..136991
FT                   /locus_tag="PA0116"
FT   CDS_pept        136518..136991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0116"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03506"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I716"
FT                   /protein_id="AAG03506.1"
FT                   /translation="MRWEELSEQPCSLARVLAILGDRWTLLVLRDCFLGVRRFDDFERS
FT                   LGVTRHVLADRLKRLVEAEILAKVPYQERPLREEYRLTEKGMELYPAILSLVNWGDRHL
FT                   AGVEGPPLEHVHKHCGQHMHGVLVCSECGEPLHARDVTVREGLFWKGRLLRRG"
FT   gene            137248..137976
FT                   /locus_tag="PA0117"
FT   CDS_pept        137248..137976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0117"
FT                   /product="probable short chain dehydrogenase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03507"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I715"
FT                   /protein_id="AAG03507.1"
FT                   /translation="MTQRKAVLVMGAGDATGGAIARRFAREGYVACVARRNAEKLEPLV
FT                   QAIRDQGGEALACGCDARQEQQVIDLFARIEGEVGALEAVIFNVGANVWFPITETTERV
FT                   YRKVWEMAAFGGFLTGREAARVMLPRQRGTIIFTGATASLRGRAHFAAFSGAKFALRAL
FT                   AQSMARELGPKDIHVAHPIIDGAIDTDFIRETLPELYKRKEQDGILDPEHIAETYWQIH
FT                   CQPRDCWVHELDLRPWMETF"
FT   gene            138001..138588
FT                   /locus_tag="PA0118"
FT   CDS_pept        138001..138588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0118"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03508"
FT                   /db_xref="GOA:Q9I714"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I714"
FT                   /protein_id="AAG03508.1"
FT                   /translation="MSKQIEFFFDFGSPTTYLAWTQLPRIAAAHGASIAWRPMLLGGVF
FT                   KATGNHSPIEVPAKGRYTLHDLARYAKRYGVPLAFNPAFPINTLTLMRGAQGYLGGEGF
FT                   QPYLKAVFEALWVRQQNLGKPEVVAQVLAEAGFDPDEFLRLVGDEQVKEGLKATTEEAV
FT                   RRGVFGAPSFFVGDQLFFGQDRLDFVAEVLAG"
FT   gene            138818..140167
FT                   /locus_tag="PA0119"
FT   CDS_pept        138818..140167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0119"
FT                   /product="probable dicarboxylate transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03509"
FT                   /db_xref="GOA:Q9I713"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I713"
FT                   /protein_id="AAG03509.1"
FT                   /translation="METPAMFIKRCSRSIFLQVVIGLVIGVICGVGIPDLAVQMKPLGD
FT                   GFIKLIKMLIALIVFCVVVNGISGAGDLKKVGRIGLKSVIYFEILTTIALVLGLVVAYS
FT                   LGLGSGANIHLNELPAGDVALYTGRTQEIHGPVAFLMGLIPTSVFSAFAENDILQVLLF
FT                   SVLFGSALNLVGEQASGVARLINEFSHIVFRIMGMIVRLAPLGVFGAVAFTTARYGVDS
FT                   LSHLGALVLVFYATCLVFVMAVLGSVLRLSGVRMLPFLRYFREELLIVMGTASSDAVLP
FT                   QVMRKLEHMGIRSSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAHVTGTPLAMTDLITIL
FT                   LVSLVTSKGAHGIPGSALVILAATLTAVPAIPVAGLVLVLSVDWFMGIGRALTNLIGNC
FT                   VATVTIARWENDIDMPRAQAILDGRLEAPAKADGEPLKRSAVAGEGKLHG"
FT   gene            140216..140902
FT                   /locus_tag="PA0120"
FT   CDS_pept        140216..140902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0120"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03510"
FT                   /db_xref="GOA:Q9I712"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I712"
FT                   /protein_id="AAG03510.1"
FT                   /translation="MFSSSKLVNAVAQRLLDTIEQGRWVAGQMLPGQRELAEQMEISRP
FT                   SLREAIMVLETLGVVRSLPGKGVMVLERSEPLREVAAPGEATMEDVLQLRYALEPFIVG
FT                   IVAQSAGAAEISELRLLLLDLREAVEDGDPQALVEAYTAFHRRLVKLTSNPIFLSVSEQ
FT                   IGSALERSDNLVRRQPEYAEEILQEHDAILRAIRQHDSERASQAMRQHILNEGARLNID
FT                   LRLPQV"
FT   gene            141003..141737
FT                   /locus_tag="PA0121"
FT   CDS_pept        141003..141737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0121"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03511"
FT                   /db_xref="GOA:Q9I711"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I711"
FT                   /protein_id="AAG03511.1"
FT                   /translation="MVGFEARTQQGAALRPTSHFVYESIYTAILEKRLAPAAKLSKETL
FT                   GQIFRVSNGTIQRALTRLAEDGAVVMPPKEVASVARPDERQARQVLDARLLVESEVVRQ
FT                   LPAGLDPAALAELRALVDEEQACLAARDSAGLIRLAGRFHLRLAELTENPLLQGFVRGL
FT                   VARASLDIALNKGAVYTAEACAAQRALLDALEDGDSAAAAALMDAYLRGLFARMRFLPP
FT                   PTTDLREAFGMKAPSGEKRRRA"
FT   gene            141917..142327
FT                   /locus_tag="PA0122"
FT   CDS_pept        141917..142327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03512"
FT                   /db_xref="GOA:Q9I710"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I710"
FT                   /protein_id="AAG03512.1"
FT                   /translation="MAYAEWIAVKVVVSKSIGTVGIRNATLQWGKFYRYTNKDDEISTE
FT                   EVSSMNVQAGSPQWIASCGRENASSGTQGSFDCYDGNTKMGTFSWDDPWKSGATNTWSF
FT                   TPASADYAGITSGGNATGTDIGEVTLTLGRFS"
FT   gene            complement(142359..143267)
FT                   /locus_tag="PA0123"
FT   CDS_pept        complement(142359..143267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0123"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03513"
FT                   /db_xref="GOA:Q9I709"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I709"
FT                   /protein_id="AAG03513.1"
FT                   /translation="MDSLKGMAIFATVVDKGSMAAAAQSLGMTPSAVSQQIRKLESRAQ
FT                   VTLLHRTTRRLTLTEAGEAFYRSCAQMLAIAEEAERRLGEWRDAPVGELRLAAPVGFSG
FT                   TLITQALKPLLENHRQLRLQLFFQDERIDLVAERIDLAIRVGNLADSSLVARHLGDWSS
FT                   VLCAAPAYLRQRAPINRPEQLTEVDWISLNTSNHLNHLTLSGPGGEVCKLRLEPRVAAN
FT                   GMLAVRQFTLDGLGVSYQPLPEVRDALNDGRLQQLLPEWRIPGLGIYAVTPRREAQPAK
FT                   VKVAIEALRRAFATDGDERWS"
FT   gene            complement(143567..143848)
FT                   /locus_tag="PA0124"
FT   CDS_pept        complement(143567..143848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0124"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03514"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I708"
FT                   /protein_id="AAG03514.1"
FT                   /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQ
FT                   VANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKEIQILRIDRVEITP"
FT   gene            complement(143845..144072)
FT                   /locus_tag="PA0125"
FT   CDS_pept        complement(143845..144072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0125"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03515"
FT                   /db_xref="GOA:Q9I707"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR036535"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I707"
FT                   /protein_id="AAG03515.1"
FT                   /translation="MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQW
FT                   QVAAIDEGLADANAGRLLEHIEIEKRWGLQ"
FT   gene            complement(144248..144868)
FT                   /locus_tag="PA0126"
FT   CDS_pept        complement(144248..144868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0126"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03516"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I706"
FT                   /protein_id="AAG03516.1"
FT                   /translation="MPTRVLRGLVAALPLFLAACSDSAPSSEEIARLLAERGFDKPACA
FT                   SSTLFKTFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLRRDGDSYDLTPAGREDYKPES
FT                   KAFCYSSGFDVSVRSVDPAKPDDYGPAVEKGWLVTVEVKPREVKDWAKNPEVLKQASLT
FT                   TLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
FT   gene            144969..145469
FT                   /locus_tag="PA0127"
FT   CDS_pept        144969..145469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0127"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03517"
FT                   /db_xref="GOA:Q9I705"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I705"
FT                   /protein_id="AAG03517.1"
FT                   /translation="MRLPANLGRLLPALCLGVLLSACSTFGQRDPLRIDLVGLEPLPGQ
FT                   GMEMRFMVKLRVQNPNDEPIEYNGIALDLDVNGQPLASGVSDQTGEVPRFGERVVSVPL
FT                   TVSAFSAFRQAWGLSNNAPTQGMPYVVKGKLAGGLFGTVRFSEKGTLDFSGPAVGAPKT
FT                   KGL"
FT   gene            145542..145883
FT                   /locus_tag="PA0128"
FT   CDS_pept        145542..145883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03518"
FT                   /db_xref="GOA:Q9I704"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="PDB:2AKL"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I704"
FT                   /protein_id="AAG03518.1"
FT                   /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKV
FT                   IKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMK
FT                   LKSEFVRKV"
FT   gene            complement(145965..147392)
FT                   /gene="gabP"
FT                   /locus_tag="PA0129"
FT   CDS_pept        complement(145965..147392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="PA0129"
FT                   /product="gamma-aminobutyrate permease"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03519"
FT                   /db_xref="GOA:Q9I703"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I703"
FT                   /protein_id="AAG03519.1"
FT                   /translation="MSKVVLASQLPNKRNASLAPGLKQRHVTMLSIAGVIGAGLFVGSG
FT                   HAIAAAGPAALLAYLIAGTLVVLVMRMLGEMAVASPDTGSFSTYADRSIGRWAGFTIGW
FT                   LYWWFWVLVIPLEAIAAAAILNAWFPAIDTWIFALAVTFLLTVTNLFSVARYGEFEFWF
FT                   ALLKVIAIIAFIVLGAVAIVGGLPEREVSGLSSLMASHGGFVPNGYGAVLGALLTTMFS
FT                   FMGTEIVTIAAAESKDPAKQITRATNSVIWRIGLFYLVSIFIVISIVPWNDPLLIQVGS
FT                   YQRALELLDIPHAKLIVDLVVLVAVASCLNSAIYTSSRMVFSLAKRGDAPSVLKLTNTA
FT                   HVPRPAVLASTAVGFLTTIVNYFAPEKVFTFLLASSGAVALLVYLVIAVAQLRMRKQLQ
FT                   ASGQPIEFRMWLYPWLTWAVILFIVAALSIMLIMPEHRHEVFATALLTIFTVCLGLLNA
FT                   RRKPRLGEDYAGKTARV"
FT   gene            complement(147561..149054)
FT                   /locus_tag="PA0130"
FT   CDS_pept        complement(147561..149054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0130"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03520"
FT                   /db_xref="GOA:Q9I702"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I702"
FT                   /protein_id="AAG03520.1"
FT                   /translation="MGTLHHLINGEMVADNGRSADVFNPSTGEAIHKVPLADGKTLQKA
FT                   IDAARAAFPAWRNTPPAKRAQVLYRFKQLLEQNEARISKLISEEHGKTLEDAAGELKRG
FT                   IENVEYACAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAI
FT                   ACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDKEAVDGLLQAPEVKAISF
FT                   VGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCM
FT                   AISVAVCVGDQVADALIAKLVPQIKALKIGAGTSCGLDMGPLVTAAAQAKVTGYIDSGV
FT                   AQGAELVVDGRGYQVAGHENGFFLGGSLFDRVTPEMTIYKEEIFGPVLCVVRVNSLEEA
FT                   MQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFGGWKRSLFG
FT                   DLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
FT   gene            complement(149138..149425)
FT                   /locus_tag="PA0131"
FT   CDS_pept        complement(149138..149425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0131"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03521"
FT                   /db_xref="GOA:Q9I701"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I701"
FT                   /protein_id="AAG03521.1"
FT                   /translation="MSGRPQAVPTVQVDNAEVIVTEWRFAPGAETGRHRHGHDYVVVPL
FT                   TDGTLLLETPEGDRHAPLVAGQAYFRKAGVEHNVINASAHEVVFVETEIK"
FT   gene            complement(149425..150771)
FT                   /locus_tag="PA0132"
FT   CDS_pept        complement(149425..150771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0132"
FT                   /product="beta-alanine--pyruvate transaminase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03522"
FT                   /db_xref="GOA:Q9I700"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:4B98"
FT                   /db_xref="PDB:4B9B"
FT                   /db_xref="PDB:4BQ0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I700"
FT                   /protein_id="AAG03522.1"
FT                   /translation="MNQPLNVAPPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSWL
FT                   TDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIA
FT                   GLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAGTSL
FT                   GGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDASNIAA
FT                   VIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTP
FT                   DLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVACAAGLA
FT                   ALDILARDNLVQQSAELAPHFEKGLHGLQGAKNVIDIRNCGLAGAIQIAPRDGDPTVRP
FT                   FEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALNGIA"
FT   gene            150906..151823
FT                   /locus_tag="PA0133"
FT   CDS_pept        150906..151823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0133"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03523"
FT                   /db_xref="GOA:Q9I6Z9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6Z9"
FT                   /protein_id="AAG03523.1"
FT                   /translation="MAKSRNPSLGQVSDFDIRLLRIFKTIVECGSFSAAESTLGLSRSA
FT                   ISLHMGDLEKRLGMRLCQRGRAGFALTDEGREVYRATQTLLAALEGFRAEVNDLHQHLR
FT                   GELNIGIINNLVTLPQMRITHALSALKGQGPQVRINIGMTTPNEIELGVLDGHLHVGVV
FT                   PLISPLSGLEYLPLYDEHAQLYCSRGHALFERADGDIAVDEVLAADAVAPSYRLPAEAQ
FT                   ARHQELNNSASASDREGMAFLILTGNFIGYLPSHYAADWVAAGMLRPLLPERFHYAIAL
FT                   TIVTRKGRRPNLVLERFLEAVAVS"
FT   gene            complement(151936..153306)
FT                   /locus_tag="PA0134"
FT   CDS_pept        complement(151936..153306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0134"
FT                   /product="probable guanine deaminase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03524"
FT                   /db_xref="GOA:Q9I6Z8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Z8"
FT                   /protein_id="AAG03524.1"
FT                   /translation="MNDAVPAGNFVPPLILHSDHGGSAMSSSAHRGRILHFLGDPAKLG
FT                   DKAWEYFEDGLLWIEHGHVRALDHATYLLPQLPADLPLEEHPQRLLLPGFVDCHVHYPQ
FT                   LGVIASYGTQLLDWLETHTFPAEQRFADAGYAAAQAELFLDELLRHGTTTALVFGTVHA
FT                   VSAEAFFQAAQKRRLRMIAGKVLMDRNAPPALCDTAASGYAESRALIERWHGNGRLQYA
FT                   VTPRFAPTSSPEQLAAAARLLDEYPGVYLHTHLSENLKEVAWVGELFPQAQDYLDVYHR
FT                   AGLVGERSVFAHGIHLSERECRCLAHKNAALAHCPSSNLFIGSGLFDLGRAQQYGIRVG
FT                   IGSDVGGGTSLSLLANLADAYKIQQLRGTSLDPFQALYLATLGGARALDLDGLVGNFLP
FT                   GREADFVALDLAATPMIAQRMEHARGLADTLFVLNTLGDDRAVAETWVMGERRHVKG"
FT   gene            153696..153836
FT                   /locus_tag="PA0135"
FT   CDS_pept        153696..153836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0135"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03525"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Z7"
FT                   /protein_id="AAG03525.1"
FT                   /translation="MECATTVHRETVDSGSTHGAAEHASVDRRGLSWKAGKPSIHGHHG
FT                   V"
FT   gene            154417..155988
FT                   /locus_tag="PA0136"
FT   CDS_pept        154417..155988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0136"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03526"
FT                   /db_xref="GOA:Q9I6Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Z6"
FT                   /protein_id="AAG03526.1"
FT                   /translation="MSAPSSFAPPRLELRGISKRYPGCLANDRIDLCIDAGEIHALLGE
FT                   NGAGKSTLMKIIYGVTRPDAGEIRWQGEPVQVRDPARARALGIGMVFQHFSLFETLSVA
FT                   ENIALALGAEAGSPRRLEARIREVSQRYGMPLEPRRLVHGLSIGERQRVEIVRCLMQDI
FT                   RLLILDEPTSVLTPREAEDLFVTLRRLAEEGCSVLFISHKLAEVRALCQRATVLRGGRV
FT                   AGQCVPAQCSDLELARLMVGDAEGLAAEYPKVTGGAPFLQVRDLHWRNPDPFGVSFAGL
FT                   DLEVRSGEILGIAGVAGNGQDELLALLSGEVRLPRAQAERIRLGGCAGAHLAPDARRRA
FT                   GQAFVPAERLGHGAVPEMSLADNALLTAFQQGLVKRGLVRRRKVLALAEEIIRRFAVKA
FT                   PGAGAPARSLSGGNLQKFILGREILQAPRLLVAAHPTWGVDVGAAALIHRALIALRDAG
FT                   TAILVVSEDLDELFLLSDRIAALCSGRLCPAVATASASPQKVGGWMAGQFEAPAAVAGA
FT                   VAQGSL"
FT   gene            155988..157085
FT                   /locus_tag="PA0137"
FT   CDS_pept        155988..157085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0137"
FT                   /product="probable permease of ABC transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03527"
FT                   /db_xref="GOA:Q9I6Z5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Z5"
FT                   /protein_id="AAG03527.1"
FT                   /translation="MLLSLEPRGRQSRWMLLASPLLAGLLTLVCGALLFACLGHDPWQT
FT                   LHTVLVQPLSDLYGLGELLVKAMPILLCALGLALAYQARVWNIGAEGQLLVGALAGSAV
FT                   AIQLLDWQSRWALAWVLLAGTAAGALWAGFAAWLRTRFNANEILTTIMLNYIALNLLLY
FT                   GVHGPLKDPDGFNFPQSALFGEASRLPALFEDSRVHLGALFGLLALAAVWVLAQRSFLG
FT                   FQVRVLGLDRRAAGFVGFREKRLVWFVLLFSGALAGLAGVCEVAGPIGQLVPQVSPGYG
FT                   YAAITVAFLGRLNPFGILCASLLMALLYLGGEAAQMSLNLPLALSGLFQGMMLFFLLAC
FT                   DVLILYRPRLHGRWRKRPALRDALA"
FT   gene            157108..158034
FT                   /locus_tag="PA0138"
FT   CDS_pept        157108..158034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0138"
FT                   /product="probable permease of ABC transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03528"
FT                   /db_xref="GOA:Q9I6Z4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Z4"
FT                   /protein_id="AAG03528.1"
FT                   /translation="MDIDLLDNLLFAMVRTGTPLLLVALGELVCERSGVLNLGQEGMML
FT                   FGAVIGFMVAFSSGSLWLGVLLAVLAGMLLAALFAGVALYLNANQVACGLALTIFGVGL
FT                   ASFVGAAWVGKPLQGFAPLALPVLGELPLLGRMLFAQDALVYLSLALFAAVAWMLLRSR
FT                   AGLVLQAVGENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAENMTAG
FT                   RGWIALALVVFASWRVLRVLLGAWLFGLASILHLVAQGVGLSIPANLLAMLPYAATILV
FT                   LVLLSRDALRTRLYAPVSLGQPWKAGH"
FT   gene            158199..158762
FT                   /gene="ahpC"
FT                   /locus_tag="PA0139"
FT   CDS_pept        158199..158762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PA0139"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03529"
FT                   /db_xref="GOA:Q9I6Z3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Z3"
FT                   /protein_id="AAG03529.1"
FT                   /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTF
FT                   NCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQL
FT                   TNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPG
FT                   EVCPAKWKEGEKTLAPSLDLVGKI"
FT   gene            158907..160472
FT                   /gene="ahpF"
FT                   /locus_tag="PA0140"
FT   CDS_pept        158907..160472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="PA0140"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03530"
FT                   /db_xref="GOA:Q9I6Z2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6Z2"
FT                   /protein_id="AAG03530.1"
FT                   /translation="MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVG
FT                   LTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLD
FT                   ADVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVE
FT                   ARQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVGGGPA
FT                   GAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETEGPKLARALEEHVRHYEV
FT                   DIMNLQRASKLVPAKNAGELHEVRFESGGSLKAKTLILATGARWREMGVPGEQEYKAKG
FT                   VCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKL
FT                   YSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLK
FT                   GSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRT
FT                   SAPE"
FT   gene            complement(160552..161448)
FT                   /locus_tag="PA0141"
FT   CDS_pept        complement(160552..161448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03531"
FT                   /db_xref="GOA:Q9I6Z1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6Z1"
FT                   /protein_id="AAG03531.1"
FT                   /translation="MALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDLQI
FT                   ELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQ
FT                   WYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLTNSG
FT                   ILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMFFHTDT
FT                   ADAPWTVIKSDDKKRARLNCIRHFLHSLDYPDKDRRIAHEPDPLLVGPASRVIEEDEKV
FT                   YAEAAAAPGHANLDIPA"
FT   gene            161906..163255
FT                   /locus_tag="PA0142"
FT   CDS_pept        161906..163255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0142"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03532"
FT                   /db_xref="GOA:Q9I6Z0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6Z0"
FT                   /protein_id="AAG03532.1"
FT                   /translation="MSRTWIRNPLAIFTANGLDAAGGLVVEDGRIVELLGAGQQPAQPC
FT                   ASQFDASRHVVLPGLVNTHHHFYQTLTRAWAPVVNQPLFPWLKTLYPVWARLTPEKLEL
FT                   ATKVALAELLLSGCTTAADHHYLFPGGLEQAIDVQAGVVEELGMRAMLTRGSMSLGEKD
FT                   GGLPPQQTVQEAETILADSERLIARYHQRGDGARVQIALAPCSPFSVTPEIMRASAEVA
FT                   ARHDVRLHTHLAETLDEEDFCLQRFGLRTVDYLDSVGWLGPRTWLAHGIHFNAEEIRRL
FT                   GEAGTGICHCPSSNMRLASGICPTVELEAAGAPIGLGVDGSASNDASNMILEARQALYL
FT                   QRLRYGAERITPELALGWATRGSARLLGRSDIGELAPGKQADLALFKLDELRFSGSHDP
FT                   LSALLLCAADRADRVMVGGAWRVVDGAVEGLDLAALIARHRAAASALIAG"
FT   gene            163363..164415
FT                   /gene="nuh"
FT                   /locus_tag="PA0143"
FT   CDS_pept        163363..164415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuh"
FT                   /locus_tag="PA0143"
FT                   /product="nonspecific ribonucleoside hydrolase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03533"
FT                   /db_xref="GOA:Q9I6Y9"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y9"
FT                   /protein_id="AAG03533.2"
FT                   /translation="MSRAARPCNRFCSLLLGLALLMPASLPLSAAETVAPPSPRTLIID
FT                   TDPGADDVIALLFAMASPKELKIQALTTVAGNVPLEKTARNARLAREWGKRPDIPVYAG
FT                   APRPLLRTPIYAADVHGSEGISGVEVHEPKQPLAEGNAVDYLIRTLRAAPEKSVTLAML
FT                   GPETNLALALTQAPDIVKGVREIVIMGGAHFNGGNITPAAEFNIFADPHAAEIVLKSGA
FT                   PITMLPLDVTHKILTSPERIAKLRNLGNQAGKTVADILDAYVQYDIKYYGLKGGPVHDA
FT                   TVVAYLLKPSLFKGKRINVQVDSREGITFGQTVADWYGGLKQPANVEWINEGDAQGFFD
FT                   LLTERIARLP"
FT   gene            complement(164443..165069)
FT                   /locus_tag="PA0144"
FT   CDS_pept        complement(164443..165069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0144"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03534"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y8"
FT                   /protein_id="AAG03534.1"
FT                   /translation="MSRSNGSSSRRTFLRLAALLLPAGALLGSLPGVRAAARPRKLYLA
FT                   GPDVFRADAVAHGEALKALCARYGFEGLYPLDNALPKQLAEPREQAAWIYRANIGLIER
FT                   ADAVLANLNFFRGAEPDSGTAFEVGYATALGKPVYGYVDDAGSYAERIRRHAPELIGED
FT                   PTRDRDGMTLEEFGLPLNLMLAVPATLVVGDAEQALRQLASRRHG"
FT   gene            complement(165219..165737)
FT                   /locus_tag="PA0145"
FT   CDS_pept        complement(165219..165737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0145"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03535"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y7"
FT                   /protein_id="AAG03535.1"
FT                   /translation="MTAIYLAGPDVFRPDAEAHGETLKALCAEFGFVGLYPLDHALPAD
FT                   IREPAAQAAWIYRANVGLIERADCVLANLEPFRGSEPDSGTAFEVGYALALGKPVYAYL
FT                   SDAGAYAERLARLAPEWLGEHPGEDRDGWQLEGFGLPLNLMLAVPSRLVAGGPREALRR
FT                   LAEELGGNA"
FT   gene            165976..167073
FT                   /locus_tag="PA0146"
FT   CDS_pept        165976..167073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03536"
FT                   /db_xref="GOA:Q9I6Y6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y6"
FT                   /protein_id="AAG03536.1"
FT                   /translation="MKHRRTQSRMSVLRRLAAVLGLGACALAAEAAEPLKIGFVYVGPV
FT                   GDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTSFG
FT                   YMNPTAKVARQFPKVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKIGYI
FT                   ASFPIPEVIRDINAIQLALDKYDPQAELKVMWVSTWFDPGKEADAANALIDQGVDVVFQ
FT                   HTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMDGTWKS
FT                   EDFWGGLAESTVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSGKERFAA
FT                   GVSATKADLASMNYYVEGIKADLPK"
FT   gene            167146..168108
FT                   /locus_tag="PA0147"
FT   CDS_pept        167146..168108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0147"
FT                   /product="probable oxidoreductase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03537"
FT                   /db_xref="GOA:Q9I6Y5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y5"
FT                   /protein_id="AAG03537.1"
FT                   /translation="MDRLPIIDIAPLYGADRGAWNDVARRIDQACREWGFFYIAGHPLP
FT                   AARFEALLAAAREFFALPVEEKLKIDITRSRNHRGYGAIATEQLDPALPSDFKETFDMA
FT                   LHLPAEHPDVRAGKSFYGPNRHPDLPGWEALLEGHYADMLALARTVLRALAIALGIEED
FT                   FFDRRFEQPVSVFRLIHYPPASARQSADQPGAGAHTDYGCVTLLYQDAAGGLQVQNRQG
FT                   EWIDAPPIDGTFVVNIGDMMARWSNDRYRSTPHRVISPRGVHRYSMPFFAEPHMDTEIR
FT                   CLPGCFDADNPPKYPPTTCGDWLTSRFAQTYAYRRGETA"
FT   gene            168213..169163
FT                   /locus_tag="PA0148"
FT   CDS_pept        168213..169163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0148"
FT                   /product="probable adenosine deaminase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03538"
FT                   /db_xref="GOA:Q9I6Y4"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PDB:3OU8"
FT                   /db_xref="PDB:3PAN"
FT                   /db_xref="PDB:3PAO"
FT                   /db_xref="PDB:3PBM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6Y4"
FT                   /protein_id="AAG03538.1"
FT                   /translation="MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETL
FT                   RKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTD
FT                   RGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAV
FT                   GLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRA
FT                   FEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFG
FT                   GYVTENFHALQQSLGMTEEQARRLAQNSLDARLVK"
FT   gene            169361..169906
FT                   /locus_tag="PA0149"
FT   CDS_pept        169361..169906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0149"
FT                   /product="probable sigma-70 factor, ECF subfamily"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03539"
FT                   /db_xref="GOA:Q9I6Y3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y3"
FT                   /protein_id="AAG03539.1"
FT                   /translation="MPADGEAARRADLLKAFLAQRQRMESLVSRWVGCRATAADLVQEL
FT                   FLRFWRRPAAPVEELGSYLLRSARNLAIDHLRGEGSRQRQLDDWLPEQRQGEPVGPEQA
FT                   LEAGDQWRRVEAALRGLPERTRRIFLLNRIHGRTYAEIAQAMQLSQSAVEKHMMRALDA
FT                   CKASLAGPAGEQARSAQP"
FT   gene            169903..170898
FT                   /locus_tag="PA0150"
FT   CDS_pept        169903..170898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0150"
FT                   /product="probable transmembrane sensor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03540"
FT                   /db_xref="GOA:Q9I6Y2"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y2"
FT                   /protein_id="AAG03540.1"
FT                   /translation="MTRPDSDAAPYEPVLEQTAQAWLVRLRGTPDAATRRAFEDWLAQR
FT                   PAHAEAYARAEALWRLTEIPASRLAIEEADALEAYLRPRRASRNPRRWAYPLASVACLL
FT                   AMLWLGGWWQPGDWLQDWRADYVAAPGQVAEWKLADGSYLSLDAGSAVRVRIDGGQRRV
FT                   ELLRGAAALRVKRDALPFVVEAGEGRARVLGTEFEVRRGAGATRVTVLQGRVAVSAGTG
FT                   AGAAEEVLGAGQQVGFADGKLGRPVAIDAAAALAWRQGWLSFYRRPLAEVLDELARYYP
FT                   GRILLLDDALGRQPVSGSFRSDDPEAALKSLQAVLGYRQQILFGRLVVIR"
FT   gene            171047..173434
FT                   /locus_tag="PA0151"
FT   CDS_pept        171047..173434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0151"
FT                   /product="probable TonB-dependent receptor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03541"
FT                   /db_xref="GOA:Q9I6Y1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y1"
FT                   /protein_id="AAG03541.1"
FT                   /translation="MTPFPRFALRTLPALFLSLGCLAATVQAAEAVRYRFSQAAAPLAQ
FT                   ALNAFSRASGQTLLYTAELPPQATAPALHGSLVAEEALQRLLQGSGLRARRIDERTLTL
FT                   EPIPASGALDLDATTVSAAAPAQGYRPAANASISRGDAPVLEIPQAISVVPAQALQDQR
FT                   PRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTATADH
FT                   VEVLKGPASLLYGIQDPGGVVNVVSKKPQLQQANALTLRGSAYAHGRNGSGGQLDSTGP
FT                   LGDSGLAYRMILDHEDEDYWRDFGKSRETLVAPSLAWYGEDTTVNLSYEHREFTTPFDR
FT                   GTAIDPRTNRPLDIPRSRRLDEPFNITEGRSELTRLDLERQLDDTWKAHFGYGYSRETY
FT                   DDNQARVMAVNADGTLTRRMDGTHGAVSSDSFTTLGLSGTLQLAGMQHDLQFGMDHEKR
FT                   KIFRADLLRDSKTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYFQDSIHLDER
FT                   WILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSLYGSYMRSFKP
FT                   NSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRKKNVLVNELDGA
FT                   GNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLAAEVTEDPTLEGKRLQNVARNT
FT                   ASLSAVYELGQLFGGDRLRLGGGARYVGKRPGDPANSFDLPSYTVADAFASYDTRFGGH
FT                   GVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQVSTTVEF"
FT   gene            173811..174638
FT                   /gene="pcaQ"
FT                   /locus_tag="PA0152"
FT   CDS_pept        173811..174638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaQ"
FT                   /locus_tag="PA0152"
FT                   /product="transcriptional regulator PcaQ"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03542"
FT                   /db_xref="GOA:Q9I6Y0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Y0"
FT                   /protein_id="AAG03542.1"
FT                   /translation="MAVSQPAISKTLKELEEILGARLFERSKAGAELTEAGVTFLRYAG
FT                   PCVQALRDGVNTLRGHEAQVETVRVGVLSTVESLVVPEVIRRLHRRHGALVVSVATGPS
FT                   AYLLAQLKVGELDLVVGRMTDSPDIQGLTFEHLYSESMMLVVRPGHPLLAAPLGDLQRL
FT                   AEFPLVLPLAGTTIRRHADSLFVQWGIALAGQRLETLSPTLSRSYVLRSEAIWVAPRDA
FT                   VRLDVGNGELAELDLGIREPGGSVGLCHNAALPLPLGAQWFSAVLREVAAELH"
FT   gene            174773..175492
FT                   /gene="pcaH"
FT                   /locus_tag="PA0153"
FT   CDS_pept        174773..175492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="PA0153"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03543"
FT                   /db_xref="GOA:Q9I6X9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X9"
FT                   /protein_id="AAG03543.1"
FT                   /translation="MHDAESRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSLS
FT                   ETSGPDFSHLRLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQAN
FT                   AGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGHYYFRTIKPGPYPWRNGPNDWRPAHIH
FT                   VSVSGPAIAARLVTQMYFEGDPLIPKCPIIRTLADPEAAQSLIGRLDMSMANPMDCLAY
FT                   RFDIVLRGQRKTFFENA"
FT   gene            175503..176108
FT                   /gene="pcaG"
FT                   /locus_tag="PA0154"
FT   CDS_pept        175503..176108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="PA0154"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03544"
FT                   /db_xref="GOA:Q9I6X8"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X8"
FT                   /protein_id="AAG03544.1"
FT                   /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMAREGA
FT                   RGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPERPFNSFGRTATTFDAGE
FT                   WTLHTVKPGVVRNAQGVPMAPHINVSLFARGINIHLQTRLYFDDETEANAACPVLNLIE
FT                   QAPRRDTLLAQRCEVDGQLAYRFDIRIQGDNETVFFDF"
FT   gene            176315..177154
FT                   /gene="pcaR"
FT                   /locus_tag="PA0155"
FT   CDS_pept        176315..177154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaR"
FT                   /locus_tag="PA0155"
FT                   /product="transcriptional regulator PcaR"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03545"
FT                   /db_xref="GOA:Q9I6X7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X7"
FT                   /protein_id="AAG03545.1"
FT                   /translation="MSELPEHPATLAPPTVLSPAKRIEAFTGDPNFMTSLARGLAVIHA
FT                   FQERKRHLTIAQISHRTEIPRAAVRRCLHTLMQLGYATTDGRTYSLLPKVLTLGHAYLS
FT                   STPLAITAQPILDRLSEQLHEACSMATLEGDDVLYIARSATPQRLISVDLNVGSRLPAY
FT                   CTSMGRILLAALDDDALHAYFGGVEMQAKTSRTLYTPETLLPCLVEIRRQGWCIVDQEL
FT                   EVGLRSLAVPVRDSAGHVLAALNVGTHAGRVSRAELESRFLPLLLEASRELSARLFT"
FT   gene            177307..178458
FT                   /locus_tag="PA0156"
FT   CDS_pept        177307..178458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0156"
FT                   /product="probable Resistance-Nodulation-Cell Division
FT                   (RND) efflux membrane fusion protein precursor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03546"
FT                   /db_xref="GOA:Q9I6X6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X6"
FT                   /protein_id="AAG03546.1"
FT                   /translation="MSDARGAFHSKGRWSRMALPAILCAGLLVGCGAEPPAEEHVRVLA
FT                   QTVKMAEFASATSITGDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQ
FT                   RSNVENAQAAVAAQQAQSKLADLNYQRQKALLPKGYTSQSEYDQALASVRSAQSSLKAA
FT                   QAQLANARDLLSYTELRASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYES
FT                   LFSHDVDGQRITVSLLGKPEVTASGKVREITPTVDERSGTLKVKVGLDSVPAEMSLGSV
FT                   VNASVAAPAEHSVVLPWSALSKVGEQPAVWLLDQQGKARLQPVRVARYASEKVVIDGGL
FT                   EAGQTVVTVGGQLLHPGQVVEVAQPPQPTQSTASRDAVGGGQP"
FT   gene            178455..179525
FT                   /locus_tag="PA0157"
FT   CDS_pept        178455..179525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0157"
FT                   /product="probable Resistance-Nodulation-Cell Division
FT                   (RND) efflux membrane fusion protein precursor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03547"
FT                   /db_xref="GOA:Q9I6X5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X5"
FT                   /protein_id="AAG03547.1"
FT                   /translation="MKPFSLAGLFGFALLLSGCGDEPPPAPPRPVLTVTVKTLKNDDLG
FT                   RFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGDLA
FT                   SAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARDQLS
FT                   YTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFL
FT                   VSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSSAGSVR
FT                   SVLPASVLLERDGKTQVWVVDGKQSSVALREVQVLSRDERQVVIGQGLADGDRVVRAGV
FT                   NSLKPGQKIKLDEDAR"
FT   gene            179522..182569
FT                   /locus_tag="PA0158"
FT   CDS_pept        179522..182569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0158"
FT                   /product="probable Resistance-Nodulation-Cell Division
FT                   (RND) efflux transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03548"
FT                   /db_xref="GOA:Q9I6X4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X4"
FT                   /protein_id="AAG03548.1"
FT                   /translation="MKGGFNLSDWALRHQSLVWYLMAVSLVMGVFSYLNLGREEDPSFA
FT                   IKTMVIQTRWPGATVDDTLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLKDTTK
FT                   AGDIPDIWYQVRKKISDIQGEFPQGIQGPGFNDEFGDVFGSVYAFTADGLDFRQLRDYV
FT                   EKVRLDIRSVKDLGKVQMIGAQNEVIYLNFSTRKLAALGLDQRQVVQSLQAQNAVTPSG
FT                   VVEAGPERISVRTSGNFRSEKDLQAVNLRVNDRFYRLSDLASISRDFVDPPTSLFRYKG
FT                   EPAIGLAVAMKEGGNILEFGEALNARMQEITGELPVGVGVHQVSNQAQVVKKAVGGFTR
FT                   ALFEAVVIVLIVSFVSLGLRAGLVVACSIPLVLAMVFVFMEYTDITMQRVSLGALIIAL
FT                   GLLVDDAMITVEMMITRLELGDSLHDSATYAYTSTAFPMLTGTLVTVAGFVPIGLNASS
FT                   AGEYTFTLFAVIAVALLLSWIVAVLFAPVIAVHILPKTLKHKSEQKKGRIAERFDSLLH
FT                   LAMRRRWTTIFLTALLFGVSLFLMKFVQHQFFPSSDRPELLVDLNLPQNSSIHETRAVM
FT                   DRLEATLKDDEDIDHWSAYVGEGAIRFYLPLDQQLQNNFYGQLVIVTKDLEARERVAAR
FT                   LRDRLRKDYVGISTYVQPLEMGPPVGRPIQYRVSGPQIDKVREYAMGLAGVLDGNPNIG
FT                   DIVYDWNEPGKMLKIDIAQDKARQLGLSSEDVAQIMNSVVTGSAVTQVRDDIYLVNVIG
FT                   RAEDSERGSLETLESLQIVTPSGTSIPLKAFAKVSYELEQPLVWRRDRKPTITVKASLR
FT                   GEIQPTDLVARLAPEVKRFADGLPANYRIEVGGTVEESGKAEGPIAKVVPLMLFLMATF
FT                   LMIQLQSVQKLFLVASVAPLGLIGVVAALLPTGTPMGFVAILGILALIGIIIRNSVILV
FT                   TQIDAFEKDGKTPWEAVLEATHHRTRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGI
FT                   VAATLLTLIFLPALYVAWYRIPEPGR"
FT   gene            182768..183706
FT                   /locus_tag="PA0159"
FT   CDS_pept        182768..183706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0159"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03549"
FT                   /db_xref="GOA:Q9I6X3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X3"
FT                   /protein_id="AAG03549.1"
FT                   /translation="MDTLQGMRVFARVVDSGSFTSAAQALDLSTAQVSRLISDLEAHLQ
FT                   TRLLHRTTRRLALTEAGERYLERCRGILEDIEVAEAEAAGAHIRPCGRLRVQSLMGMGQ
FT                   HHLVPMIARYGALFPDVVIELTLSQRNPDMLEEGQDVLITGERQLPDSEFVAQRLGSIH
FT                   SVLCASPGYLQQHGVPRSVDDLERHVCLRLQDPAYPEGWIFADEQGERTVSPQNTFMVN
FT                   VAEVMAQAAKADLGIALLPSYVAAAALRNGELLRVLPGHAMHQRTIYALYPSRRYLDAK
FT                   IRTWVDLLQQELPQAFARDETTMQSSSYCAQ"
FT   gene            183822..184007
FT                   /locus_tag="PA0160"
FT   CDS_pept        183822..184007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0160"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03550"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X2"
FT                   /protein_id="AAG03550.1"
FT                   /translation="MNRQILAAAILSLFSLAFSQAGFAEESSLMTNRMVDANQQAIEHQ
FT                   QELSASAAQAGARSDS"
FT   gene            184287..184439
FT                   /locus_tag="PA0161"
FT   CDS_pept        184287..184439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0161"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03551"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X1"
FT                   /protein_id="AAG03551.1"
FT                   /translation="MESLKPDESKRLSIEESDCVSAGFQCPEIHWQDFPTPNFDCSYST
FT                   SSQGR"
FT   gene            184594..185928
FT                   /gene="opdC"
FT                   /locus_tag="PA0162"
FT   CDS_pept        184594..185928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opdC"
FT                   /locus_tag="PA0162"
FT                   /product="histidine porin OpdC"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03552"
FT                   /db_xref="GOA:Q9I6X0"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="PDB:3SY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6X0"
FT                   /protein_id="AAG03552.1"
FT                   /translation="MRNLFALTPMALALCTASAAWADEGEAKEGFIEGSSLQLLTRNYY
FT                   FNHDRRHASGHDSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLDGGGGTGGTSIL
FT                   PITSPSKEGYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLSNPVVAGGESRMLPQTF
FT                   RGVSLTNNSFEDLTLTAGQVSFTKYYNQSGHRRLGSYYGELPGDRDSHHLSWLGGTWGG
FT                   IEGFTSSLYAAELQNVWKQYYADVDYTYEIDDNWSLNPGAHYYKTVDSGDSLLGRIDNN
FT                   TYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNEKSWKLQ
FT                   YDYDFVALGLPGLSASASYSRGKLDLTRVDPDSPGYGGWYSADGKNAKHWERDLDLQYV
FT                   VQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPIDVF"
FT   gene            complement(185957..186754)
FT                   /locus_tag="PA0163"
FT   CDS_pept        complement(185957..186754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0163"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03553"
FT                   /db_xref="GOA:Q9I6W9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W9"
FT                   /protein_id="AAG03553.1"
FT                   /translation="MTMNGQPAELHRPIPTLARLPRPVYARAESLRAGSWTSRHRHAWV
FT                   QLSYAISGVLGVHTAEGSFFAPPQRAIWIPAQLEHEVVTSTRAEMRSLYIRGDACAWAP
FT                   TRCRVLEVTPLARELIKSFCELPVDYPEGDSAESRLVQVLLDQLRLLPEVAFSLPMPRE
FT                   PRLLRLCQALIDEPTQSLTMGDWAQRLGTSEKTLSRLFQRETGMNYRLWRQRQRLLASL
FT                   NALEAGDSVTGAALDSGYDSTSAYIAAFKGLFGFTPGELFRQR"
FT   gene            186832..188448
FT                   /locus_tag="PA0164"
FT   CDS_pept        186832..188448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0164"
FT                   /product="probable gamma-glutamyltranspeptidase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03554"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W8"
FT                   /protein_id="AAG03554.1"
FT                   /translation="MLDFSAHALPYASQRSPVHARRGMVATSQPQAAQVGLEILRRGGN
FT                   AIDAAIATAAALTVVEPTGCGIGGDAFALVWTRGRLHGLDASGRAPGLLDRERVRAAGH
FT                   ERMPLYGWTPVTVPGCPAAWGELSRRFGKLPFEQLLRPAIELARDGFPVSPVIARLWQS
FT                   GLDKFRAALPQRPELRAWFDEFLIDGRAPRAGEVFRQPGQADTLDELARSQCESFYRGE
FT                   LARAIVGHAECSGGYLRAEDLAGYQAKWVEPISLNYRGYDVWEIPPSGQGLIALMTLNI
FT                   LKGFEFGERDCARTWHRQLEAMKLAYVDGLHYISQPQSMRVSVEELLHEDYAASRRALI
FT                   GERALDPSPGQPRPGGTVYLACGDEEGNLVSFIQSNYHGFGSGVVVPGTGIALQNRGAE
FT                   FSLDPDHVNCLEPGKQTFHTIIPGFLSKDGVPLGPFGVMGAYMQPQGHVQMVMNLVDFG
FT                   LNPQAALDAPRWQWLGGLRVGIEHAAPRALAAELAQRGHQVEIAYDSTSYGRGQIVLRD
FT                   PASGVLCGGTEPRTDSQIAVW"
FT   gene            189120..189956
FT                   /locus_tag="PA0165"
FT   CDS_pept        189120..189956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0165"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03555"
FT                   /db_xref="GOA:Q9I6W7"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W7"
FT                   /protein_id="AAG03555.1"
FT                   /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNESL
FT                   TYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEITP
FT                   RLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNFYYR
FT                   KPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYHANLH
FT                   FNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKYHF"
FT   gene            190198..191604
FT                   /locus_tag="PA0166"
FT   CDS_pept        190198..191604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0166"
FT                   /product="probable transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03556"
FT                   /db_xref="GOA:Q9I6W6"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W6"
FT                   /protein_id="AAG03556.1"
FT                   /translation="MHSEDQRPNDLIYGLDDRPRPLPAFLAALQHVLASFVGIVTPPLV
FT                   IGSLLGLGEHLPYLISMALMVSGAGTLIQARRPFGIGAGMICLQGTSFAFLGAVLAAGM
FT                   LVKQRGGGPEEILAMIFGVCFFGAFVQIVLSRFLGHLRRVITPLVTGIVITLIGVSLIK
FT                   VGITDLGGGAGATDFGAPANLALGALVLLSIVLLNRSRLPWLRLAAIVIGLALGTLAAW
FT                   ATGLFVPRALPELPLVSLPQPFRFGFAFDWMAFLPVALIYLISSIETVGDLTANCMLSR
FT                   QPLEGPAYLQRLRGGVLGDGVSCLLAATFSAFPNTTFAQNNGVIQLTGVASRHVGIYIG
FT                   GVLLALGLFPWVGAILQQIPKPVLGGATLVMFGSVAAAGIRILGQTAMDRRSVLIIAAS
FT                   FGVGLGVAAQPTLLDQMPAVVKTLFDSAITSGGITAILLNLLLPEERVAEAAQASAKGG
FT                   ALARWRKPLG"
FT   gene            191697..192362
FT                   /locus_tag="PA0167"
FT   CDS_pept        191697..192362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0167"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03557"
FT                   /db_xref="GOA:Q9I6W5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W5"
FT                   /protein_id="AAG03557.1"
FT                   /translation="MTLTVPAHDPAARDKPAGRIRQKNEEAILAAAEEEFARHGFKGTS
FT                   MNTIAQNVGLPKANLHYYFGNKLGLYTAVLSNILELWDSTFNTLGVDDDPAEALARYIR
FT                   AKMEFSRRYPLASRIFAMEIISGGECLTAHFNQDYRSWFRGRAAVFEAWIAAGRMDPVD
FT                   PVHLIFLLWGSTQHYADFASQIGLVTGRKRMSRQDFAAAADNLVRIILKGCGLTPPAA"
FT   gene            192368..192958
FT                   /locus_tag="PA0168"
FT   CDS_pept        192368..192958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03558"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W4"
FT                   /protein_id="AAG03558.1"
FT                   /translation="MPSTLQGLAEYREEIRKSRFHTIAAPVADEDEAQAFIAAHRDASA
FT                   GHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVAVLVSRWFGGIKLGTGGL
FT                   ARAYGGGAAKCLQQAPRSELVERCRVRFACAFADHALLKARSLALGASVAAEDYGADGV
FT                   VLTLELPVARFEALQALLVDLSRGQVRPQRLDA"
FT   gene            complement(192965..193672)
FT                   /locus_tag="PA0169"
FT   CDS_pept        complement(192965..193672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0169"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03559"
FT                   /db_xref="GOA:Q9I6W3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W3"
FT                   /protein_id="AAG03559.1"
FT                   /translation="MRLERIARISDGFQSMAREQNLSLSERYHKQLRRLEKVARISDRY
FT                   QQMMRDLNLALKEASIRDPLTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFFKQ
FT                   VNDTWGHDSGDRVLVEIARAMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLERVR
FT                   DSVRTLAVRVGTEALSVTASVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCVFAAL
FT                   PPLPAPSRPAPAR"
FT   gene            complement(193799..194179)
FT                   /locus_tag="PA0170"
FT   CDS_pept        complement(193799..194179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0170"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03560"
FT                   /db_xref="InterPro:IPR018530"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W2"
FT                   /protein_id="AAG03560.1"
FT                   /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVIDW
FT                   VERFLADGQRPLELDLRLLYLNTSSIKAMMDILDLLEEAHQGGRPVSLRWHYDRRNERV
FT                   AELAEEFREDCSFPFAIQAHDE"
FT   gene            complement(194206..194748)
FT                   /locus_tag="PA0171"
FT   CDS_pept        complement(194206..194748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0171"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03561"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W1"
FT                   /protein_id="AAG03561.1"
FT                   /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHAE
FT                   QAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLVER
FT                   DDGQSLVRSIQAIANLDKAALKAAYKEQLRRPRDSGCASGAGLGLLDIARKSSEPLAAS
FT                   LKEQPDGRAFFSLRAVI"
FT   gene            complement(194757..196748)
FT                   /locus_tag="PA0172"
FT   CDS_pept        complement(194757..196748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0172"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03562"
FT                   /db_xref="GOA:Q9I6W0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6W0"
FT                   /protein_id="AAG03562.1"
FT                   /translation="MAANWGLRGKSVVALLLACALALVPAVLLGWRAMDDIRTHFGLAY
FT                   AKNFTLLHRQKILAPVSRELALSRRFAESVVTRDWLLKEDDPARRALFFREAEGYRGDF
FT                   RDHAYFIIASGSHHYYFNDGRQPYSERPRYTLEAGDPEDAWYFNTLRNSAAYNINVNVD
FT                   SKLNLTKVWFNLVIRDQGRPIGLAGSGLDLSGFLDDFIIAREPGVTPMIVGDDGAIQAH
FT                   PDRRLIAYSSAAGGASERHRVFDLLDQPEQRDALREAMRLARAKAGSVHCLWAGLDGRQ
FT                   QLFAVAYIPQLRWYVLTAVDLHAAQVLDNRWLWPLAGTFLLLLVALLLGFAYAVERLLL
FT                   RPLRSLKRSAKAIAAGRYDTPLPLARQDEIGSLSKAFASMADQVRRHTAELEDKVQERT
FT                   QALEEANREMAAAQKKIGDSLDYASLIQRAILPDRQLSATLGEHHFILWKPRDVVGGDF
FT                   YVYREQADGYLIGVVDCAGHGVPGALMTMLARAAIDHAIEAVGSRDPAAILGETDQAMR
FT                   SMLSQEQIPQALATNMDAGLVWVDRRRRQLAFAGAKISLYASDGEEVQELKGARRAIGD
FT                   KRRGDYRNIEVPLAPGWTFYLSTDGFLDQAGGEHGFGFGSRRFADMLRDHARQPLPEQA
FT                   EAFVATLAEYQGEHPQRDDITILSFRFD"
FT   gene            complement(197011..198060)
FT                   /locus_tag="PA0173"
FT   CDS_pept        complement(197011..198060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0173"
FT                   /product="probable methylesterase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03563"
FT                   /db_xref="GOA:Q9I6V9"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6V9"
FT                   /protein_id="AAG03563.1"
FT                   /translation="MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIK
FT                   QHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVDFI
FT                   AKPRLGIAEGMQAYAEEIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIALGAS
FT                   TGGTEALKEVLLGLPAHSPGVVITQHMPPGFTRSFAERLDRLTRLSVSEARDGDRILPG
FT                   HALVAPGDHHMEVQRSGANYVVRLNRQAQVNGHRPAVDVMFESLARCAGRNLLAGLLTG
FT                   MGKDGARGLLAIRQAGGYTLAQDEATCVVYGMPREAVELGAAEDVLPLERIAAALLQQA
FT                   ARRGSGNRL"
FT   gene            complement(198080..198682)
FT                   /locus_tag="PA0174"
FT   CDS_pept        complement(198080..198682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03564"
FT                   /db_xref="GOA:Q9I6V8"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6V8"
FT                   /protein_id="AAG03564.1"
FT                   /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASGEDLVIVTVLG
FT                   SCVSVCLRDPLNGIAGMNHFMLPERGLGGDPASPSARYGSHAMELLINRMLALGASRER
FT                   LQAKVFGGGSVLRQISAAIGQRNVEFTLDYLATERIPLLASDVLEAFPRKIYFFPRNGR
FT                   VLVKSLVELKNDTVLQRERDYRRRIDRNADGGPIDLF"
FT   gene            complement(198688..199530)
FT                   /locus_tag="PA0175"
FT   CDS_pept        complement(198688..199530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0175"
FT                   /product="probable chemotaxis protein methyltransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03565"
FT                   /db_xref="GOA:Q9I6V7"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6V7"
FT                   /protein_id="AAG03565.1"
FT                   /translation="MPTSTPSPVFGNQEFHYTREDFQQVRERLYRLTGISLAESKAQLV
FT                   YSRLSRRLRLLRLGSFAEYFTHLDREPGEQQLFVNALTTNLTAFFRERHHFPLLADLAR
FT                   RQLQRHRPLRIWSAAASTGEEPYSIAITLVEALGSFDPPVKIVASDIDTGVLDCARQGV
FT                   YPLERLEQMPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWSIAGELDA
FT                   IFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRSVGQTVYSPA"
FT   gene            complement(199600..201639)
FT                   /gene="aer2"
FT                   /locus_tag="PA0176"
FT   CDS_pept        complement(199600..201639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aer2"
FT                   /locus_tag="PA0176"
FT                   /product="aerotaxis transducer Aer2"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03566"
FT                   /db_xref="GOA:Q9I6V6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR041395"
FT                   /db_xref="PDB:3LNR"
FT                   /db_xref="PDB:3VOL"
FT                   /db_xref="PDB:4HI4"
FT                   /db_xref="PDB:4I3M"
FT                   /db_xref="PDB:4I44"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6V6"
FT                   /protein_id="AAG03566.1"
FT                   /translation="MGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLY
FT                   DSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGV
FT                   NELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRGAAEATS
FT                   AQLATAAYNARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDA
FT                   GRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANERLGSAV
FT                   QWTDRTEEHRAEQEVSQLVQAAAAGDFSKRVEEAGKEGFFLRLAKDLNSLVDTADRGLR
FT                   DVSRMLGALAQGDLTQRIEADYQGTFGQLKDFSNDTAQSLSRMLGQIREAADTINTAAS
FT                   EIASGNAELSARTEQQASSLEETASSMEELTSTVKLNAENARQANSLAANASEVATQGG
FT                   TVVQKVVSTMSSINESARKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRTLAQRSAAAAKEIKTLISDSVDKVENGNTLVAQAGQTMSDIVVAIRRVTDIMSEI
FT                   AAASAEQSTGIEEVNSAVSQMDDMTQQNAALVEEAAAAAEAMQEQAGLLNQSVAVFRLD
FT                   TPPSVVQLASARPSAPRPSAPAPLARSGMARASKARKEDGWEEF"
FT   gene            complement(201675..202160)
FT                   /locus_tag="PA0177"
FT   CDS_pept        complement(201675..202160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0177"
FT                   /product="probable purine-binding chemotaxis protein"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03567"
FT                   /db_xref="GOA:Q9I6V5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6V5"
FT                   /protein_id="AAG03567.1"
FT                   /translation="MNGTEASQANGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTAI
FT                   ANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSVSD
FT                   VIALGGDAIRPPPEFGASFDTEYLLGLATAGERMLILVDIERLMTSREMALVDEAAA"
FT   gene            complement(202147..204066)
FT                   /locus_tag="PA0178"
FT   CDS_pept        complement(202147..204066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0178"
FT                   /product="probable two-component sensor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03568"
FT                   /db_xref="GOA:Q9I6V4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6V4"
FT                   /protein_id="AAG03568.1"
FT                   /translation="MPQDMSQFLQVFFEETEEHLATLELLLIGLDLDRPDSETLHGIFR
FT                   AAHSIKGSSGMFGFDDITAVTHELETLLDRIRCGQMHLRPDMISSFLEARDVLQRLLDA
FT                   HRSGRPDPGVPLLETVERLRGWLRVPEQEAAEEGFGLFDDAPARETADDDAFGFFDEGP
FT                   GAPERAAAPEAFGLFDEAPGAPAASEAFGLFDEAPGSPPAEERAFGLFDGAPGSPAAPS
FT                   APAQAVAAPARGAVAPVRGDGESGSIRVSVEKIDSLINLVGELVITQAMLGQLGEQLDP
FT                   SRHERLQHALAQLEHNTRDLQESVMSIRMLPINFIFSRFPRLVRDTATRLGKQVELHLH
FT                   GEHTELDKSVIEKLSDPLTHIVRNSIDHGIETPAERLAAGKPASGTVKLAASHQGGSVV
FT                   VEVSDDGRGLSRPRILAKARERNLPVHDGMSDAEVWQLVFMPGFSTAETVTELSGRGVG
FT                   MDVVKRNIGAMGGRIDIDSAPGMGTRIGIRLPLTLAILDGLIVAVEAVNYVIPLTYIVE
FT                   SLQARSDDVRGLGGEDNAMIRVRGEYLPLFSLHELLRIGGEAPAPEQGIVVILESEGRS
FT                   FALQVDELVGQQQVVIKSLEQNFRRVEGIAGATIMGDGSVALILDVDALPRLAAREDTA
FT                   DERH"
FT   gene            complement(204094..204459)
FT                   /locus_tag="PA0179"
FT   CDS_pept        complement(204094..204459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0179"
FT                   /product="probable two-component response regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03569"
FT                   /db_xref="GOA:Q9I6V3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6V3"
FT                   /protein_id="AAG03569.1"
FT                   /translation="MGKPILIVDDSASIRQMLSFTLKSAGYEVDEAADGKEGLGKAQSK
FT                   SYSLVFTDQNMPNMDGLSLIRSLRNLAGYRSVPILMLTTESSDAMKQQGRSAGATGWLV
FT                   KPFDPPKLLEVTRKVLP"
FT   gene            complement(204657..205829)
FT                   /gene="cttP"
FT                   /locus_tag="PA0180"
FT   CDS_pept        complement(204657..205829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cttP"
FT                   /locus_tag="PA0180"
FT                   /product="chemotactic transducer for trichloroethylene
FT                   [positive chemotaxis], CttP"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PA0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03570"
FT                   /db_xref="GOA:Q9I6V2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6V2"
FT                   /protein_id="AAG03570.1"
FT                   /translation="MRESLGVSLPSRPLLLKLGLLSLPWALCAGLHAVGLGVWLVLALG
FT                   WFASLAMLVLLLRAPRQAVANANPQADAASPAWSAAQRALADETAQLDGHARQIDELLH
FT                   SAIRQLSDSFHGLAERIDTQRGLSHSLIERYDGRGQVDEGINFQDFVRTTQQTLSLFVE
FT                   ATLETSRTSQQLVERMDQVRLKITEILQSTQDMDAIAKQTNLLALNAAIEAARAGESGR
FT                   GFAVVADEVRALSTRSTEFSAAIRKHVDVVHHEIQDAESAISQLADKDMSFALDSKHKI
FT                   QGMLDDLEAMNRHTLKVIHELDRLSLEVGQGVDAAVTALQFQDMGSQLLGQMRKHHARL
FT                   GAFALGLGALEARPRQEWPERVAREVEELRRPLPSPVSQNSVNVGEVELF"
FT   gene            complement(206022..206954)
FT                   /locus_tag="PA0181"
FT   CDS_pept        complement(206022..206954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0181"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03571"
FT                   /db_xref="GOA:Q9I6V1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6V1"
FT                   /protein_id="AAG03571.1"
FT                   /translation="METLSNIQCFVRSAEAGSFAEAARRLGLTPAGVGKNVARLESNLG
FT                   VRLFQRSTRRLTLTEAGERFLQEVGGSLEGIQTALANVSSVGNQPSGTLKVSMGLAFGR
FT                   DYILPLLGEFLERYPDIVPDWHFDNRQVDLIGEGFDAAIGGGFELPPGVVARNLTPGHL
FT                   ILLASPTYLRDKPPIRHPGDLGGFDGIRIRSPQTGRVRSWPLRRRNGEEAPIELRERMT
FT                   MSDPEATCEVAAMGLGITLVCMQHAYAYLESGALVRVLPDWYVDAGNTSLYYAANKLLP
FT                   AKTRVFVDFVVDYFRRQDLARRFSAFPTG"
FT   gene            207071..207823
FT                   /locus_tag="PA0182"
FT   CDS_pept        207071..207823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0182"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03572"
FT                   /db_xref="GOA:Q9I6V0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6V0"
FT                   /protein_id="AAG03572.1"
FT                   /translation="MSVSSASLAGKVAFVQGGSRGIGAAIVRRLAAEGASVAFTYVSSA
FT                   DKSRALAAELEGAGASILALHADSADAAALVAAVDEAAARFGRIDILVNNAAVLALGSV
FT                   EELPLADFERTLAINVRSVFVATQAAVKHMGDGGRVISIGSTNAERMPFAGGATYAMSK
FT                   SALVGLTKGLARDLGPRGITVNNVQPGPVDTDMNPDDGDFAEALKGLMALPRYARSEEI
FT                   ASFVAYLAGPEAAYITGASLTIDGGFSA"
FT   gene            complement(207923..209533)
FT                   /gene="atsA"
FT                   /locus_tag="PA0183"
FT   CDS_pept        complement(207923..209533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsA"
FT                   /locus_tag="PA0183"
FT                   /product="arylsulfatase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03573"
FT                   /db_xref="GOA:P51691"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="PDB:1HDH"
FT                   /db_xref="PDB:4CXK"
FT                   /db_xref="PDB:4CXS"
FT                   /db_xref="PDB:4CXU"
FT                   /db_xref="PDB:4CYR"
FT                   /db_xref="PDB:4CYS"
FT                   /db_xref="PDB:5AJ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51691"
FT                   /protein_id="AAG03573.1"
FT                   /translation="MSKRPNFLVIVADDLGFSDIGAFGGEIATPNLDALAIAGLRLTDF
FT                   HTASTCSPTRSMLLTGTDHHIAGIGTMAEALTPELEGKPGYEGHLNERVVALPELLREA
FT                   GYQTLMAGKWHLGLKPEQTPHARGFERSFSLLPGAANHYGFEPPYDESTPRILKGTPAL
FT                   YVEDERYLDTLPEGFYSSDAFGDKLLQYLKERDQSRPFFAYLPFSAPHWPLQAPREIVE
FT                   KYRGRYDAGPEALRQERLARLKELGLVEADVEAHPVLALTREWEALEDEERAKSARAME
FT                   VYAAMVERMDWNIGRVVDYLRRQGELDNTFVLFMSDNGAEGALLEAFPKFGPDLLGFLD
FT                   RHYDNSLENIGRANSYVWYGPRWAQAATAPSRLYKAFTTQGGIRVPALVRYPRLSRQGA
FT                   ISHAFATVMDVTPTLLDLAGVRHPGKRWRGREIAEPRGRSWLGWLSGETEAAHDENTVT
FT                   GWELFGMRAIRQGDWKAVYLPAPVGPATWQLYDLARDPGEIHDLADSQPGKLAELIEHW
FT                   KRYVSETGVVEGASPFLVR"
FT   gene            complement(209621..210460)
FT                   /locus_tag="PA0184"
FT   CDS_pept        complement(209621..210460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0184"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03574"
FT                   /db_xref="GOA:Q9I6U9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U9"
FT                   /protein_id="AAG03574.1"
FT                   /translation="MNAFTAPATGTPLVSFRQVRKHFAVDGRRLEAIQQFDLEIGEGEF
FT                   IAIVGASGCGKSTLLRLLIGLDRDYDGEIRVDGRPIAGIGGERGIVFQEHRLFPWLTVQ
FT                   QNVALGLVNEALGETDKAARIDEYIRLVGLHGFERAYPHQLSGGMAQRVAIARGLVASP
FT                   RLLLLDEPFSALDALTRQQLQEELLAIRRRTRITTLLVTHDVEEALYLADRVVVMEPRP
FT                   GRIRRVVEVGLAHPRERGGFDFLRQREALLHELTADGEYVAPPPRRVENLPFEFIAC"
FT   gene            complement(210457..212073)
FT                   /locus_tag="PA0185"
FT   CDS_pept        complement(210457..212073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0185"
FT                   /product="probable permease of ABC transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03575"
FT                   /db_xref="GOA:Q9I6U8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U8"
FT                   /protein_id="AAG03575.1"
FT                   /translation="MKNIDKTLSPAWSRPLPRLAPPPSAAFARRLGDGLLPWLLPLGLA
FT                   LLWWVASHRHWMSAQVLPTPELVWQSARELLAGELWSELAISLRRLAWGLLAGVASGAA
FT                   LGAWLGFSPRAERLVFPTFSALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVVVPVTI
FT                   HTLVGVRDAQPKLREAAAVLRLPPRLLVWRLILPAALPAFLTGLRLALAQGWTSLLAVE
FT                   LLASSEGIGYLMVQGRQLFMLDIVFVCILIIGLVGVGMDRAIQWLDRRLLHWPQAATGE
FT                   FRRRPPGRGWQRLQVWLPPLALLLLWQSASSAEWVDPAILASPLEVARATWSGALDGSL
FT                   PGALFDSLKRTLGGLLLGGGLGFLGGLLLGLWRPAERFFGPTFAALRQVAIFAWVPLLT
FT                   AWFGLGEPAKLTFVAIAAFFPLLLATQRGIASLPPSLGEAARVLRLGPWRRLLRLVLPG
FT                   AAPSVFAGLRLALIYAWLGTIGAEYFMPSDGGIGSLMIGAQQLFRMDLIGAGMLLVGLT
FT                   GALLNALGQRIEARATRWRHA"
FT   gene            212340..213401
FT                   /locus_tag="PA0186"
FT   CDS_pept        212340..213401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0186"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03576"
FT                   /db_xref="GOA:G3XD96"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:G3XD96"
FT                   /protein_id="AAG03576.1"
FT                   /translation="MKALTSSLLGLFAAPVLAGLLGAYVPLASAAPPKEIRIAVPDVSA
FT                   GSSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLGDL
FT                   AAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLSFDN
FT                   ALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLSTRDLN
FT                   GAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQASYPVV
FT                   ILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRREFSAEQWAAPELLEAAG
FT                   KLAKAKAVAQAAE"
FT   gene            213819..214634
FT                   /locus_tag="PA0187"
FT   CDS_pept        213819..214634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0187"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03577"
FT                   /db_xref="GOA:Q9I6U7"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U7"
FT                   /protein_id="AAG03577.1"
FT                   /translation="MNLDSKLFDATLDLERVKVSVRTLVKLSRQEQSAIIRTLNEFGFL
FT                   LLRSEHGEDRQELLALKELFGRAAPHPRADADGIVPISNARYVSGYLGSTPLEHKLHTD
FT                   GAFLDTPEQLCSLQCVRNAREGGETLLASAGLAFERLRRRMPTKHLGLLRGDALTIVRK
FT                   HQSSTQPVFRLNGEALGIKFRQNDGAAEVVEHPVAVEAFAELVAALEDPACQLRIKLEP
FT                   GEILVLDNTAVLHGRTAFCANELREMRRLNFDGHGRLRAELELGFKVGL"
FT   gene            214631..215512
FT                   /locus_tag="PA0188"
FT   CDS_pept        214631..215512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0188"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03578"
FT                   /db_xref="GOA:Q9I6U6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U6"
FT                   /protein_id="AAG03578.1"
FT                   /translation="MIAQFVAVVLPILICTGIGFAWSRSAGPVDTRALVFLVANVGFPC
FT                   LLLSSLDRPGLSIGMVAGVFLATALAVLAFALLGLVALRLLRMPVRRYLPSIMLPNSGN
FT                   MGIPIAYLAFGEEALVYAVAFSTLIQVGHATLGVWFASGDITPASILRNPMIYALAVAL
FT                   GLIALGWSLPPPLRDVTRLLGGITVPLMLVMLGLSLAGLRLHETWRPLLLSLVRVWGGF
FT                   AVGYGIAAGLGMAAVAAGTFAIQCGMPTAVLTYLLAKRYDGPVNEVAGMVLITTLLVLL
FT                   STPLFIQLLPRA"
FT   gene            complement(215550..216908)
FT                   /locus_tag="PA0189"
FT   CDS_pept        complement(215550..216908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0189"
FT                   /product="probable porin"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03579"
FT                   /db_xref="GOA:Q9I6U5"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U5"
FT                   /protein_id="AAG03579.1"
FT                   /translation="MQNLRRAVFAGLVAGTLSEGAAATAGDGGFVEDSELQFLARTYYF
FT                   NRDYRDSPNNAGRNRFKPRSERNGYREEATQGLRLQFASGYTPGSLGFGLDAHAMLGLQ
FT                   LDSGGGRTGTGNLPVGADGHPDHRYGKVGGALRLRHGETRLKYGQTTTSAPVFAASSNR
FT                   TLAGMAYGLLLEDRSFDGLLLEGGRFTAASGPGESKVRGDISTVYGRLGAYPVRLDAVG
FT                   FLGGQWQATERLQLSLYASRFDDIWQQAYFGASHRQPLGGERALRVDLDAYRTRDSGQS
FT                   RFGRIDTLTSSLALGYEHGPQRITLAYQRVHGEQPFDYMAFGDGRSSASMVLANSVGYS
FT                   DFNGPGERSWQLRYDLDLGALGLPGLSLHALHARGRAGASASSAAESIYAGLYGRDGRH
FT                   RENDLGFAYRVKAGPLAGLALRASQAWHRGNASYLDGDIDETRLVVDYSRSIW"
FT   gene            217156..217881
FT                   /locus_tag="PA0190"
FT   CDS_pept        217156..217881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0190"
FT                   /product="probable acid phosphatase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03580"
FT                   /db_xref="GOA:Q9I6U4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U4"
FT                   /protein_id="AAG03580.1"
FT                   /translation="MNNKTLCPSLLLCLSLLAPLSCLGETAAAPYPLAHPPRLADYLPP
FT                   PPAADSAAAVADLGAVLEAQRLRTPEQVRRVRAHDQWEDNVFPFAGDLLGASFDKERLP
FT                   LTRSFFNRAQENLVEVLMPAKKHFARPRPYEVTPKVKPVLPPPEGESYPSGHTMDSYFK
FT                   ASLLSMLVPEHHDAFFARAEEHAQSRVLAGVHFPSDLEGGQTAAAALVASLLADPAVAA
FT                   DFAAVREELRGALGLPKLQ"
FT   gene            complement(217905..218822)
FT                   /locus_tag="PA0191"
FT   CDS_pept        complement(217905..218822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0191"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03581"
FT                   /db_xref="GOA:Q9I6U3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U3"
FT                   /protein_id="AAG03581.1"
FT                   /translation="MDLRQLRYFIALAEHRSFVRAADAMGITQPAFSRSIQGLEQELGC
FT                   QLVDRGSKDLRPTPEGQVVLQHALSLVQGSANLIHEIAQLNKLDAGELRFGSGPAPAQQ
FT                   LVPDAVADFINRHPRVQISLDVDNWEKLSRALLREEIEFFVADIRDFEADPNFQTRPLT
FT                   PRRGQFFCRPQHPLLGKDSLSTNDLFNYPLASTLIPPGIRKLLANLSGKIDFAANIRCE
FT                   NMHALIRIVRQTDAIGIASDETLRPYLQRGELQPLQWRNLPQNLDSLSARCGIISRSGY
FT                   RLSAAAKAMIETLVELDQAQHAAA"
FT   gene            219172..221544
FT                   /locus_tag="PA0192"
FT   CDS_pept        219172..221544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0192"
FT                   /product="probable TonB-dependent receptor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03582"
FT                   /db_xref="GOA:Q9I6U2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U2"
FT                   /protein_id="AAG03582.1"
FT                   /translation="MKHHYRLPLRRTPPGGSDYALALLLALGGALPASAADAPAPAEEA
FT                   PPLAGSAPAKADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQVL
FT                   PSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIEQLE
FT                   LLRGPQGTLFGKNTTAGVLNISTRAPTFTAERTVEVSGGQDGYFQGRGTVSGPLGETLA
FT                   GRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEEDSSNG
FT                   SMVVYGGAERFWQRAALVGASPLRDPQRRKVNINGRQHVSVHQGGSSLEANWNLAGGYR
FT                   LTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFDYVVGAYA
FT                   FRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQGTWHLTERL
FT                   DFTAGLRGTYEEKNAKVERFAPLGGAAVGGVGAAVRNGQLGAYDSGDLSQYNFAPSALL
FT                   SLSYQFSDDLLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERANDAELGLKSTLF
FT                   DRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLEFEATALPLRGL
FT                   TLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLTGQRVVGASKWIANLNGEYQWR
FT                   LDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSDLGDGQLDTSVWLK
FT                   NAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
FT   gene            221585..222487
FT                   /locus_tag="PA0193"
FT   CDS_pept        221585..222487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0193"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03583"
FT                   /db_xref="GOA:Q9I6U1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U1"
FT                   /protein_id="AAG03583.1"
FT                   /translation="MSNAAQALATPVRLDIRPVAGRIGAEIRGVTLSGELDAATVEAIQ
FT                   AALVRHKVIFFRDQSHLDDQTQEAFAHLLGEPVAHPTVPSREGTRFLLELDGAEGRRAN
FT                   SWHTDVTFVEAYPKASILRSVVAPESGGDTVWANTASAYADLPAELRELADRLWAVHSN
FT                   EYDYAGVKPSASVEQLENYRKVFTSTVYETEHPVVRVHPQSGERTLLLGHFVKRLKGLS
FT                   QHDSAHLFAVLQGHVTRLENTVRWRWQAGDVAIWDNRATQHYAIDDYGDQPRVVRRVTL
FT                   GGDVPVGIDGQRSRTIRKA"
FT   gene            222555..223454
FT                   /locus_tag="PA0194"
FT   CDS_pept        222555..223454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0194"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03584"
FT                   /db_xref="GOA:Q9I6U0"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6U0"
FT                   /protein_id="AAG03584.1"
FT                   /translation="MSQSATARQPEPEVAEAFRITPLEAPLGAEVRGLDARRPLAPEQV
FT                   LALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPDIVKV
FT                   ANTGDGELGNFALPAHIDHQWTPVPSSGSFLYALEVPSSGGETRFTNLARAYESLDEAT
FT                   RREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRRVLFL
FT                   SAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHARNAFP
FT                   ASERRRLKRISLAGSRPF"
FT   gene            224101..225219
FT                   /gene="pntAA"
FT                   /locus_tag="PA0195"
FT   CDS_pept        224101..225219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAA"
FT                   /locus_tag="PA0195"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 1"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG56537"
FT                   /db_xref="GOA:Q14T74"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q14T74"
FT                   /protein_id="ABG56537.1"
FT                   /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVSASQ
FT                   PDSAYEAAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIARM
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATVAEMKP
FT                   GSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNILDFLKL
FT                   TLNAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
FT   gene            225295..225603
FT                   /gene="pntAB"
FT                   /locus_tag="PA0195.1"
FT   CDS_pept        225295..225603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAB"
FT                   /locus_tag="PA0195.1"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 2"
FT                   /db_xref="EnsemblGenomes-Gn:PA0195.1"
FT                   /db_xref="EnsemblGenomes-Tr:ABG56539"
FT                   /db_xref="GOA:Q14T73"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q14T73"
FT                   /protein_id="ABG56539.1"
FT                   /translation="MDIISDGIYNLIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAGGH"
FT   gene            225603..227039
FT                   /gene="pntB"
FT                   /locus_tag="PA0196"
FT   CDS_pept        225603..227039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="PA0196"
FT                   /product="pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03585"
FT                   /db_xref="GOA:Q9I6T9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T9"
FT                   /protein_id="AAG03585.1"
FT                   /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIAV
FT                   ATTVGLVFKLGAEIATTGVGYIVVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLGIVAHLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVILGGFGAEADAGGPAGSKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAVARAQHA
FT                   LMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINSEFGQTDV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
FT   gene            227382..228194
FT                   /gene="tonB2"
FT                   /locus_tag="PA0197"
FT   CDS_pept        227382..228194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB2"
FT                   /locus_tag="PA0197"
FT                   /product="TonB2"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PA0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03586"
FT                   /db_xref="GOA:Q9RMT3"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RMT3"
FT                   /protein_id="AAG03586.1"
FT                   /translation="MATPQPVDARTQPWRETPGGDLVALGRPVRQALHLVRHNPAQGRV
FT                   LSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPPPP
FT                   EPLPPVVEEPPPPVVDENAVKPPPPKPVPKPKPKPKPQPRPKPAPKAVEPAPPAPPQPA
FT                   APPAPPAPAAAPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSE
FT                   IQVQKSSGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVSVPIDFKLN"
FT   gene            228223..228942
FT                   /gene="exbB1"
FT                   /locus_tag="PA0198"
FT   CDS_pept        228223..228942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /locus_tag="PA0198"
FT                   /product="transport protein ExbB"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03587"
FT                   /db_xref="GOA:G3XCW0"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:G3XCW0"
FT                   /protein_id="AAG03587.1"
FT                   /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQDR
FT                   QFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRLER
FT                   ALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAG
FT                   PIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRVIVHP
FT                   SAARQAGNPSRNVKEAS"
FT   gene            228944..229345
FT                   /gene="exbD1"
FT                   /locus_tag="PA0199"
FT   CDS_pept        228944..229345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="PA0199"
FT                   /product="transport protein ExbD"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03588"
FT                   /db_xref="GOA:Q9RMT1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RMT1"
FT                   /protein_id="AAG03588.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNSIPIN
FT                   LPKTESVAPPEQKDPLVVSIDGAGKLFVNKDEIQPELLESNLAAAKAKDAEVRVQLQAD
FT                   EGVNYGQVAKAMASIERAGITRLAVITAR"
FT   gene            complement(229526..229738)
FT                   /locus_tag="PA0200"
FT   CDS_pept        complement(229526..229738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0200"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03589"
FT                   /db_xref="InterPro:IPR021430"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T8"
FT                   /protein_id="AAG03589.1"
FT                   /translation="MAKKFPLHPSHPERICWGCDRYCSAESMGCGNGASRTQHPSELFG
FT                   EDWAGEWEVEGTEDAKEQEAPARQA"
FT   gene            229954..230535
FT                   /locus_tag="PA0201"
FT   CDS_pept        229954..230535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0201"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03590"
FT                   /db_xref="GOA:Q9I6T7"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T7"
FT                   /protein_id="AAG03590.1"
FT                   /translation="MHSERVRYVLVPGWYGSEDAHWQSHWQRALPNASRVEQQDWITPL
FT                   RADWIAELDAEIRRQPGPVVLIAHSLGCVTVALWAAQAERRVRDQVRGALLVAPADVER
FT                   ESCAEALRNFAPISREPLPFPSVLVGSDNDQACSPQRAMHLARAWGAETVILPEAGHIN
FT                   VKSGHGAWEAGYRHLFRLQYLIDSQARRRA"
FT   gene            complement(230543..232000)
FT                   /locus_tag="PA0202"
FT   CDS_pept        complement(230543..232000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0202"
FT                   /product="probable amidase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03591"
FT                   /db_xref="GOA:Q9I6T6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T6"
FT                   /protein_id="AAG03591.1"
FT                   /translation="MKPNPPINELVLLQAHQLAERIRLRQVSCREVMQAYLAHIERFNP
FT                   RVNALVSLLPAERLLEEADARDGELARGEWRGWMHGLPHAIKDLSLTRGIRTTLGSPLY
FT                   RDYIPERDGIMVERIRAAGAILIGKTNTPEFGLGSQTYNPLFGATACAYDERLSAGGSS
FT                   GGAAAALALHLVPVADGSDMMGSLRNPAAFNNVIGFRPSQGRVPFDDSADLFFDQLGYE
FT                   GPMGRSVRDTALLLSVQAGADRRAPLSIAEPGARFAAPLERDFEGTRLGWLGDLDGYLP
FT                   MQDGILQMCQRALGDFRSLGCEIEEANLGFAPERLWECWRTLRHWLVAGSLGGVHADPA
FT                   KRALLKPEALWEVENGLRLGADAVFRASVIRSDWYRAIGRLFERYDYLLLPSAQVFPFA
FT                   KETPWPRSIEGVAMDTYHRWMEVVVPGSLSGCPVANVQAGFNAEGLPMGLQIIGPHQAD
FT                   FAVLQLAHAYERASRWFERQPSPLLAN"
FT   gene            complement(232066..233100)
FT                   /locus_tag="PA0203"
FT   CDS_pept        complement(232066..233100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0203"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03592"
FT                   /db_xref="GOA:Q9I6T5"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T5"
FT                   /protein_id="AAG03592.1"
FT                   /translation="MHQRIASIGLGLTLALGGSAQAAGQLNVVSWSGYFSPQLLEKFEK
FT                   ESGIRVTVDSYDSNETLLAKLKQGGAGYDVAIPSQQFVPILVKEALLERFDPAAEPYYA
FT                   NLLDNLKKPAWDPEGAYSVPFIWGTTSVVLDGARYAGPADSYAVLYQPPEELRGRINMF
FT                   DSVSEVVDMASLYLGIPLCSADPKQMQRVLELLKAQKPFVKTYSSKAGSIRENLAAGEV
FT                   DMSMFWGGSSMRARELKPSLKYLYPKEGVLAWVDNLVIPRGSRNPDNARRFIAFLAQPE
FT                   NAALTQNFLKHQSPVKGVEPYLDASLKDAPELHVPAGTRVVFSQTCGEDAIRLADRLWT
FT                   NLMR"
FT   gene            complement(233123..233932)
FT                   /locus_tag="PA0204"
FT   CDS_pept        complement(233123..233932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0204"
FT                   /product="probable permease of ABC transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03593"
FT                   /db_xref="GOA:Q9I6T4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T4"
FT                   /protein_id="AAG03593.1"
FT                   /translation="MIARLWKGSRHNVQDFPGFGAFSLLFYLYLYAPILVLVVYSFNAN
FT                   QSATVWTGFSLDWYRAAFANQALRQAAGNSLLIAVCASAAATAIATLAALGTSRGAKFR
FT                   GLRLSMGAIMLPLVLPEIVVGVATLALFSTVGLSLGYGNLIIAHTVFCIPFAYLPIRAR
FT                   LDDMDLSLEQAAADLYAGPWRTLRKVTLPLLAPGIFSGLMLAFIVSLDNFVISMMVSQA
FT                   GTTTLPIFIFGLLRMGVTPDVNAVSTLILGVSVIFVSLSYLLGKPRA"
FT   gene            complement(233929..234849)
FT                   /locus_tag="PA0205"
FT   CDS_pept        complement(233929..234849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0205"
FT                   /product="probable permease of ABC transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03594"
FT                   /db_xref="GOA:Q9I6T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T3"
FT                   /protein_id="AAG03594.1"
FT                   /translation="MHPIPSPGAALQRRQALRSFLGVTPALVAIGLFLVLPILIVAAYS
FT                   LMEANPYGGVDRAFSGEAYVSLLFERQMDDSLAFADSYLTIALRSLGIAALTTLITLSL
FT                   GFPVAVWLAMQPPRRRGLLIFLITVPFWANLLIRTYAWILLLRGSGVINNGLLGLGLVD
FT                   HPLPLLYSDGAVLLGLVYTYAPFVVLPIYATLEKMDMRLLEAAQDLYAGRLRTLRKVVL
FT                   PTARPGILAGAILTFVPCLGAMIAPELLGGGTRMMLGNLIFRQFADARNWPFGAALSLV
FT                   LMAAVMLILTVYAWRAERLARGMGR"
FT   gene            complement(234875..235987)
FT                   /locus_tag="PA0206"
FT   CDS_pept        complement(234875..235987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0206"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03595"
FT                   /db_xref="GOA:Q9I6T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6T2"
FT                   /protein_id="AAG03595.1"
FT                   /translation="MSALHSLRTHAVSIRAVRKVYGDPESGPVALKRVDLDIRDNEFFT
FT                   LLGPSGCGKTTLLRMIAGFEFPTEGEILLYGENIAARPPFERPVNTVFQHYALFPHMSI
FT                   AENLAFGLESRPLGRSLGKAEIAERVREMLALVQMERFADRRPGQLSGGQQQRVALARA
FT                   LAPQPRVLLLDEPLSALDLKLRQAMREELKAIQAKTGITFIFVTHDQEEALTMSDRIAV
FT                   LSEGQVQQVGPPEEIYERPGNRFVADFIGETNFIEAELLQRDGPLALYRGPGGEAFEAA
FT                   ARDGLAAGARVCLSIRPERLDLLAANTGGGLPCTVESQVYLGTDLQYRVRLADGSLLTV
FT                   RTPNGTARRFATGEAACLAVAKDSASVLLD"
FT   gene            236218..237111
FT                   /locus_tag="PA0207"
FT   CDS_pept        236218..237111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0207"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03596"
FT                   /db_xref="GOA:Q9I6T1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T1"
FT                   /protein_id="AAG03596.1"
FT                   /translation="MSIPRLPPLNAVRAFEAAARLGSYVAAAKALHVTQPAVGRHVRLL
FT                   EDWLGARLFERTSRGVLLTPAGRQYYAAVSTALQQIAEAGGQLSGARWLRIMAVPAFSR
FT                   RWLTSRLETLCAQRPGLKIALEPNPTFDHVEERSADLGIVYGLPGQYANPRALLIRPKV
FT                   FPVCSPAYLAAAGPLESAEQLVAHKLIHVDDGEWWNLWFSAIGVDVEVRPAVLYLSNDH
FT                   ALARAEEGLGIALANEVLVRQELRSGALVRPLAAEAALECYQVLTPPGTPSADVEWFIG
FT                   WLGEALREEFPDAVTS"
FT   gene            237232..238896
FT                   /gene="mdcA"
FT                   /locus_tag="PA0208"
FT   CDS_pept        237232..238896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="PA0208"
FT                   /product="malonate decarboxylase alpha subunit"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03597"
FT                   /db_xref="GOA:Q9I6T0"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="PDB:5VIT"
FT                   /db_xref="PDB:5VJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6T0"
FT                   /protein_id="AAG03597.1"
FT                   /translation="MTTPISPPPQWSRRRQEKQRRLERVRGLADGAVLPREGLVAALEA
FT                   LIAPGDRVVLEGNNQKQADFLSRSLARVDPGKLHDLHMIMPSVGRPEHLDLFELGIARK
FT                   LDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLVVDLIPNVALVAGFVADREGNV
FT                   YTGPSTEDTPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRDGSLRSN
FT                   RMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHSTPAW
FT                   LDMRGEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLAPVMIYGDD
FT                   VTHVLTEEGIAYLYKARSLEERQAMIAAVAGISPIGLRHDPRETQRMRREGLIALPEDL
FT                   GIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
FT   gene            238896..239777
FT                   /locus_tag="PA0209"
FT   CDS_pept        238896..239777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03598"
FT                   /db_xref="GOA:Q9I6S9"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6S9"
FT                   /protein_id="AAG03598.1"
FT                   /translation="MNAIANLAATPGADLGECLADLAVDALIDEAELSPKPALVDRRGN
FT                   GAHADLHLGLMQASALSLWPCFKEMADAAQRHGRIDARLRGVLGQLGRDGEAAMLRTTE
FT                   GVNTHRGAIWALGLLVAAAALEPRRTQAGEVAARAGRIALLDDPAAAIGDSHGERVRRR
FT                   YGVGGAREEARLCFPRAVRHGLPQLWRSREGGAGEQNARLDALLAIMSVLDDTCVLHRA
FT                   GRVGLAAMQDGARAVLAAGGSASLAGRRRLCELDRRLLALNASPGGAADLLAACLFLDR
FT                   LPAVSGGWAGSL"
FT   gene            239779..240078
FT                   /gene="mdcC"
FT                   /locus_tag="PA0210"
FT   CDS_pept        239779..240078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="PA0210"
FT                   /product="malonate decarboxylase delta subunit"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03599"
FT                   /db_xref="GOA:Q9I6S8"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6S8"
FT                   /protein_id="AAG03599.1"
FT                   /translation="METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIQVV
FT                   TSVNGSGPRWQQLFARVFAASTAPAASIRIHDFGATPGVVRLRLEQALEEAGHD"
FT   gene            240071..240934
FT                   /gene="mdcD"
FT                   /locus_tag="PA0211"
FT   CDS_pept        240071..240934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="PA0211"
FT                   /product="malonate decarboxylase beta subunit"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03600"
FT                   /db_xref="GOA:Q9I6S7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="PDB:5VIP"
FT                   /db_xref="PDB:5VIT"
FT                   /db_xref="PDB:5VJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6S7"
FT                   /protein_id="AAG03600.1"
FT                   /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSPW
FT                   LERQGIVPQADDGVVVARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAEDN
FT                   RNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCFGGM
FT                   SIAAGLCSYVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFASGLAD
FT                   AYLADDLDEVRTSVLAYFAKGLPARPRCRRAEDYLRRLGDLDTAEQPDAAGVRRLYQGL
FT                   GQGDAT"
FT   gene            240931..241737
FT                   /gene="mdcE"
FT                   /locus_tag="PA0212"
FT   CDS_pept        240931..241737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="PA0212"
FT                   /product="malonate decarboxylase gamma subunit"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03601"
FT                   /db_xref="GOA:Q9I6S6"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:5VIP"
FT                   /db_xref="PDB:5VIT"
FT                   /db_xref="PDB:5VJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6S6"
FT                   /protein_id="AAG03601.1"
FT                   /translation="MSQPFASRGLAWFQALAGSLAPRPGDPASLRVADAELDGYPVRFL
FT                   AVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGR
FT                   REEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHDPGV
FT                   MVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTA
FT                   DLVRVRTCLGEALADILGGPRDLGGRLGAANREASARVRRLLREQW"
FT   gene            241753..242445
FT                   /locus_tag="PA0213"
FT   CDS_pept        241753..242445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0213"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03602"
FT                   /db_xref="GOA:Q9I6S5"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6S5"
FT                   /protein_id="AAG03602.1"
FT                   /translation="MVIANSSQRGSSRRRLAPDPMRRRAGPEPHDLLLGMAPAHLPENA
FT                   PAWVCAALKAGWPVVVRRAPADPARVAIGVRGLAREQRWAGWMPLAAITRRLRPEALGQ
FT                   REPAMLRDLPAWRALRDLRAPLNALGLAWGVTGGAGFELASGVAVLHPDSDLDLLLRTP
FT                   RPFPRDDALRLLQCFEQCPCRIDLQLQTPAGGVALREWAEGRPRVLAKGSEAPLLLEDP
FT                   WRIAEVEA"
FT   gene            242442..243374
FT                   /locus_tag="PA0214"
FT   CDS_pept        242442..243374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0214"
FT                   /product="probable acyl transferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03603"
FT                   /db_xref="GOA:Q9I6S4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6S4"
FT                   /protein_id="AAG03603.1"
FT                   /translation="MSVLFAYPGQGAQRPGMLAALPDEPPVRACLEQAADCLGQAPAEL
FT                   ESAEALRGTRAVQLCLLIAGVAASRLLETRGHRPGLVAGLSIGAYPAAVVAGALDFDDA
FT                   LRLVALRGELMQAAWPEGYGMSAILGLEQAQLEALILAVRREHPPLYLANVNAERQLVV
FT                   AGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAGIRLHRPRVPY
FT                   LSSSRARLVAEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARP
FT                   LFGCATPAFEGSRADTLDALLREEEKRTR"
FT   gene            243431..243835
FT                   /locus_tag="PA0215"
FT   CDS_pept        243431..243835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0215"
FT                   /product="malonate transporter MadL"
FT                   /note="Class 2: Function of highly similar gene
FT                   experimentally demonstrated in another organism (and gene
FT                   context consistent in terms of pathways its involved in (if
FT                   known)."
FT                   /db_xref="EnsemblGenomes-Gn:PA0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03604"
FT                   /db_xref="GOA:Q9I6S3"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6S3"
FT                   /protein_id="AAG03604.1"
FT                   /translation="MIIYGVALLSLCTLAGLFIGEILGVLLGVPANVGGVGIAMLLLIF
FT                   VGSYLGKRGLLSAKTEQGVEFWSAVYIPIVVAMAAQQNVLGALSGGPAAILAGIAAVAV
FT                   AFALVPLLDRFGRKKAEGARPLKPRTSVQG"
FT   gene            243841..244605
FT                   /locus_tag="PA0216"
FT   CDS_pept        243841..244605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0216"
FT                   /product="malonate transporter MadM"
FT                   /note="Class 2: Function of highly similar gene
FT                   experimentally demonstrated in another organism (and gene
FT                   context consistent in terms of pathways its involved in (if
FT                   known)."
FT                   /db_xref="EnsemblGenomes-Gn:PA0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03605"
FT                   /db_xref="GOA:Q9I6S2"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6S2"
FT                   /protein_id="AAG03605.1"
FT                   /translation="MFESLNKVINGYGLISGFAIIGVTMAVSYWLSARLTRGRLHGSAI
FT                   AIFLGLVLSYVGGVATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELRRA
FT                   GVSGVVSLFLGVGSSFVAGVAVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGASSE
FT                   VMALSIAAGLVKAILVMVLTPFVAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAATDPKL
FT                   VPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
FT   gene            complement(244690..245619)
FT                   /locus_tag="PA0217"
FT   CDS_pept        complement(244690..245619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0217"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03606"
FT                   /db_xref="GOA:Q9I6S1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6S1"
FT                   /protein_id="AAG03606.1"
FT                   /translation="MLIDEEITLKKLETFLAFMRTGNLARAAAELGTSNVSVHRAIHSL
FT                   ESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQEVLDTVRLTREAAGFSAERFKLGAL
FT                   YSLTVKTVPQLIMGLKLRRSALNIDLILGSNVDLFYQLKNMELDAILVSLNDSVSDPDC
FT                   EHLPLFSDDIFLAVPVDSPYARLAEIDLSTLRDTPFVTLTQGFATHQDGTRVFQQAGFE
FT                   PQIAMQVNDIFTLLSMVSSGVGHALLPKRIEAVYENRVRLIPLQPRYRLQQHIGVVFLK
FT                   AKERDPNLLALLAECRMYSLRLEQEAAG"
FT   gene            complement(245948..246868)
FT                   /locus_tag="PA0218"
FT   CDS_pept        complement(245948..246868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0218"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03607"
FT                   /db_xref="GOA:Q9I6S0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:3FZV"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6S0"
FT                   /protein_id="AAG03607.1"
FT                   /translation="MASYTLRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEES
FT                   FGVQLFIRHHAQGVSLTPAGARFYRKAQELLRMAHEFEQNALADNDVIAGQIDIGCFET
FT                   VAPLYLPGLIAGFRQAYPGVEIRIRDGEQQELVQGLTSGRFDLAFLYEHDLDSTIETEP
FT                   LMPPQRPHALLPEGHRFAGQAQVSLRDLCLEPMILLDVQPSRTYFVSLFEELGLTPNIA
FT                   FSSPSIEMVRGMVGQGFGFSLLVTRPHSECTYDGKKVVMVDLAEPVSTSGLAAAWLKRA
FT                   QLTKPARLFVDYCREQLGKLAERRH"
FT   gene            247219..248709
FT                   /locus_tag="PA0219"
FT   CDS_pept        247219..248709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0219"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03608"
FT                   /db_xref="GOA:Q9I6R9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R9"
FT                   /protein_id="AAG03608.1"
FT                   /translation="MFELSDWQRRAATQRFIDQALIGGRQRPAASGATFDAIDPASNRL
FT                   LARVAACDAADVDAAVAAARRAFDEGPWARLAPVERKRVLLRLAELMLAHREELALLDS
FT                   LNMGKPVMDAWNIDVPGAAHVFAWYAESLDKLYDQVAPTAQQTLATITRVPLGVIGAVV
FT                   PWNFPLDMAAWKLAPALAAGNSVVLKPAEQSPFSALRLAELALEAGVPEGVLNVVPGLG
FT                   EQAGKALGLHPEVDALVFTGSTEVGKYFMQYSAQSNLKQVWLECGGKSPNLVFADCRDL
FT                   DLAAEKAAFGIFFNQGEVCSANSRLLVERSIHDEFVERLLAKARDWQPGDPLDPASRAG
FT                   AIVDRRQTAGILAAIERAQGEGATLLGGGRQLTINGSDNFIEPTLFGDVRPDMQLAREE
FT                   IFGPVLAISAFDSEDEAIRLANDSRYGLAASLWSDDLHRAHRVARRLNAGTVSVNTVDA
FT                   LDVAVPFGGGKQSGFGRDLSLHSFDKYTQLKTTWFQLR"
FT   gene            248767..250200
FT                   /locus_tag="PA0220"
FT   CDS_pept        248767..250200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0220"
FT                   /product="amino acid APC family transporter"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa."
FT                   /db_xref="EnsemblGenomes-Gn:PA0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03609"
FT                   /db_xref="GOA:Q9I6R8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R8"
FT                   /protein_id="AAG03609.1"
FT                   /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGTA
FT                   GLGFIVPLGVAYLLALSYAFSFSELALMIPRAGSLSSYTEVAIGHFPAILATFSGYVVV
FT                   AMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALALLM
FT                   MIVLLVLGLGAVSSDHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLVEETR
FT                   RPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGEYGQLF
FT                   LVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFKQLSRRARTPWVAVLFVAAITG
FT                   LPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTPFYPLPQL
FT                   FGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLFVPEPLETA
FT                   GETAQGKSVALDPLQSPSA"
FT   gene            250231..251613
FT                   /locus_tag="PA0221"
FT   CDS_pept        250231..251613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0221"
FT                   /product="probable aminotransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03610"
FT                   /db_xref="GOA:Q9I6R7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R7"
FT                   /protein_id="AAG03610.1"
FT                   /translation="MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGDG
FT                   LQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAASRQLEQLPYYNMFFHTTHPAVVELS
FT                   EMLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGSTLG
FT                   STALGGMKFMHEMGGMLPDFAHIDEPYWYANGGELSPAEFGRRAALQLEEKILELGAEN
FT                   VAAFVAEPFQGAGGMIFPPQSYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHFG
FT                   FQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGVFAHGLTYSGHPVAAAVAIANL
FT                   KALRDEGVVTRVREETGPYLQRCLREVFGDHPLVGEVQGAGFVAALQFAEDKVTRKRFA
FT                   NENDLAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAVDRTAREIG
FT                   VL"
FT   gene            251777..252835
FT                   /locus_tag="PA0222"
FT   CDS_pept        251777..252835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0222"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03611"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R6"
FT                   /protein_id="AAG03611.1"
FT                   /translation="MFKSLHQYAHVFSRLSLFGLAFAAAAQAQSQSLTVISFGGATKAA
FT                   QEQAYFKPFERSGGGQVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEGLF
FT                   ERLDPARFGDPAQFVPGTFSECGVATYVWSMVMAYDSTKLARAPQSWADFWNVREFPGK
FT                   RGLRKGAKYTLEVALLADGVKAEDLYKVLATPEGVSRAFAKLDQLKPNIQWWEAGAQPP
FT                   QWLAAGDVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALAEKFIA
FT                   FASQPQTQKVFSEQIPYGPVHKGTLALLPKTVQEALPTAPANLEGARAVDAEFWVDHGE
FT                   ELEQRFNAWAAR"
FT   gene            complement(252913..253794)
FT                   /locus_tag="PA0223"
FT   CDS_pept        complement(252913..253794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0223"
FT                   /product="probable dihydrodipicolinate synthetase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03612"
FT                   /db_xref="GOA:Q9I6R5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:3NA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R5"
FT                   /protein_id="AAG03612.1"
FT                   /translation="MSASIHGIIGYTITPFAADGGLDLPALGRSIERLIDGGVHAIAPL
FT                   GSTGEGAYLSDPEWDEVVDFTLKTVAHRVPTIVSVSDLTTAKTVRRAQFAESLGAEAVM
FT                   VLPISYWKLNEAEVFQHYRAVGEAIGVPVMLYNNPGTSGIDMSVELILRIVREVDNVTM
FT                   VKESTGDIQRMHKLRLLGEGRVPFYNGCNPLALEAFVAGAKGWCSAAPNLIPTLNGQLY
FT                   QAVLDGDLEKARALFYRQLPLLDFILRRGLPTTIKAGLGLSGLEVGAPRLPVQALDTEG
FT                   CRYLQGLLEELR"
FT   gene            complement(253854..254636)
FT                   /locus_tag="PA0224"
FT   CDS_pept        complement(253854..254636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0224"
FT                   /product="probable aldolase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03613"
FT                   /db_xref="GOA:Q9I6R4"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R4"
FT                   /protein_id="AAG03613.1"
FT                   /translation="MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFEA
FT                   GHDSGLAGQITSRGPEAGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPANRF
FT                   HSWVYRARPDVNCIIHTHPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVPVGN
FT                   EEGEIISAALGDKRAILLSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGEIKPI
FT                   PPALAREAHDWISTPKRHGAAFNYYARRCLPRNSDCLS"
FT   gene            254791..255330
FT                   /locus_tag="PA0225"
FT   CDS_pept        254791..255330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0225"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03614"
FT                   /db_xref="GOA:Q9I6R3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R3"
FT                   /protein_id="AAG03614.1"
FT                   /translation="MSMRLKLLRKKLGVTLETLAEKTGLTKSYLSKVERGLNTPSIAAA
FT                   LKLAKALNVQVEELFSEESDGVDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARALLP
FT                   FIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHRIRS
FT                   LGETQAELLVVIHSDE"
FT   gene            255481..256332
FT                   /locus_tag="PA0226"
FT   CDS_pept        255481..256332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0226"
FT                   /product="probable CoA transferase, subunit A"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03615"
FT                   /db_xref="GOA:Q9I6R2"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R2"
FT                   /protein_id="AAG03615.1"
FT                   /translation="MAEILSLREAVRRFVHDGDSVALEGFTHLIPTAAGHELIRQGRKD
FT                   LTLIRMTPDLVYDLLIGAGCAKKLVFSWGGNPGVGSLHRLRDAVEKGWPQPLEIEEHSH
FT                   ADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDVSVI
FT                   HAQKADRKGNVLLWGILGVQKEAALAAKRCIVTVEEIVDELDAPMNACVLPSWALSAVC
FT                   LVPGGAHPSYAHGYYERDNRFYQDWDPIARDRESFTAWIDEYIRGTEDFGAFQAKLAEG
FT                   KR"
FT   gene            256329..257111
FT                   /locus_tag="PA0227"
FT   CDS_pept        256329..257111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0227"
FT                   /product="probable CoA transferase, subunit B"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03616"
FT                   /db_xref="GOA:Q9I6R1"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6R1"
FT                   /protein_id="AAG03616.1"
FT                   /translation="MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSPD
FT                   VVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQV
FT                   DRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAKEVLIILKQSHRTFVDKLAFVTSVG
FT                   HGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEATGWAI
FT                   RFAERVAETPAPSEVELAALRDLEARTAAAHGQKGSDE"
FT   gene            257108..258313
FT                   /gene="pcaF"
FT                   /locus_tag="PA0228"
FT   CDS_pept        257108..258313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="PA0228"
FT                   /product="beta-ketoadipyl CoA thiolase PcaF"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03617"
FT                   /db_xref="GOA:Q9I6R0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6R0"
FT                   /protein_id="AAG03617.1"
FT                   /translation="MSREVFICDAVRTPIGRFGGSLSAVRADDLAAVPLKALVERNPGV
FT                   DWSALDEVFLGCANQAGEDNRNVARMALLLAGLPESVPGVTLNRLCASGMDAIGTAFRA
FT                   IACGEMELAIAGGVESMSRAPYVMGKADSAFGRGQKIEDTTIGWRFVNPLMKEQYGIDP
FT                   MPQTADNVADDYRVSRADQDAFALRSQQRAGRAQEAGFFAEEIVPVTIRGRKGDTLVEH
FT                   DEHPRPDTTLEALARLKPVNGPEKTVTAGNASGVNDGAAALVLASAEAVEKHGLTPRAR
FT                   VLGMASAGVAPRIMGIGPVPAVRKLLRRLDLAIDAFDVIELNEAFASQGLACLRELGVA
FT                   DDSEKVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRRGLATMCVGVGQGLALAIE
FT                   RV"
FT   gene            258463..259761
FT                   /gene="pcaT"
FT                   /locus_tag="PA0229"
FT   CDS_pept        258463..259761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaT"
FT                   /locus_tag="PA0229"
FT                   /product="dicarboxylic acid transporter PcaT"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03618"
FT                   /db_xref="GOA:Q9I6Q9"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Q9"
FT                   /protein_id="AAG03618.1"
FT                   /translation="MTAPVHQYSNEERRKRIFAIVGASSGNLVEWFDFYVYAFCAIYFA
FT                   PAFFPSDNPTVQLLNTAGVFAAGFLMRPIGGWMFGRIADKHGRKTAMLISVVMMCAGSL
FT                   AIACMPTYASIGTLAPALLLLARMFQGLSVGGEYGTSATYMSEVALKGQRGFFASFQYV
FT                   TLIGGQLLAVLVVVILQQLLSEDELRAWGWRIPFVIGAITAVIALWLRRSLNETASKST
FT                   LERKESGTFAELFKHKRAFFTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAKTASAVM
FT                   TFALLAYMLMQPLFGMLSDRIGRKTSMLWFGTLGTLCTLPILLALKTVSSPYMAFFLII
FT                   LALAIVSLYTSISGLIKAEMFPPEVRALGVGVSYAVGNAIFGGSAEYVALGLKSVGMEN
FT                   VFYWYVSAMCLLALLVCVSLPDLRKVSYLNDEP"
FT   gene            259784..261163
FT                   /gene="pcaB"
FT                   /locus_tag="PA0230"
FT   CDS_pept        259784..261163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="PA0230"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03619"
FT                   /db_xref="GOA:Q9I6Q8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6Q8"
FT                   /protein_id="AAG03619.1"
FT                   /translation="MSDVPANQLFDAYFMAAPMRAVFSDRGRLQGMLDFEAALARAEAR
FT                   TGVVPATAVAPIEAACRAELYDPLALAEAVATAGNSAIPLVKALGRQVAAGDAEAERYV
FT                   HLGATSQDAMDSGLVLQLRRALALLEQDLQRLAEVLADQAERHADTPLAGRTWLQHATP
FT                   VTLGMKLAGLLGALTRHRQRLRELRPRLLVLQFGGASGTLAALGEQALPVAAALAEELG
FT                   LALPEQPWHTQRDRLVEFASVLGLVAGSLGKFGRDVSLLMQTEAGEVFEPAGAGRGGSS
FT                   TMPHKRNPVSSAVLIAAATRAPGLVSTLFAAMPQEHERSLGLWHAEWETLPELCCLVAG
FT                   ALQQAIGLLEGLEVDAQRMRRNLGLTHGLVLAEAVSIALARRIGREAAHHLVEQCCRRA
FT                   VEQRRELRAVLGEEARVSAELSGDELDRLLDPAHYLGQARAWVERALAEHHALGFEPHP
FT                   A"
FT   gene            261179..261970
FT                   /gene="pcaD"
FT                   /locus_tag="PA0231"
FT   CDS_pept        261179..261970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="PA0231"
FT                   /product="beta-ketoadipate enol-lactone hydrolase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03620"
FT                   /db_xref="GOA:Q9I6Q7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Q7"
FT                   /protein_id="AAG03620.1"
FT                   /translation="MPTVRLADGDLNYSLEGPAGAPVLLLSNSLGTDLGMWDTQIPALT
FT                   AHFRVLRYDTRGHGASLVTPGPYAIGQLGADVLALLDALELPRVHFCGLSMGGLIGQWL
FT                   GIHAGERLGRLVLCNTAAKIASDEVWNTRIDTVLKGGEQAMRDLRDASVARWFTAGFAE
FT                   REPAQVERIVAMLAATSPQGYAANCAAVRDADFREQLGLVQAPTLIVAGSHDAVTTPDN
FT                   ARFMQARIADAQLVEFAAAHLSNVEAGDAFSRRLVDFLLSA"
FT   gene            261981..262382
FT                   /gene="pcaC"
FT                   /locus_tag="PA0232"
FT   CDS_pept        261981..262382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="PA0232"
FT                   /product="gamma-carboxymuconolactone decarboxylase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03621"
FT                   /db_xref="GOA:Q9I6Q6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Q6"
FT                   /protein_id="AAG03621.1"
FT                   /translation="MDEKQRYEAGMQVRRAVLGAAHVERSLANLTPFNEEFQEMITRHA
FT                   WGDIWTRPGLPRHTRSLVTIAMLIGMNRNEELKLHLRAAKNNGVSRDEIKEVIMQSAIY
FT                   CGIPAANATFHLAESVWDELGVESQQASR"
FT   gene            262557..263498
FT                   /locus_tag="PA0233"
FT   CDS_pept        262557..263498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0233"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03622"
FT                   /db_xref="GOA:Q9I6Q5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Q5"
FT                   /protein_id="AAG03622.1"
FT                   /translation="MSRKLHIHAPAIHYFDMVRRCHSIREAARRLNVASSAVNRQILKL
FT                   EDEIGAPLFDRLPGGLRLTGAGEIFARHVTVVLQDMERVRSELDALQGLRTGHVEIATI
FT                   EAVTSDLLPCVLKAMRERYPDITVGVTLLGSQAIPEAVSSGAVDLGLAFALPRSADLQQ
FT                   VSVGHFRLGAIVSPQHPLARHQAIAFADCVEHGLIMAKSELSIHHLLAPLQRRLREPRR
FT                   AVLESSSLELSRQLARRGLGVAFQTRLGIEADIAQGELRFLPLKDNGGIHSDLGLYVRT
FT                   GRYLPVAVDALARQIAEEVRLREREEARLNEA"
FT   gene            263689..264522
FT                   /locus_tag="PA0234"
FT   CDS_pept        263689..264522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0234"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03623"
FT                   /db_xref="GOA:Q9I6Q4"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Q4"
FT                   /protein_id="AAG03623.1"
FT                   /translation="MKKMMQGAAALIALVGAGESMALEWMSNSVGFRYGQQFTNPNNPD
FT                   KFAKRIYSFTHADGYRYGSNFFNLDVFLSDNRDPRKGTDHGGSEVYAVYRHQLYASRVF
FT                   DRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYREKN
FT                   HFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNHAAKFQGFVNYVGDKGEDYNDKHTAAE
FT                   TLVRTALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFTF"
FT   gene            complement(264964..266310)
FT                   /gene="pcaK"
FT                   /locus_tag="PA0235"
FT   CDS_pept        complement(264964..266310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaK"
FT                   /locus_tag="PA0235"
FT                   /product="4-hydroxybenzoate transporter PcaK"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03624"
FT                   /db_xref="GOA:Q9I6Q3"
FT                   /db_xref="InterPro:IPR004746"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6Q3"
FT                   /protein_id="AAG03624.1"
FT                   /translation="MNSPSLPAVERLDVQAFINAQPLSPYQWRIVLLCFLIVFLDGLDT
FT                   AAMGFIAPALTQDWGIDRASLGPVMSAALIGMVFGALGSGPLADRYGRKLVLVAAVFLF
FT                   GLFSLASAYSTNVEQLLALRFLTGLGLGAAMPNATTLLSEYTPERLKSLLVTSMFCGFN
FT                   LGMACGGFVSAKLIPLFGWHSLLLLGGLLPLVLAVVLLFRLPESARYLVVRNRGSERVR
FT                   QVLAPIAPAQVALARSFHVPEQQTVQARNVFAVIFSGTYSAGTLLLWLTYFMGLVIVYL
FT                   LTSWLPTLMRDSGASLEQAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGLFYLLAGV
FT                   FAWCVGQSLGQVTLLATLVLLAGMCINGAQSAMPSLAARFYPTQGRATGVSWMLGIGRF
FT                   GAILGAWIGATLLGLGWNFEQVLTALVLPAALATAAVLLKGLVSHADAG"
FT   gene            266616..267395
FT                   /locus_tag="PA0236"
FT   CDS_pept        266616..267395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0236"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03625"
FT                   /db_xref="GOA:Q9I6Q2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Q2"
FT                   /protein_id="AAG03625.1"
FT                   /translation="MAGSLIERALGLLELLASDARGLPLQQLADRLDIPKSAAHRMLAE
FT                   LIRLGYVRQDDDTSRYRLSTRLAALGFRFLASSGVVDLVQPVLDGLARETGELVRLGVI
FT                   EGDRQTWIAKSQGATSGLRYDPDMGREAPLFYTASGHAWLASLSDKAALALVERQGVGA
FT                   ARDFGPNAPRSRSELLRYLKRAREHGYAWQIECSAPGMAAMAALVRHPEDGRALGVLSV
FT                   AGPSARFGEARMHELAPLLLAAAQDLSHASQASELFR"
FT   gene            267638..268681
FT                   /locus_tag="PA0237"
FT   CDS_pept        267638..268681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0237"
FT                   /product="probable oxidoreductase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03626"
FT                   /db_xref="GOA:Q9I6Q1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Q1"
FT                   /protein_id="AAG03626.1"
FT                   /translation="MDAPLRIALIGAGNMGRQHYHRLQRIAGARLCAVADPQGQAFAAD
FT                   TGVPWFGDHRRLLEEARPQAAIVANPNNLHVATALDCLAAGVPLLLEKPVGVQLDEVSE
FT                   LVAVARRSGVPLLVGHHRRHNPLVVRARQLIAEGALGRLLSVTALWQLKKPDSYFEVAW
FT                   RREPGAGMLLTNLIHDLDLLRHLCGEVREVQALAGNAIRGLPNEDNIALLLRFANGALG
FT                   SLTGCDAAAAPWSWELAAGENPVYPRQAEQPCYLLAGTEGALSLPQLRRWRYAEARQGW
FT                   HDPLAASEEAVATGDPLQRQLEHFVRVARGEEAPLMDATDAARTLALVEAVREAARSGR
FT                   ACAPASF"
FT   gene            268704..269519
FT                   /locus_tag="PA0238"
FT   CDS_pept        268704..269519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0238"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03627"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6Q0"
FT                   /protein_id="AAG03627.1"
FT                   /translation="MESRILSLAALTVLELSPPDMVEAAARAGYSHVGLRLVPATVEEH
FT                   HYPLLADAGLRRRTLARLRDSGVRTLDVEILRLRPDTRVGEFAAVLEVGAEFGARYVLV
FT                   AGNDDDERRSADNFAALCDLARPLGLDPHLEFMPWTGIRDLRQAARVVEAAARDNAGLL
FT                   LDAFHFDRSASSLEDLRAIPPARLGYAQLCDVVGPRPTSMDEILRQAREERRFPGDGGL
FT                   DLLALLRALPENLPLSLEVPALDLLARGVDGAERARLAIERTRALLARL"
FT   gene            269669..270547
FT                   /locus_tag="PA0239"
FT   CDS_pept        269669..270547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0239"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03628"
FT                   /db_xref="GOA:Q9I6P9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P9"
FT                   /protein_id="AAG03628.1"
FT                   /translation="MNASTSPLPASDQTLRGILLICAAVFLFASHDGLSKFLSGFYPIV
FT                   MVVWARYLVHTLLMVAVFVPRNGLAVIRSRRPLMQLARALCLIGTSLFFTTGLRYLPLA
FT                   EATAVNFLAPLLVTALSVPLLKEKVSLGQWLAVLTGFIGVLFIVRPGGALFTPAALFPL
FT                   GSALCFGLYQLLTRMLANSDSPTTSNFLAGIFNTLIMSLLVPFFWQTPSLLHGLMMIAL
FT                   GGCGMGGHLLLTQAFRHAPPATLAPFSYGQIIFAGLLGLLVFGHVPDAWALLGILVICA
FT                   SGLVVAWRRGR"
FT   gene            complement(270573..271838)
FT                   /locus_tag="PA0240"
FT   CDS_pept        complement(270573..271838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0240"
FT                   /product="probable porin"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03629"
FT                   /db_xref="GOA:Q9I6P8"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="PDB:3SZD"
FT                   /db_xref="PDB:4FMS"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P8"
FT                   /protein_id="AAG03629.1"
FT                   /translation="MSHPSHVRALCASLCLGAGLPVHAGHVHAGQGFLEDAKASLTARN
FT                   FHLHRNFVGDASQGKAEEWTQSFILDARSGFTQGSVGFGLDVLGLYSLKLDGGKGTAGT
FT                   QLLPIHDDGRPADDFGRLAVAGKLRVSNSELKIGEWMPVLPILRSDDGRSLPQTFRGGQ
FT                   LSANEIAGLTLYAGQFRGNSPRNDASMQDMSLFGRPAATSDRFDFAGGEYRFNGERSLL
FT                   GLWNAELKDIYRQQYLQLQHSQPLGDWLLGANLGGFRGRDAGSARAGKLDNRTVSALFS
FT                   ARYGLHTLYLGLQKVSGDDGWMRVNGTSGGTLANDSYNASYDNPGERSWQLRYDFDFVG
FT                   LGLPGLTFMTRYLHGDHVRLAGVTDDGSEWGRESELGYTLQSGAFKRLNVRWRNSSQRR
FT                   DWGSNTRFDENRLIVSYPLSLL"
FT   gene            complement(271904..273229)
FT                   /locus_tag="PA0241"
FT   CDS_pept        complement(271904..273229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0241"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03630"
FT                   /db_xref="GOA:Q9I6P7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P7"
FT                   /protein_id="AAG03630.1"
FT                   /translation="MIHSSSSRLLAADAPRESRGGRIRNAFAVGRTRWGMLALVFFATT
FT                   LNYIDRAALGVMQPILAEKMSWTAMDYANINFWFQVGYAIGFILQGRFIDKVGVKRAFF
FT                   LAVLLWSLATGAHGLATSAAGFMVCRFILGLTEAANYPACVKTTRLWFPAGERAVATGI
FT                   FNAGTNVGAMVTPALLPLILGVWGWQAAFLCMSALGLVWLVFWWRNYYNPEEHPRVKQS
FT                   ELEYIQQQEEPPATRVPFSQILRRRGTWAFALAYSITAPVFWFYLYWLPPFLNQQYGLG
FT                   ISVTQMGIPLILIWLTADFGSVGGGILSSWLIGRGMPAIRARLLSMLLFACTIVGVVFA
FT                   ANASGLWIAVLAIALAVGAHQAWTANIWSLVMDYTPKHLMSTVFGFGGMCAALGGMFMT
FT                   QIVGGVLTATNNNYAVLFTMIPAMYFIALTWLYFMAPRRIEA"
FT   gene            273775..275679
FT                   /locus_tag="PA0242"
FT   CDS_pept        273775..275679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0242"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03631"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P6"
FT                   /protein_id="AAG03631.1"
FT                   /translation="MQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLHYDGSPRD
FT                   VRRLCADLGLEILLFQPFRDFEGCRRERLGRNLERAERKFDLMQELGTDLVLVCSNVAA
FT                   DALGEPALLADDLRQLAERAAVRGLRIGYEALAWGRQVNTWEQAWDLVRRADQANLGLI
FT                   LDSFHTLSLDGDPRGIADLPGEKIFFVQMADAPLLAMDVLEWSRHFRCFPGQGGFDLAG
FT                   FLAPVVASGYRGPLSLEVFNDGFRAAPTRANAVDGLRSLLYLEEKTREHLQRQTPHVAV
FT                   DELFAPPPASLCDGIEFLEFAVDETLGARLGQWLQRLGFARAGEHRSKNVSLLRQGDIN
FT                   LVLNAEPYSFAHGFFEAHGPSLCATALCVRDAGQALERARAYGGQPYRGLLGPNEREIP
FT                   AVRALDGSLLYLVERHTEGRSIYDSDFVTNDADTSGLGLRRVDHVALALPAEGLDSWVL
FT                   FYKSLFDFGADDEVVLPDPYGLVTSRAVRSPCGSVRLPLNISEDRNTAIARSLSSYRGS
FT                   GVHHIAFDCADIFAAVAQAKEAGVALLEIPLNYYDDLAARFDFDDEFLSELAYYNVLYD
FT                   RDAQGGELFHVFTEPFEERFFFEILQRRHGYAGYGAANVPVRLAAMAQARRGVRRVKL"
FT   gene            275772..276440
FT                   /locus_tag="PA0243"
FT   CDS_pept        275772..276440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0243"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03632"
FT                   /db_xref="GOA:Q9I6P5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P5"
FT                   /protein_id="AAG03632.1"
FT                   /translation="MSKPDPAVVEESAPRGKGRKNNPEKTRQDILRAAIDEFVAQGLSG
FT                   ARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIEGTLRLGALPPAKAMEK
FT                   LVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNSSIVQSIAEILRRGEAEGV
FT                   FRAGLEALDVHMLISSFCFYRVSNRYTVSRIFRTDLHDAEVRQRHRRMIGEAVLRYIRA
FT                   "
FT   gene            complement(276480..277334)
FT                   /locus_tag="PA0244"
FT   CDS_pept        complement(276480..277334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0244"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03633"
FT                   /db_xref="GOA:Q9I6P4"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P4"
FT                   /protein_id="AAG03633.1"
FT                   /translation="MSAPRSVLAGLIGAGIQASRTPALHEREGDAQGIRYLYRLIDLDP
FT                   LGKSADDLEFLLAAASDLGFTGLNVTFPCKQAIIPLLDDLSAEARGIGAVNTVVLRDGR
FT                   RIGHNTDCLGFAEGFRRGLADAPRQRVVQMGAGGAGAAVAHALLAEGVERLVLFDVDPA
FT                   RAQALADNLNQHFGAPRALAGSDLAGALGDAQGLVNTTPVGMAKLPGMPVPAELLRADL
FT                   WVAEVIYFPLETELLRQARALGCRTLDGGTMAVFQAVKAFELFSGVTADAARMQAHFAS
FT                   LGD"
FT   gene            complement(277331..277777)
FT                   /gene="aroQ2"
FT                   /locus_tag="PA0245"
FT   CDS_pept        complement(277331..277777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ2"
FT                   /locus_tag="PA0245"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03634"
FT                   /db_xref="GOA:Q9I6P3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6P3"
FT                   /protein_id="AAG03634.1"
FT                   /translation="MTRTVLVLNGPNLNLLGTREPQTYGRRTLGEIADECAAFAETRGF
FT                   AVDFRQTNQEGQLLDWIHQARGRVAGIVINPAAWTHTSVALRDALAAVELPVVEVHLSN
FT                   VHQREAFRHHSYVSPVALGVICGFGSLGYRLALEHFAERFEAAA"
FT   gene            complement(277894..279399)
FT                   /locus_tag="PA0246"
FT   CDS_pept        complement(277894..279399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0246"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03635"
FT                   /db_xref="GOA:Q9I6P2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P2"
FT                   /protein_id="AAG03635.1"
FT                   /translation="MSDLAQNPPAVRTVLAGLMLSIFLSALDQTIVAVSLPAISADYAD
FT                   LDLLAWVISAYMVAMTVSMPIYGKLGDLYGRRRLMLFAIVVFTAASLLCGLAQSMGQLV
FT                   LARVLQGIGAGGLMAVSQAIIGDIVPPRERGRYQGYFSSMYAIASVAGPVLGGLLTEYL
FT                   SWHWVFWINLPIGLLALAISRRTLVGLPVPRRQPVIDYLGIVLMVVGLTALLLAITQIG
FT                   QGAAWSDPALLGLFALAALALLLFVAQERRFREPLVPMQLFAVRAATLSWLVAFFASFQ
FT                   AISLTVLVPLRYQSVTGAGADSAALHLLPLVMGLPLGAYCCGRLTASLGRYKPLILLGA
FT                   VLLPCGIAGLALVPVGDHWLSGLCMLLTGIAIGTQFPTSLVAAQNAVEQRHIGVATSNA
FT                   TLFRSLGGAVGVALMSAILLALLKHLRIGGGLDQGFSESALLSSLDAASGPARVILQHV
FT                   LADAFKVLFLVNAAVALLGLAVASALPDMTLRGRGATQPTAGE"
FT   gene            complement(279574..280758)
FT                   /gene="pobA"
FT                   /locus_tag="PA0247"
FT   CDS_pept        complement(279574..280758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="PA0247"
FT                   /product="p-hydroxybenzoate hydroxylase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03636"
FT                   /db_xref="GOA:P20586"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:1D7L"
FT                   /db_xref="PDB:1DOB"
FT                   /db_xref="PDB:1DOC"
FT                   /db_xref="PDB:1DOD"
FT                   /db_xref="PDB:1DOE"
FT                   /db_xref="PDB:1IUS"
FT                   /db_xref="PDB:1IUT"
FT                   /db_xref="PDB:1IUU"
FT                   /db_xref="PDB:1IUV"
FT                   /db_xref="PDB:1IUW"
FT                   /db_xref="PDB:1IUX"
FT                   /db_xref="PDB:1K0I"
FT                   /db_xref="PDB:1K0J"
FT                   /db_xref="PDB:1K0L"
FT                   /db_xref="PDB:1PXA"
FT                   /db_xref="PDB:1PXB"
FT                   /db_xref="PDB:1PXC"
FT                   /db_xref="PDB:1YKJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20586"
FT                   /protein_id="AAG03636.1"
FT                   /translation="MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRA
FT                   GVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTE
FT                   VTRDLMEAREACGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHG
FT                   ISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYY
FT                   VQVPLSEKVEDWSDERFWTELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRL
FT                   FLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAE
FT                   RFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE"
FT   gene            280936..281802
FT                   /locus_tag="PA0248"
FT   CDS_pept        280936..281802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0248"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03637"
FT                   /db_xref="GOA:Q9I6P1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P1"
FT                   /protein_id="AAG03637.1"
FT                   /translation="MTDSTRDVPVFKLYGAPLEWPTPDLLHCESIPARSRLHDWEIKPH
FT                   RHADLAQLLYVRKGWAQLQVEGEPTRVEQPSIQFVPPLCIHGFQFSERIDGYVLTLAAP
FT                   LLARLQAHLGAQRQALEAPGLYPVGADRRYIDTLFDAIDGEYAGAAPARELLLQSLIGV
FT                   LAVWLGRQVMVRRAEARPGRGQEYLSAFSQLVERHFREHLGIDEYARRLGISPAHLNGV
FT                   ARRLSGQTALGIVHQRLLLEAKRDLVYTAMTVNEIADRLGFSEPAYFTRFFKRLSGVSP
FT                   SVFRKGD"
FT   gene            complement(281799..282245)
FT                   /locus_tag="PA0249"
FT   CDS_pept        complement(281799..282245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0249"
FT                   /product="probable acetyltransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03638"
FT                   /db_xref="GOA:Q9I6P0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6P0"
FT                   /protein_id="AAG03638.1"
FT                   /translation="MSSPPKIRRYIPADRDATLAIWLEASRVGHGFLGEAELQKQKALV
FT                   RDHYLDASETWLALDGDTPLGFIGLLDAFIGGLFVAPTAHGRGIGRQLVEHAATLKGAL
FT                   EVEVYAANREALGFYARCGFVESGRRPRDDEGRALEIVQLRREH"
FT   gene            complement(282323..282757)
FT                   /locus_tag="PA0250"
FT   CDS_pept        complement(282323..282757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03639"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N9"
FT                   /protein_id="AAG03639.1"
FT                   /translation="MKTVAQLLNAKQNQQVYTIGADEMVLDALRLMAEKNIGALLVVNH
FT                   GEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHLRH
FT                   LPVVEDGQLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
FT   gene            complement(282912..283553)
FT                   /locus_tag="PA0251"
FT   CDS_pept        complement(282912..283553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0251"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03640"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="InterPro:IPR037181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N8"
FT                   /protein_id="AAG03640.1"
FT                   /translation="MNDYIARLREKYDAHFGCAPAMTLDCRDFWRHCVAAPEMAVFAYR
FT                   LESTRRPHHVVITAGMSQAPMHFAPYMGKARWSAELICYLDELGGDDLRHLQWLAGLPF
FT                   HERLALGHGHAVAFGFPLYEQSLLRHFLLLPAPLEEDASLFDGFALSAHPVDLLWVVPL
FT                   TEQEYQVNVKEHLEGIARLLTDAGHPLSLDRHRYCYVTGQSPEGLARVLH"
FT   gene            complement(283818..284105)
FT                   /locus_tag="PA0252"
FT   CDS_pept        complement(283818..284105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0252"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03641"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N7"
FT                   /protein_id="AAG03641.1"
FT                   /translation="MGGLRKPIRPAMPRHPHTTLLLCLCLTLPGCESGRSYSLSEGAPV
FT                   TGIRIQRDDRSPLQRLRDCERQGCSERQKIDPFTPDPDYLRAEGHFPLPW"
FT   gene            complement(284197..284673)
FT                   /locus_tag="PA0253"
FT   CDS_pept        complement(284197..284673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0253"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03642"
FT                   /db_xref="GOA:Q9I6N6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N6"
FT                   /protein_id="AAG03642.1"
FT                   /translation="MTGPMTETNALGLPQGPLYLMTEIVRQRERQLTALLAPLELGLHE
FT                   WRALRIIHAFDGDVPMSVLIEHSQTDRTALGRTIERLVRRGWVSRLPDPDDGRAVLVRR
FT                   SPAAQAVFEQALAQVAGLDERLLAGLGSGPEEEALTLVLGKLLRAFDGLSRVRQ"
FT   gene            complement(284714..286204)
FT                   /locus_tag="PA0254"
FT   CDS_pept        complement(284714..286204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03643"
FT                   /db_xref="GOA:Q9I6N5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032903"
FT                   /db_xref="PDB:4IP2"
FT                   /db_xref="PDB:4IWS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6N5"
FT                   /protein_id="AAG03643.1"
FT                   /translation="MNRSALDFRHFVDHLRRQGDLVDVHTEVDANLEIGAITRRVYERR
FT                   APAPLFHNIRDSLPGARVLGAPAGLRADRARAHSRLALHFGLPEHSGPRDIVAMLRAAM
FT                   RAEPIAPRRLERGPVQENVWLGEQVDLTRFPVPLLHEQDGGRYFGTYGFHVVQTPDGSW
FT                   DSWSVGRLMLVDRNTLAGPTIPTQHIGIIREQWRRLGKPTPWAMALGAPPAALAAAGMP
FT                   LPEGVSEAGYVGALVGEPVEVVRTQTNGLWVPANTEIVLEGEISLDETALEGPMGEYHG
FT                   YSFPIGKPQPLFHVHALSFRDQPILPICVAGTPPEENHTIWGTMISAQLLDVAQNAGLP
FT                   VDMVWCSYEAATCWAVLSIDVQRLAALGTDAAAFAARVAETVFGSHAGHLVPKLILVGN
FT                   DIDVTEIDQVVWALATRAHPLHDHFAFPQIRDFPMVPYLDAEDKARGSGGRLVINCLYP
FT                   EQFAGQMRAATASFRHAYPTALRRRVEERWSDYGFGDA"
FT   gene            complement(286338..287024)
FT                   /locus_tag="PA0255"
FT   CDS_pept        complement(286338..287024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03644"
FT                   /db_xref="GOA:Q9I6N4"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N4"
FT                   /protein_id="AAG03644.1"
FT                   /translation="MVGSSARRLRLRRTRGRVGLGLVAGLSVLAGMTDAIGFLATGDFV
FT                   SFMSGNTTRLAVSLGEGDFGGLVRLSVALASFVVGNALGVILARFSGRRAAPILVCCAM
FT                   LLALSAVWPFDWNVPALVAAILAMGMLNAVVEQVNGLPIGLTYVTGALSRFGRGLGRWL
FT                   LGERRNGWRVQLVPWSGMCVGAVLGALLEQQLGLAAMAASAALAALLALLALVIPRPWQ
FT                   MDYMVR"
FT   gene            complement(287188..288120)
FT                   /locus_tag="PA0256"
FT   CDS_pept        complement(287188..288120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0256"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03645"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N3"
FT                   /protein_id="AAG03645.1"
FT                   /translation="MRSWHGVVTKIAKQGKGAVVKNRLGPEELLVPFTVSTLVEVDLDA
FT                   RIYGTDVDDTPWAEGDERKEVLVGTEVELLTDTDTFPTHASQVLSANFRFALDIVKGGL
FT                   SGPVRKGAVLVIYHDFQQEIRRGDSGSAFAEAVVAYARNKLYKPAFAIKADTNYAQLVR
FT                   DLGKVAAESGEQYFIDTILIATHGTAGQLWLGNPHGDSTADVMARRVQGKQFVEPQAFG
FT                   ATLLELFGKELAIALYGCDFAGDEDGEAAALELRIAANARAVYAGKGTVYLNASKEGRS
FT                   TVTCSKAMVVYRTDKIEVLGGNQVPVFDI"
FT   gene            complement(288384..289175)
FT                   /locus_tag="PA0257"
FT   CDS_pept        complement(288384..289175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0257"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03646"
FT                   /db_xref="GOA:Q9I6N2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N2"
FT                   /protein_id="AAG03646.1"
FT                   /translation="MSRQAYYKRNRAADSKARQADRVVEFVQQIRIRQPRLGTRKLHYL
FT                   LHCQPDRRLQIGRDRLFQVLGERRLLVLPKRAYHKTTQSFHRFYRHPNLLKSGPNQVVP
FT                   SGPEHVWAADITYLPASSGPLYLSLVTDAYSRKIVGHHVHESLHAKSVAQAFRQALRKR
FT                   QRRQSLVHHSDRGIQYFSALYQSLHARHGVQCSMTDGYDCYQNALAERIYGILKTELLL
FT                   SSPENLEQARKMVAEAVQIYNTERPHMALKNKTPDAVHRAF"
FT   gene            complement(289205..289390)
FT                   /locus_tag="PA0258"
FT   CDS_pept        complement(289205..289390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0258"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03647"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N1"
FT                   /protein_id="AAG03647.1"
FT                   /translation="MSDPKTLTPEQRIKELEQQLELMSQKDQFFETVVDVLKNDYGVSV
FT                   VKKRSGKSSRKVKSQD"
FT   gene            complement(289562..291004)
FT                   /locus_tag="PA0259"
FT   CDS_pept        complement(289562..291004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0259"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03648"
FT                   /db_xref="InterPro:IPR021531"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6N0"
FT                   /protein_id="AAG03648.1"
FT                   /translation="MSADAYHPPTTSPRLETLDVLSIGMSLDVFRQGQVWKALQEQNAA
FT                   QAEALHVGSILPMDPKKYPTSADDKDMAYEKRQADALELGLKNFLEKWPIPTVTVVRGW
FT                   DPSTPNLRFTPEETRESLSVKVNDLRVPAGLHWHRIANLQDGIICNDTPEGVLEALFSL
FT                   FERNPDLPAVLVYANEGISMAGALSSRDVTLKSLGAVSGPRIPGTLTDAMVALIVGRPE
FT                   RVDWLRQFAPYTKVNENRIDPEFRGWGWRKPPVEFRPTPFIPQPWTERALEQWDALPVL
FT                   ARLHRPVSVPLTHPDTGERLKREALTAQLAAAWKTASAGLRPAPARLFYDGGLNATPLA
FT                   ELTPALGAAQSSLDLLDSRESYDLTQRLGDTGAASPFVGITLATMASYLNGDSSMVMPL
FT                   RRKDQATLIGISSPTPGKKPVHDPFGVDLLPQTASGDGPPPSADPVAPASRLTTRLPPG
FT                   EDYALEEFLSSLKPSTDWQDDL"
FT   gene            complement(291154..293304)
FT                   /locus_tag="PA0260"
FT   CDS_pept        complement(291154..293304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0260"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03649"
FT                   /db_xref="InterPro:IPR021692"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6M9"
FT                   /protein_id="AAG03649.1"
FT                   /translation="MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDL
FT                   AGCYERIERGLCQGLNERLDMPPTLPGGQANPGYLTPAGYSLPADDEGKAENPDVVYYR
FT                   RKFASGAGGAAVRSVVVPFYWGFREEEQYINKTAAHGEWLDRNGNRLDKSGTKEGGQFV
FT                   NATTNLPDMWGQGFNGKLFGFISLDWFGGTMTHPLFSAAGRKYMVLAAMRLAMLIKIIR
FT                   KRYPDDTINVVGHSQGTLLTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGWS
FT                   SQQTREARLATLKGILEFICGRRHPVPALSSVALRNCQGYGAIGGPGWVGGQGCQTTID
FT                   GERLSFDERDNRGSVYLYFTPQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQR
FT                   IFTVRKRNGEKEKIGGHAPPHVYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTA
FT                   PRLPLPTEARFDFDGAVTAPGENSASGVYQVRDTLDPIDAAIGVSNGGWKEKDSGHAVA
FT                   QQVDAALAYRYGRDARSVERALNEGKELAQQTHVFSARELGTGMVLVTRAETPYEARLR
FT                   LQTAEGHLEPLSFHSAIPNNPEHNRRVLAYDLAIGAGDSVDDVVFYQYLCRVADWRLDW
FT                   KASDKGIFSQGDASVDLPDEEVRALYRAEESKNSQLIDATVAYRKSGEFPVVVGNRLPS
FT                   LVGTQTILDRYHEQAVRFGGTI"
FT   gene            complement(293301..293798)
FT                   /locus_tag="PA0261"
FT   CDS_pept        complement(293301..293798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0261"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03650"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6M8"
FT                   /protein_id="AAG03650.1"
FT                   /translation="MKCKTLLIACLFGLGSAQALAVSKLPPQIPVHAGSGRVTLDLRPL
FT                   LAETNDVEITRVSVCRRVGSHCQETLWRIELPPGWRAGEIEVFGDYPGSSVLLRRPERL
FT                   QPDGSYNAFIHFNERSRRHRQTVSSIAVEFCLAGEPGNWMLLDEATCLARRNAEERQGE
FT                   KP"
FT   gene            complement(293802..296861)
FT                   /locus_tag="PA0262"
FT   CDS_pept        complement(293802..296861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03651"
FT                   /db_xref="GOA:Q9I6M7"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6M7"
FT                   /protein_id="AAG03651.1"
FT                   /translation="MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKN
FT                   AIDFKQVLDQPGTFTLWQDGRPARYVHGIVSHFTQGSSGFRRTRYELLLEPQLARLELC
FT                   CNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLAFEE
FT                   GLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTA
FT                   RQTQRDYSFKRPTYDQEHHLAGEALEHQGSSYERYDYPGRYKRSGAGRPFTESRLRGHR
FT                   RDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVRVVHRGTQYAGQEEESADAPL
FT                   GVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDR
FT                   EGRHDEFSTCWIRVAQNWAGADWGHMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNR
FT                   PPYALPDHKILSTIKSKEYKGSRANELRIDDTTAQISAALMSDHGASALHLGYLTHPRP
FT                   EGGKPRGEGFELRTDEHGAVRAAKGLLLSTEEQLRAGAGHLDRGVVVQVLEAALELARE
FT                   LGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATP
FT                   ASLTLAAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQK
FT                   NDIRLEAKQSVEVSASQQHVLVTAKEHITLMCGGAYLTLKGGNIELGMPGNFVVKAAKH
FT                   SHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANGEVIEGVTDAEGA
FT                   TQLLQKDAMNIAKVDMKHTKSPASAVAGIAAAVGAAVAVGKLLGGPDAEAGRALSEGEI
FT                   SLAKGVFGDSIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQ
FT                   GLFIHEMTHVWQHQHGVNVLLVGAYQQARQFLLGDQYAYRLEPGKTLKDYNIEQQGDIV
FT                   RDYFLEKNEFGEASANSRFAGVLKNFPTGY"
FT   gene            complement(297043..297561)
FT                   /gene="hcpC"
FT                   /locus_tag="PA0263"
FT   CDS_pept        complement(297043..297561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcpC"
FT                   /locus_tag="PA0263"
FT                   /product="secreted protein Hcp"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03652"
FT                   /db_xref="GOA:Q9HI36"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="PDB:3HE1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HI36"
FT                   /protein_id="AAG03652.1"
FT                   /translation="MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFN
FT                   HEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAA
FT                   GTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGS
FT                   DDWRSPVAG"
FT   gene            complement(298816..298892)
FT                   /locus_tag="PA0263.1"
FT   tRNA            complement(298816..298892)
FT                   /locus_tag="PA0263.1"
FT                   /product="tRNA-Arg"
FT   gene            complement(299081..299497)
FT                   /locus_tag="PA0264"
FT   CDS_pept        complement(299081..299497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0264"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03653"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6M6"
FT                   /protein_id="AAG03653.1"
FT                   /translation="MSSGSTSTTPRAWLSGSVVTGKCCLLVIRKGQRPGVPFPAPCASG
FT                   VAVTGRPPCATGGRGRTRPPTGVGEDTKDSCGKGIADETPRRHHGGPATRKAGRATGRS
FT                   ERGHSRGTRPAELMPIPRSPVVVALGAFEISNES"
FT   gene            299522..300973
FT                   /gene="gabD"
FT                   /locus_tag="PA0265"
FT   CDS_pept        299522..300973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="PA0265"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03654"
FT                   /db_xref="GOA:Q9I6M5"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6M5"
FT                   /protein_id="AAG03654.1"
FT                   /translation="MQLKDAKLFRQQAYVDGAWVDADNGQTIKVNNPATGEIIGSVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPLAE
FT                   AKGEIAYAASFLEWFGEEAKRIYGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPSAMI
FT                   TRKAGPALAAGCTMVLKPASQTPYSALALAELAERAGIPKGVFSVVTGSAGEVGGELTS
FT                   NPIVRKLTFTGSTEIGRQLMAECAQDIKKVSLELGGNAPFIVFDDADLDAAVEGALISK
FT                   YRNNGQTCVCANRLYVQDGVYDAFVDKLKAAVAKLNIGNGLEAGVTTGPLIDAKAVAKV
FT                   EEHIADAVSKGAKVVSGGKPHALGGTFFEPTILVDVPKNALVSKDETFGPLAPVFRFKD
FT                   EAEVIAMSNDTEFGLASYFYARDLARVFRVAEQLEYGMVGINTGLISNEVAPFGGIKAS
FT                   GLGREGSKYGIEDYLEIKYLCLGGI"
FT   gene            301218..302498
FT                   /gene="gabT"
FT                   /locus_tag="PA0266"
FT   CDS_pept        301218..302498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="PA0266"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03655"
FT                   /db_xref="GOA:Q9I6M4"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6M4"
FT                   /protein_id="AAG03655.1"
FT                   /translation="MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYI
FT                   DFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPK
FT                   KTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSF
FT                   MQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVA
FT                   GKAEIMDAIAPGGLGGTYAGSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQ
FT                   AKHKVIGDVRGLGSMVAIELFEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIR
FT                   FLMPVTIPDAQLEKGLAILAECFDELA"
FT   gene            302824..304023
FT                   /locus_tag="PA0267"
FT   CDS_pept        302824..304023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0267"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03656"
FT                   /db_xref="GOA:Q9I6M3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6M3"
FT                   /protein_id="AAG03656.1"
FT                   /translation="MSAAKKAPVILIADPDPWSRDLLGQLVLGVRCDARLVLCGDGGEA
FT                   LAHCRRRRFALILAELNLPQVDGFELLREARLRRSVAEQPFILISDRADQASVRAAVAL
FT                   APTAYLVKPFQAENLMQRLRGLLLKGDEVVACPLPERDAGENLEAFLERARDSAEGAPL
FT                   LADVRAASDRCLSAEEHPLRVLEAEFGRDPQITAGLIAAANSAARHVGPACQTLGQALR
FT                   RLGLGHSLNLVLGFSLQRAIQLGEPLLAERAMHFWDLSQRCADIAWELADALGADVERC
FT                   YTAGLLHRLGDLALLRTLQDWCDGGGALDEARLDELLGRFGASFGSALRARWRLPLELR
FT                   RLIAAAYQFGGVLSREELILSLATQAASLPEDDAEQLAESKAARMLGLDGERLAKLLQP
FT                   "
FT   gene            complement(304177..305598)
FT                   /locus_tag="PA0268"
FT   CDS_pept        complement(304177..305598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0268"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03657"
FT                   /db_xref="GOA:Q9I6M2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6M2"
FT                   /protein_id="AAG03657.1"
FT                   /translation="MELQLILDGRHDLVGQLYRQLRDAILHGRLATGDRLPATRYLAER
FT                   LEVSRKTVSEAYERLASEGFLEGRVGSGTFVARGPAGEAPPQRADGPLRPAARWARIEP
FT                   QSGLMDQRAPLRYSFAGGTTDKRRFPFDTWRTCVLQALRLQQRSPAFYKETEGDPELRL
FT                   AISRYLAINRAVQCDWNALMVTQGAQQGLDLLARVMLDPGDLAVVEEPGYPPARASLLA
FT                   TGAEVRGVPVDAEGLRVDLLPDNAKLVYVTPSHQFPLGMPMSLERRLQLLDWAQRHRAL
FT                   IIEDDYDSEYRFDGRSLESLRSLDRNGQVAYLGTFSKTLFPELRLGYLLPPASLREAVL
FT                   AARKLVDRHSETLQQRALALFIQRGDFARHTRRLQREYAQRRGRLLERLHGDLSPWLEA
FT                   LPAVAGIHLAARCREPLDVLRIARHLRQQGLEVGTLPPFYAETPAQAGFLFGFGCIERD
FT                   DIDPALDLLRAELRR"
FT   gene            305725..306162
FT                   /locus_tag="PA0269"
FT   CDS_pept        305725..306162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03658"
FT                   /db_xref="GOA:Q9I6M1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="PDB:2IJC"
FT                   /db_xref="PDB:2O4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6M1"
FT                   /protein_id="AAG03658.1"
FT                   /translation="MTTRLEWAKASPDAYAAMLGLEKALAKAGLERPLIELVYLRTSQI
FT                   NGCAYCVNMHANDARKAGETEQRLQALCVWQETPYFTPRERAALAWTEQLARLSQGALP
FT                   HGLLDELREHFDDKEIAELTLAVSAINAWNRFGVGMGMQPE"
FT   gene            306174..306581
FT                   /locus_tag="PA0270"
FT   CDS_pept        306174..306581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0270"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03659"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6M0"
FT                   /protein_id="AAG03659.1"
FT                   /translation="MKANRSIACLLLAALPTLASAHVAEKVETLHDQALAEIPGHRGLM
FT                   LTVSFKPGQVSAPHVHPGSVFVYVLEGTVQTQLEGGSVETYTVGQSWYEPANVPHLLAR
FT                   NPDPMKPAKLLVWELLKEGDPILKPLERGAH"
FT   gene            306615..306899
FT                   /locus_tag="PA0271"
FT   CDS_pept        306615..306899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0271"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03660"
FT                   /db_xref="GOA:Q9I6L9"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L9"
FT                   /protein_id="AAG03660.1"
FT                   /translation="MSASQVIRIRARNGQSERLGLRLQQLVEPGLEAPGCLEYQVRRDA
FT                   LEPDLWLVCSQWREAQQMFDYLAGGIQQVFAEVLWRSLAASLEVQDDAG"
FT   gene            complement(306896..307828)
FT                   /locus_tag="PA0272"
FT   CDS_pept        complement(306896..307828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0272"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03661"
FT                   /db_xref="GOA:Q9I6L8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L8"
FT                   /protein_id="AAG03661.1"
FT                   /translation="MLIANGLRKVDMQDLLVFLQVHQRQNLVEVAEHLNLSPSTVSYCL
FT                   KKLRQAFDDELFIATRGGMQPTHKSRAMLPHVEEMLARINACHAAQGSFDPRGEPRTFT
FT                   LCAPEYVELLILPALLRRLAANGPRIGLDIRRLGPELPTEALLDGQVDLVFDFGPEYHR
FT                   PAPELQALALFSDELLCVQDRAQPRHERLELDEFCRRRFVFPTPLDASNANLVDTWLRR
FT                   QGRSREVAARANSYVAALQLLSGSDFVLMLPRRIHALLDDGRHHACLAPPGLPPFALHL
FT                   SWSRAAEQDPANLWLREQVLIVCAELGLL"
FT   gene            complement(307878..309092)
FT                   /locus_tag="PA0273"
FT   CDS_pept        complement(307878..309092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0273"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03662"
FT                   /db_xref="GOA:Q9I6L7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L7"
FT                   /protein_id="AAG03662.1"
FT                   /translation="MPTANPPGRTLWLMAAIVLVGLNLRLSMAAVGPLLNAMRGEIALS
FT                   FGDVSLLTALPMLTLGLGMFFGLGIARRVGEWRSVALALLLIGAASALRLGSRGLPDLL
FT                   GSAMLAGLGIALIQALMPALIKARFGARTPLCMGLYVTAIMAGAALSASAAPTLAEHAG
FT                   WRLGLGAWAALAALALLAWWLQPGTRLRLPDAQPGRSLLRYPRTWLLVLFFGLGTACYT
FT                   CVLAWLAPYYLEQGWSAQESGLLLGFLTAMEVLSGLLAPALASRSRDRRPVLVGLTALM
FT                   LAGFLGLAWAPASLPLLWALCLGLGIGGLFPMGLIVCLDHFDAPQRAGQLAALVQGAGY
FT                   LIAGVSPWIAGLLRDSLGSFTGAWLGLATVAALLLGLGLRFDPRRYAALFAERQARGVG
FT                   AESLR"
FT   gene            complement(309255..310025)
FT                   /locus_tag="PA0274"
FT   CDS_pept        complement(309255..310025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0274"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03663"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L6"
FT                   /protein_id="AAG03663.1"
FT                   /translation="MLRPALPAVLCLYCLLLALPARAALDDQQRALQQLQVQACRAVGS
FT                   LLLLRGEGFQEQHAAQLEKDLASLDRALAAAPEGVLLRQGEKTLVARIREGAAYGPREE
FT                   DLPWRYPQQLSRALRDFLNLVERQVPPPPPGQPLPLWQLPVRVEYLSLQYLARAYLGGL
FT                   ETAREQPRDYLGQDESVLVPLIDRRIALLVAQSANPAGLKKLENRWEYLSQALRDLNSK
FT                   SSALVSASGRPWAPIIVDRHARALSESLMRLSAE"
FT   gene            complement(310134..310820)
FT                   /locus_tag="PA0275"
FT   CDS_pept        complement(310134..310820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0275"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03664"
FT                   /db_xref="GOA:Q9I6L5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L5"
FT                   /protein_id="AAG03664.1"
FT                   /translation="MNERTDYRSQLQAGRWFQGLPEALQTHLLALAQPRQLPPGQRLFA
FT                   RGDAPCGLYCVVEGAIRISAVSENGKEALLILVEAPHWFGEIALFDGQARTHDAYAEGH
FT                   TQLLQVPQAALLELLRREPHYWRDVALLMSHKLRLAFIALEEMALLPAAQRLARRLLML
FT                   AEGYDNSRSRQVLHLPQEQLALMLSLSRQTTNQILKDLEAQGILQLSYGGIEILDLAGL
FT                   RAATHG"
FT   gene            310896..311411
FT                   /locus_tag="PA0276"
FT   CDS_pept        310896..311411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0276"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03665"
FT                   /db_xref="GOA:Q9I6L4"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L4"
FT                   /protein_id="AAG03665.1"
FT                   /translation="MKTLVDHLAQYAAYHRDRRNIFSHFIGIPMIVLSIAVLLARPALG
FT                   FGLSPALLLALAAALFYLRLDLRFGVAMTALLALTVWGAAQLAAGTTAAWLGWGVGLFV
FT                   VGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRGDVQREVEERAGPTC
FT                   IREHKRAA"
FT   gene            complement(311451..312209)
FT                   /locus_tag="PA0277"
FT   CDS_pept        complement(311451..312209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03666"
FT                   /db_xref="GOA:Q9I6L3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L3"
FT                   /protein_id="AAG03666.1"
FT                   /translation="MKIRLSLSALALACATLAGCQNLPQGDLMQHGMMAVKAATLSDAE
FT                   VRQVADQACAESDQQNRIAPANSKYGQRLDKIAKALGDQIDGVPVNYKVYLTEEVNAWA
FT                   MANGCIRVYSGLMELMSDNEIEGVLGHEMGHVALGHTRKAAQTAYAAAAVRGAAGASKS
FT                   GALAALSGSQLGELTESLVNAQFSQSQESDADDFSYELLKKRGVNTQGLVTAFEKLAKL
FT                   GGGDSSMFDSHPGSQARADHIRQRIAADRK"
FT   gene            complement(312381..313133)
FT                   /locus_tag="PA0278"
FT   CDS_pept        complement(312381..313133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0278"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03667"
FT                   /db_xref="GOA:Q9I6L2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L2"
FT                   /protein_id="AAG03667.1"
FT                   /translation="MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPPM
FT                   QAAALLIVPSMVTNLWQLACGPRFLGLMKRLAGLLLGVVVGTLLVGAWLGGDAPRQATG
FT                   VLGLALVAYALLGLAAIPLHLPARHEPWAGPLVGLATGALTAVTGVFVIPAVPYLGALG
FT                   LQRDELVQALGLSFSASTLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLLGQWLRQ
FT                   RISATLFRRCFFVGLLLLGADLAWRGFH"
FT   gene            313227..313925
FT                   /locus_tag="PA0279"
FT   CDS_pept        313227..313925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0279"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03668"
FT                   /db_xref="GOA:Q9I6L1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6L1"
FT                   /protein_id="AAG03668.1"
FT                   /translation="MQFNPGFSSLAALLADPGRAQMIWALMDGSARPASELALLAGVSP
FT                   SSASGHLGRLVEGGVLSLEARGRNRFYRLAGPEVGQAVEALASASLALQPQRRSLPPSH
FT                   GTPSALREARTCYDHLAGELAVGVFARMLDAGWIEQEGRTLRLSATGEAGLAGLGIDLA
FT                   EVRRRRRQFACACPDWSERKPHLGGALGAALLEACLRQGWLRPQDGSRALQVSSKGRAG
FT                   LRGLAERTAG"
FT   gene            complement(313938..314927)
FT                   /gene="cysA"
FT                   /locus_tag="PA0280"
FT   CDS_pept        complement(313938..314927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PA0280"
FT                   /product="sulfate transport protein CysA"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03669"
FT                   /db_xref="GOA:Q9I6L0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6L0"
FT                   /protein_id="AAG03669.1"
FT                   /translation="MSIEIRNVSKNFNAFKALDDINLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   GERPGESAIKAKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLLDEP
FT                   FGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPASDFVYHFLGDSNRLQLGNDQHLLFRPHEVSLSRSAVAEHRAAEVRDIRPLGA
FT                   ITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
FT   gene            complement(314931..315800)
FT                   /gene="cysW"
FT                   /locus_tag="PA0281"
FT   CDS_pept        complement(314931..315800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PA0281"
FT                   /product="sulfate transport protein CysW"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03670"
FT                   /db_xref="GOA:Q9I6K9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K9"
FT                   /protein_id="AAG03670.1"
FT                   /translation="MSSASISAATASASRRGNAGGRLALIVLAWLVFALFLLLPLYVVL
FT                   SEALKQGFGTFFEAILEPDALAALKLTLIAVAISVPLNLLFGVAAAWCVSKFEFRGKSI
FT                   LVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSDHDIQIVFAVPGIVLATLFVTVPF
FT                   VARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMGEFG
FT                   AVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSESRMSR
FT                   LKSNADEE"
FT   gene            complement(315811..316629)
FT                   /gene="cysT"
FT                   /locus_tag="PA0282"
FT   CDS_pept        complement(315811..316629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PA0282"
FT                   /product="sulfate transport protein CysT"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03671"
FT                   /db_xref="GOA:Q9I6K8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K8"
FT                   /protein_id="AAG03671.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWEQ
FT                   FWAIISAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
FT   gene            complement(316791..317789)
FT                   /gene="sbp"
FT                   /locus_tag="PA0283"
FT   CDS_pept        complement(316791..317789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PA0283"
FT                   /product="sulfate-binding protein precursor"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03672"
FT                   /db_xref="GOA:Q9I6K7"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K7"
FT                   /protein_id="AAG03672.1"
FT                   /translation="MSLRRFALAALASALVSGPVAAATQLLNVSYDPTRELYQAYNAAF
FT                   IKHWKAQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELHKLGKLLPADW
FT                   QARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVEVITPNPKTSGGARWNFLAAW
FT                   AWAKKQYGSDEKAKDYVQALYKHVPVLDTGARGSTITFVNNQIGDVLLAWENEAFLAKK
FT                   EQGGENFEIVVPSISILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIAAQNFY
FT                   RPRNQKVAAEFATQFPKLNLVTVDSDFGGWKTAQPKFFNDGGIFDQIYQAQ"
FT   gene            complement(317966..318148)
FT                   /locus_tag="PA0284"
FT   CDS_pept        complement(317966..318148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0284"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03673"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K6"
FT                   /protein_id="AAG03673.1"
FT                   /translation="MSATLRSLDGQDEATILREIQSALRGLRFGAVEITVHNGQVVQIE
FT                   RKEKFRLQQPAVKQA"
FT   gene            complement(318312..320594)
FT                   /locus_tag="PA0285"
FT   CDS_pept        complement(318312..320594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03674"
FT                   /db_xref="GOA:Q9I6K5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K5"
FT                   /protein_id="AAG03674.1"
FT                   /translation="MSPRLSALRLSLAYLAIAIAWAFLSDHLLQNQVQDHDQLVFWMTA
FT                   KRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLVTDRM
FT                   FVSPGYAALIGLAPEELGDPIETWKKRLHPEEYATVLEAHRNHLQGLTDNLDHIYRLRH
FT                   KDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRLKEDHLRQAAAVFDSTREGVLVT
FT                   DAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDVWSGEI
FT                   WNRRKSGEIYPQWLHIRAVRNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHDSLTGLP
FT                   NRVLLRERIEQALENGKDRTVAGALLLIDLDHFKHINDSLGHTTGDMLLKEVSKRLQHQ
FT                   LDERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYISASLGVSL
FT                   YPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARARAHVQVESALRHALEHDE
FT                   LRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIAALDNWVLKRA
FT                   CRQMREWQQRGVELEFVAVNVSSRLFNRGGLEERIANALEESGLEPRYLELEVTESAVM
FT                   EDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKRLPVHKLKIDQGFVAGLPGAVDD
FT                   AAIARAIVALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYGRPQPAEALRFDLP
FT                   PVALPED"
FT   gene            320766..321944
FT                   /gene="desA"
FT                   /locus_tag="PA0286"
FT   CDS_pept        320766..321944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="desA"
FT                   /locus_tag="PA0286"
FT                   /product="delta-9 fatty acid desaturase, DesA"
FT                   /note="Class 1: Function experimentally demonstrated in P.
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PA0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03675"
FT                   /db_xref="GOA:Q9I6K4"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K4"
FT                   /protein_id="AAG03675.1"
FT                   /translation="MWFNGFLDLSPWQLVAVTLVLTHITIVSVTVYLHRYSAHRALDLH
FT                   PALQHFFRFWLWLTTGMNTREWTAIHRKHHAKCETVEDPHSPVHKGLFTVLRAGAELYK
FT                   AEAKNQDTLRIYGKNCPDDWIERNLYSRFPIGGVVLMALIDLALFGALGLTVWAVQMVW
FT                   IPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKLSVKK
FT                   WEFDLGWAWIKLFSFLRLARVARVAPIAHRVEGKHSLDMDTAMAILNNRFQIMAQYRKL
FT                   VIAPLVKQEVAKADESVRHLFRRAKRLLSRETSLLQDRHHVRIDSMLAHSQALKVIYEK
FT                   RLALQQIWAKTSANGHDMLAAIKDWVHEAEASGIQSLKEFAAQLKTYSLRPA"
FT   gene            322175..323560
FT                   /gene="gpuP"
FT                   /locus_tag="PA0287"
FT   CDS_pept        322175..323560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpuP"
FT                   /locus_tag="PA0287"
FT                   /product="3-guanidinopropionate transport protein"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03676"
FT                   /db_xref="GOA:Q9I6K3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K3"
FT                   /protein_id="AAG03676.1"
FT                   /translation="MLLDYLIMLVYALAMLGLGWYGMRKAKSQSDFLVAGRRLGPGLYL
FT                   GTMAAVVLGGASTIGTVKLGYQFGLSGLWLVFMLGLGIIVLSLVFSRQIARLRVFTVTQ
FT                   VLEQRYQASSRLIGGVVMVAYDLMVAVTATIAIGSVTEVVFGIPRIPAILCGGGIVIVY
FT                   SVIGGMWSLTLTDIIQFVIKTVGIFLVLLPLSIDGAGGLARMQEVLPAGFFDLGHIGLD
FT                   TILTYFLLYFFGALIGQDIWQRVFTARSETVVRYAGLGAGVYCMLYGAACALIGAAARV
FT                   LLPDLAVPENAYAEITREVLAPGLRGLVVAAALSAIMSTASGCLLAAATVLQEDIYARF
FT                   LRPGTTSDIRLSRCITLLMGVAMLVLACLVNDVIAALSIAYNLLVGGLLVPIVGALLWR
FT                   RASPQGAIASIVAGCLAVIACMARDGLLANSPIVYGLLASLATFVAVSLATRPAASLRA
FT                   QPE"
FT   gene            323616..324572
FT                   /gene="gpuA"
FT                   /locus_tag="PA0288"
FT   CDS_pept        323616..324572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpuA"
FT                   /locus_tag="PA0288"
FT                   /product="3-guanidinopropionase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03677"
FT                   /db_xref="GOA:Q9I6K2"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="PDB:3NIP"
FT                   /db_xref="PDB:3NIQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6K2"
FT                   /protein_id="AAG03677.1"
FT                   /translation="MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWD
FT                   GGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRR
FT                   IEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPY
FT                   THGTPFRRAIEEGLLDPLRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEAT
FT                   LAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGAD
FT                   VVEVSPPFDVGGATALVGATMMFELLCLLAESAARSA"
FT   gene            324625..325587
FT                   /gene="gpuR"
FT                   /locus_tag="PA0289"
FT   CDS_pept        324625..325587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpuR"
FT                   /locus_tag="PA0289"
FT                   /product="transcriptional activator GpuR"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03678"
FT                   /db_xref="GOA:Q9I6K1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K1"
FT                   /protein_id="AAG03678.1"
FT                   /translation="MGAGMLGNINDIDLRMLRTFCAIVEAGGFTAAQARLNTSLSRLSV
FT                   LVRDLEVRLGYSLCRRGNGGFQLTEEGQELYDAALGLFSDIARFREQVRGLGGRDREAL
FT                   HLGCVDGVIGQHCLPLPLAIRLFRQRAPEVLLKLHTRRPDELEHAVLEERLQLAVGAFH
FT                   HRLSGLYYQPLFREEQNLYCGSAHPFFARADDEPTLGEICAADYVGRGYMAENHRPHDL
FT                   RFNQGTDAYTMEAIATLVFSGTYIGYLPTHYAATWVAEGRMRAIRPRQLAYDSEFHCIT
FT                   RQGHEERPTLTLFLRSLFEAQKQLGVQVPANTNGIARQL"
FT   gene            325700..326671
FT                   /locus_tag="PA0290"
FT   CDS_pept        325700..326671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0290"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03679"
FT                   /db_xref="GOA:Q9I6K0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6K0"
FT                   /protein_id="AAG03679.1"
FT                   /translation="MDDLTGIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNSV
FT                   LWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLLQVLERG
FT                   AVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKHMESELQRLAT
FT                   TDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQVLQR
FT                   IAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEGEHSFG
FT                   ITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
FT   gene            327284..328666
FT                   /gene="oprE"
FT                   /locus_tag="PA0291"
FT   CDS_pept        327284..328666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprE"
FT                   /locus_tag="PA0291"
FT                   /product="Anaerobically-induced outer membrane porin OprE
FT                   precursor"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03680"
FT                   /db_xref="GOA:G3XDA5"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="PDB:4FRX"
FT                   /db_xref="UniProtKB/TrEMBL:G3XDA5"
FT                   /protein_id="AAG03680.1"
FT                   /translation="MKSRKINKSRLALAITAGTLGALAQQAVAAGFIEDSKASLTLRNF
FT                   YINTDNRNGTASPSKQEEWGQGFILNYQSGFTQGTVGFGVDALGLLGVRLDGGGRAGKS
FT                   GLDRQPGTVFPLESNGEPVHDFASLGLTAKAKVSNTEFRYGTLQPKLPVVTYNDGRLLP
FT                   VTFEGGQVTSTDLKDFTLVAGQLEHSKGRNSTDNRSLSIAGANGSSASSRDSNKFYYAG
FT                   GDYKVNKDLTLQYYYGNLDDFYKQHFLGLIHNWQIGPGVLKTDLRAFDSSSDGKNGSRS
FT                   GRADGYVSSGYYGSGVTKGEVDNRAFSGLFTYTVSGHSIGAGYQILNGDSDFPFLNRGD
FT                   GEGSTAYLITDVQIGKFQRAGERTWQVRYGYDFATVGVPGLTFNTIYLSGDKIKTARGD
FT                   QSEWERDISLAYVIPDGTFKGLGFTWKNASFRSGLPAAGSSNNQRDQDENRLIVSYTLP
FT                   LL"
FT   gene            complement(328801..329907)
FT                   /gene="aguA"
FT                   /locus_tag="PA0292"
FT   CDS_pept        complement(328801..329907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguA"
FT                   /locus_tag="PA0292"
FT                   /product="agmatine deiminase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03681"
FT                   /db_xref="GOA:Q9I6J9"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6J9"
FT                   /protein_id="AAG03681.1"
FT                   /translation="MSNPTSTPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQA
FT                   AFAAVAKAIARFEPVTVCASAGQYENARARLDDGNIRVVEISSDDAWVRDTGPTFVIDD
FT                   KGDVRGVDWGFNAWGGFEGGLYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSIHVD
FT                   GEGTLITTEECLLNHNRNPHLSQAEIERTLRDYLAVESIIWLPNGLYNDETDGHVDNFC
FT                   CYARPGEVLLAWTDDQDDPNYLRCQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEE
FT                   CDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIIAPSFDDPKDAEARAILQRVFPEHEV
FT                   VMVPGREILLGGGNIHCITQQQPAPRKA"
FT   gene            complement(329993..330871)
FT                   /gene="aguB"
FT                   /locus_tag="PA0293"
FT   CDS_pept        complement(329993..330871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguB"
FT                   /locus_tag="PA0293"
FT                   /product="N-carbamoylputrescine amidohydrolase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03682"
FT                   /db_xref="GOA:Q9I6J8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6J8"
FT                   /protein_id="AAG03682.1"
FT                   /translation="MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQEL
FT                   FETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAV
FT                   IDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESA
FT                   RSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQD
FT                   GYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYG
FT                   PLKTLDGSLES"
FT   gene            complement(331034..331699)
FT                   /gene="aguR"
FT                   /locus_tag="PA0294"
FT   CDS_pept        complement(331034..331699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguR"
FT                   /locus_tag="PA0294"
FT                   /product="transcriptional regulator AguR"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03683"
FT                   /db_xref="GOA:Q9I6J7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6J7"
FT                   /protein_id="AAG03683.1"
FT                   /translation="MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLSIYSVAER
FT                   AEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERMLA
FT                   VYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLA
FT                   MELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLSGFISDLNR"
FT   gene            complement(331762..332823)
FT                   /locus_tag="PA0295"
FT   CDS_pept        complement(331762..332823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0295"
FT                   /product="probable periplasmic polyamine binding protein"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03684"
FT                   /db_xref="GOA:Q9I6J6"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6J6"
FT                   /protein_id="AAG03684.1"
FT                   /translation="MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTG
FT                   IRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDR
FT                   QLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKS
FT                   CGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLE
FT                   GGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYL
FT                   MQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPV
FT                   VDEIWKAFRGASH"
FT   gene            complement(333079..334455)
FT                   /gene="spuI"
FT                   /locus_tag="PA0296"
FT   CDS_pept        complement(333079..334455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuI"
FT                   /locus_tag="PA0296"
FT                   /product="probable glutamine synthetase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03685"
FT                   /db_xref="GOA:Q9I6J5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6J5"
FT                   /protein_id="AAG03685.1"
FT                   /translation="MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERN
FT                   SLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPT
FT                   AQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQP
FT                   PRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLN
FT                   HVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNI
FT                   FTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTV
FT                   ALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQME
FT                   PSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
FT                   "
FT   gene            334734..335486
FT                   /gene="spuA"
FT                   /locus_tag="PA0297"
FT   CDS_pept        334734..335486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuA"
FT                   /locus_tag="PA0297"
FT                   /product="probable glutamine amidotransferase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03686"
FT                   /db_xref="GOA:Q9I6J4"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6J4"
FT                   /protein_id="AAG03686.1"
FT                   /translation="MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPA
FT                   LGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAID
FT                   AGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPG
FT                   GVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHP
FT                   EWQVLTNPNYLAIFQAFGKACSKRAGQR"
FT   gene            335527..336885
FT                   /gene="spuB"
FT                   /locus_tag="PA0298"
FT   CDS_pept        335527..336885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuB"
FT                   /locus_tag="PA0298"
FT                   /product="probable glutamine synthetase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03687"
FT                   /db_xref="GOA:Q9I6J3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6J3"
FT                   /protein_id="AAG03687.1"
FT                   /translation="MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEK
FT                   GMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHD
FT                   TFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRS
FT                   GRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALD
FT                   LADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADG
FT                   TMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPD
FT                   SSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLT
FT                   IEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV"
FT   gene            336951..338321
FT                   /gene="spuC"
FT                   /locus_tag="PA0299"
FT   CDS_pept        336951..338321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuC"
FT                   /locus_tag="PA0299"
FT                   /product="putrescine aminotransferase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03688"
FT                   /db_xref="GOA:Q9I6J2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6J2"
FT                   /protein_id="AAG03688.1"
FT                   /translation="MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGV
FT                   YIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAK
FT                   AIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAG
FT                   VSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEEN
FT                   VAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYG
FT                   NAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIR
FT                   ILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDK
FT                   GVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA"
FT   gene            338437..339540
FT                   /gene="spuD"
FT                   /locus_tag="PA0300"
FT   CDS_pept        338437..339540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuD"
FT                   /locus_tag="PA0300"
FT                   /product="polyamine transport protein"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03689"
FT                   /db_xref="GOA:Q9I6J1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="PDB:3TTK"
FT                   /db_xref="PDB:3TTM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6J1"
FT                   /protein_id="AAG03689.1"
FT                   /translation="MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLE
FT                   KFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKL
FT                   PNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFK
FT                   PENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFH
FT                   SSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPK
FT                   DAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMK
FT                   KLYTFPDLPAKTQRAMTRSWTKIKSGK"
FT   gene            339959..341056
FT                   /gene="spuE"
FT                   /locus_tag="PA0301"
FT   CDS_pept        339959..341056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuE"
FT                   /locus_tag="PA0301"
FT                   /product="polyamine transport protein"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03690"
FT                   /db_xref="GOA:Q9I6J0"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="PDB:3TTL"
FT                   /db_xref="PDB:3TTN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6J0"
FT                   /protein_id="AAG03690.1"
FT                   /translation="MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKD
FT                   FTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLP
FT                   NWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPE
FT                   NMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSS
FT                   KYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADA
FT                   KAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKL
FT                   YVSAVLPAKVLRLQTRTWTRIKTGK"
FT   gene            341111..342265
FT                   /gene="spuF"
FT                   /locus_tag="PA0302"
FT   CDS_pept        341111..342265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuF"
FT                   /locus_tag="PA0302"
FT                   /product="polyamine transport protein PotG"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03691"
FT                   /db_xref="GOA:Q9I6I9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I9"
FT                   /protein_id="AAG03691.1"
FT                   /translation="MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTI
FT                   NKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYA
FT                   LFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQR
FT                   IAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENP
FT                   IYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVY
FT                   YIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
FT   gene            342292..343173
FT                   /gene="spuG"
FT                   /locus_tag="PA0303"
FT   CDS_pept        342292..343173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuG"
FT                   /locus_tag="PA0303"
FT                   /product="polyamine transport protein PotH"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03692"
FT                   /db_xref="GOA:Q9I6I8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I8"
FT                   /protein_id="AAG03692.1"
FT                   /translation="MPTGRHAVIGVPFLWLFLFFLLPFAIVLKISLAEADVAIPPYTEI
FT                   FAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFISTLICLLVGYPMAYAIARSS
FT                   QSSQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGLISEPLTILNTNIAV
FT                   YIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKITVPLSKNGIIAGCM
FT                   LVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLAILIIPIILF
FT                   NKNQAKELEGKV"
FT   gene            343256..344125
FT                   /gene="spuH"
FT                   /locus_tag="PA0304"
FT   CDS_pept        343256..344125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuH"
FT                   /locus_tag="PA0304"
FT                   /product="polyamine transport protein PotI"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03693"
FT                   /db_xref="GOA:Q9I6I7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I7"
FT                   /protein_id="AAG03693.1"
FT                   /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSVK
FT                   WYVGLLDNTQLVSSVGRSLEIAFYTAFSSVFLGTLAAFVLTRIPRFRGRTLFGGMVTAP
FT                   LVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRELDL
FT                   SIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLP
FT                   MEVFSAVRLGVKPEINAVASLILLSVSLFTFFAWYFTRQAEERRRRAIQQAMEETATDW
FT                   QKGSPTPA"
FT   gene            complement(344303..346690)
FT                   /locus_tag="PA0305"
FT   CDS_pept        complement(344303..346690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0305"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03694"
FT                   /db_xref="GOA:Q9I6I6"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I6"
FT                   /protein_id="AAG03694.1"
FT                   /translation="MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDV
FT                   RYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRL
FT                   FRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTP
FT                   EDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGD
FT                   WKDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYE
FT                   AQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNPNQVWYQ
FT                   GEWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENP
FT                   VLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSF
FT                   ILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWL
FT                   DTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWN
FT                   GDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDSLIATRAIDSALPRLAGDADSPWW
FT                   DDRRTERRETRADIVRTAWNASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQALLRR
FT                   LLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGV
FT                   PFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR"
FT   gene            346801..347853
FT                   /locus_tag="PA0306"
FT   CDS_pept        346801..347853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0306"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03695"
FT                   /db_xref="GOA:Q9I6I5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I5"
FT                   /protein_id="AAG03695.1"
FT                   /translation="MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLP
FT                   PPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEAL
FT                   RSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISD
FT                   DEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHDV
FT                   LTRHAEEQSRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGAS
FT                   FRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAK
FT                   REEGYSTSGT"
FT   gene            complement(348440..349051)
FT                   /locus_tag="PA0307"
FT   CDS_pept        complement(348440..349051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0307"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03696"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I4"
FT                   /protein_id="AAG03696.1"
FT                   /translation="MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYI
FT                   RPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGV
FT                   EFHVLQKPGSQGRLPDNLAALRALAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAV
FT                   CTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG"
FT   gene            349050..350069
FT                   /locus_tag="PA0308"
FT   CDS_pept        349050..350069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0308"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03697"
FT                   /db_xref="GOA:Q9I6I3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I3"
FT                   /protein_id="AAG03697.1"
FT                   /translation="MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAA
FT                   AEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGY
FT                   YDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAEL
FT                   DLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPF
FT                   VDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLV
FT                   VQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA"
FT   gene            complement(350089..350841)
FT                   /locus_tag="PA0309"
FT   CDS_pept        complement(350089..350841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0309"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I2"
FT                   /protein_id="AAG03698.1"
FT                   /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQ
FT                   KRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVV
FT                   AAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADS
FT                   LSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFA
FT                   ESPAGRSYYQAALAALKAGLAVDQAVAP"
FT   gene            350890..351588
FT                   /locus_tag="PA0310"
FT   CDS_pept        350890..351588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0310"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03699"
FT                   /db_xref="GOA:Q9I6I1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I1"
FT                   /protein_id="AAG03699.1"
FT                   /translation="MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGW
FT                   SHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESE
FT                   ACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVL
FT                   YLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFR
FT                   RRNESLLQLS"
FT   gene            complement(351610..352164)
FT                   /locus_tag="PA0311"
FT   CDS_pept        complement(351610..352164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0311"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03700"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6I0"
FT                   /protein_id="AAG03700.1"
FT                   /translation="MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISL
FT                   RLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIF
FT                   GVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNS
FT                   IGRIELRDITDLRGTIKVWGH"
FT   gene            352430..352924
FT                   /locus_tag="PA0312"
FT   CDS_pept        352430..352924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03701"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H9"
FT                   /protein_id="AAG03701.1"
FT                   /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVA
FT                   GGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAV
FT                   LKARSPSCGNLENYDGRFNGNRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAG
FT                   G"
FT   gene            complement(352927..353619)
FT                   /locus_tag="PA0313"
FT   CDS_pept        complement(352927..353619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0313"
FT                   /product="L-cysteine transporter of ABC system YecS"
FT                   /note="Class 3: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   sequence similarity to an experimentally studied gene"
FT                   /db_xref="EnsemblGenomes-Gn:PA0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03702"
FT                   /db_xref="GOA:Q9I6H8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H8"
FT                   /protein_id="AAG03702.1"
FT                   /translation="MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGLI
FT                   LGFSVAVVRVTKVPVVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGILA
FT                   LTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLSNSL
FT                   ISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQKALEN
FT                   RLTAPLRR"
FT   gene            complement(353691..354461)
FT                   /locus_tag="PA0314"
FT   CDS_pept        complement(353691..354461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0314"
FT                   /product="L-cysteine transporter of ABC system FliY"
FT                   /note="Class 3: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   sequence similarity to an experimentally studied gene"
FT                   /db_xref="EnsemblGenomes-Gn:PA0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03703"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H7"
FT                   /protein_id="AAG03703.1"
FT                   /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFNF
FT                   KQGGKLTGFETELGELLAAELAVKPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQRRK
FT                   VFDFSEPYTISSAQLIVRADETRQFKSLEDLKGLKLGVGQGTNYADLAKSVAGVNVRTY
FT                   PGAPEYLQDLASKRIDAALNDRLLIPFAIREAKLPVKPGAAVGPVANMAIPYRKNNPKF
FT                   GEALNAALEKIKADGRFAKLSEKWFGLDVSQPPK"
FT   gene            354754..355191
FT                   /locus_tag="PA0315"
FT   CDS_pept        354754..355191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0315"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03704"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H6"
FT                   /protein_id="AAG03704.1"
FT                   /translation="MRVTLPCLGLAALMFGASASLMAADLPRTKAPEGAKVYFITPADG
FT                   ATVDKTFTVKFGLKGMGVAPAGVDMPDTGHHHLLVDLKEQPAMNLPLPMTDNIRHFGKG
FT                   QTETEITLPPGKHTLQLLVGDKNHVPLEPTVESEKITVTVK"
FT   gene            complement(355248..356477)
FT                   /gene="serA"
FT                   /locus_tag="PA0316"
FT   CDS_pept        complement(355248..356477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="PA0316"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03705"
FT                   /db_xref="GOA:Q9I6H5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H5"
FT                   /protein_id="AAG03705.1"
FT                   /translation="MSKTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKTALSGD
FT                   ELKERIADAHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVFNA
FT                   PYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYGSIG
FT                   TQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGSLHELLGMSDIVSLHVPELPSTQWMIG
FT                   EKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEEFASPL
FT                   RGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPSHPGKHR
FT                   LLHIHANIPGVMSEINKVFADNGINVSGQYLQTNEKVGYVVIDVDAEYSDLALEKLQQV
FT                   NGTIRSRVLF"
FT   gene            356681..358075
FT                   /locus_tag="PA0317"
FT   CDS_pept        356681..358075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0317"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03706"
FT                   /db_xref="GOA:Q9I6H4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H4"
FT                   /protein_id="AAG03706.1"
FT                   /translation="MTREALIESLKPLVEPGKLLDDAASLDAYGKDWTKHFAPAPLAIV
FT                   FPKSVEQVQAIVRWANQHKVGLVPSGGRTGLSAAAVAANGEVVVAFDYMNRILDFNAFD
FT                   RTVVCQPGVVTKQLQTFAEENGLYYPVDFASSGSSQIGGNIGTNAGGIKVIRYGMTRNW
FT                   VAGMKVVTGKGDLLELNKDLIKNATGYDMRQLFIGAEGTLGFVVEATMRLERTPKNLTA
FT                   MVLGTPDFDSIMPVLHAFQSKLDLTAFEFFSDKALAKVLARGDVPRAFETDCPFYALLE
FT                   FEATTEEVANEALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLREYISETISHWTPYKN
FT                   DISVTVSRVPAFLKDIDAIVEANYPDFEVVWFGHIGDGNLHLNILKPENLGKDEFFAKC
FT                   ATVNKWVFETVEKYNGSISAEHGVGMTKRDYLTYTRSETEIAYMKALKAVFDPNGIMNP
FT                   GKIFAE"
FT   gene            358167..358832
FT                   /locus_tag="PA0318"
FT   CDS_pept        358167..358832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03707"
FT                   /db_xref="GOA:Q9I6H3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H3"
FT                   /protein_id="AAG03707.1"
FT                   /translation="MSYQHQYIDGTPIHFPLGKLVCVGRNYAEHAKELNNPVPTEPLLF
FT                   IKPGSCVVPVSGGLSLPQERGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPALDL
FT                   TLREVQAKLKEKGLPWELAKSFDGAGVLSPFVNADQFPDPTDIGIRLTINGEVRQDGNS
FT                   RDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLNSGDELLLELPGASRFETRVL"
FT   gene            358931..359920
FT                   /locus_tag="PA0319"
FT   CDS_pept        358931..359920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0319"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03708"
FT                   /db_xref="GOA:Q9I6H2"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H2"
FT                   /protein_id="AAG03708.1"
FT                   /translation="MPFHGDAQENTWPNSRASPMSLASKLPRFRWLLPAFVVLVGVVLT
FT                   IVMHWDDRAGLWWKESQASQQQRDESIWLPGYRVVIDAKPLQGLEEEETSDLAYNPATR
FT                   TLFTVTGKRPLLVELSLTGDVLRTIPLLGLSNPEGVAVLENGNVAVTDERRNTLTIFHV
FT                   DPQTAELSTKSLAEFPLGNIGKKNKGFEGIAWDPRQQRLLLSKERDPMTLFSWKSDGGP
FT                   SLSGAMTALPSDDLYMRNVSALSVDPRTGHTLVLSAESHLLLELDEKGEPVSFISLLGG
FT                   FNGLDSKIPRAEGVAIDDEGTIYMVSEPNLFYVFRKKSGERLATSDAD"
FT   gene            359982..360332
FT                   /locus_tag="PA0320"
FT   CDS_pept        359982..360332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03709"
FT                   /db_xref="GOA:Q9I6H1"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6H1"
FT                   /protein_id="AAG03709.1"
FT                   /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAADD
FT                   TPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTRVKLTGEVDRDLVG
FT                   REIDVEFVEVIK"
FT   gene            complement(360413..361447)
FT                   /locus_tag="PA0321"
FT   CDS_pept        complement(360413..361447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0321"
FT                   /product="probable acetylpolyamine aminohydrolase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03710"
FT                   /db_xref="GOA:Q9I6H0"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6H0"
FT                   /protein_id="AAG03710.1"
FT                   /translation="MLTIYSDDHRLHHGRHELIGGQFTPCFEKPSRADMVLDRVKAVGL
FT                   GEVRAPRDFGLEPIRRVHSEGFVRFLQNAWQDWLATGRSHDMLPIAWPTRRLRQTEPDN
FT                   IDGRLGYYSFDAGAPITAGTWQAITSSANVALSGQSELANGARSVFSLCRPPGHHAAAD
FT                   YMGGYCFFNNAAIAAQAFLDRGAGRVAILDVDYHHGNGTQDIFYDRADVLFTSIHGDPR
FT                   FEYPYFLGYADEKGNGVGTGYNFNYPLAAGSDWATWSQALQAAIRQIQAYAADALIVSL
FT                   GVDTFKEDPISQFRLDSPDYLRMGEAIGKLGLATLFVMEGGYAVEEIGINAVNVLQGFE
FT                   GVHR"
FT   gene            complement(361463..362857)
FT                   /locus_tag="PA0322"
FT   CDS_pept        complement(361463..362857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0322"
FT                   /product="probable transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03711"
FT                   /db_xref="GOA:Q9I6G9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6G9"
FT                   /protein_id="AAG03711.1"
FT                   /translation="MASERNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYMV
FT                   PLTMFTTYGVVTEITGGRTASAYLITLAAMLFTAFSYSFMVKKYPIAGSAYSYTSLSFG
FT                   PCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLAAIGLVTVLNVIGIS
FT                   SVAGMSNVIVGAQFVFAVVFVAMAVKHLAGIPSLDLSLPFVGDGSQPGFAPLMAGAAVL
FT                   CLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSVFQDAE
FT                   SAANEVMLAAGGKFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPRRVFGSL
FT                   SERFKTPVIAILVVSVISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSYLLLDGRR
FT                   APRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLTWFAAGLAYLALHTGGFRRKAPTV
FT                   TFSEQN"
FT   gene            complement(363278..364321)
FT                   /locus_tag="PA0323"
FT   CDS_pept        complement(363278..364321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0323"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03712"
FT                   /db_xref="GOA:Q9I6G8"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6G8"
FT                   /protein_id="AAG03712.1"
FT                   /translation="MTYRTPLTLLFAAGLALGGQARAEGTLHFANWSDYYPPELLKKFE
FT                   KDTGIKATLDAYDSNETLLAKLKAGGGAYDVVVPSDSFIEIFVKEGLLQKLDKSQLPSL
FT                   GNLKENFRTLGFDPGHDYSIPYLWGTTGYSYDTAKVPGGRLEESWKPFFEPPAELKGKV
FT                   VALNSIEELFIPATYYLGIDECTEDAREAQKVLDLLLRQKPALAMYNSDGTIERMAAGE
FT                   VAMHQQWNGAFHRAHAQRASLEYVYPKEGIRLFIDNFAIPRDASNVKEAHVFIDWMMRP
FT                   ENIAAASNFAKYNNAIVGSEKFMEKALFDDPAINTPQDKLDRLKPFKLCSPKALALRSK
FT                   VWTKLKK"
FT   gene            complement(364369..365157)
FT                   /locus_tag="PA0324"
FT   CDS_pept        complement(364369..365157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0324"
FT                   /product="probable permease of ABC transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03713"
FT                   /db_xref="GOA:Q9I6G7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6G7"
FT                   /protein_id="AAG03713.1"
FT                   /translation="MNGRNPLWTFSGVRQAAWLFFAFLYIPILVLVVLSFNSGQSATLW
FT                   ESFSLKWYAVVANDPEILRAAKNSLLVATLATLASTVLATLAALGMRGRAFRGQTLMNG
FT                   VLGLPLLVPEIVTAVATLMFFSFIGLKLSLFTILIAHIVFCIPFAYLPIRARLEGLDPR
FT                   LAEAAADLYASPWKAFWKITLPLLMPGVLSGAMLAFIISMDDFVITYFVAGAGATTLPV
FT                   YIFSSIRMGISPKINAISSIILMISIAFVALSYYLGQRRR"
FT   gene            complement(365154..366083)
FT                   /locus_tag="PA0325"
FT   CDS_pept        complement(365154..366083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0325"
FT                   /product="probable permease of ABC transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03714"
FT                   /db_xref="GOA:Q9I6G6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6G6"
FT                   /protein_id="AAG03714.1"
FT                   /translation="MSTAGRPTAQQSAERRQLRRRLLLSSPAMLMLVLFLVIPLGIMFA
FT                   VSIQQSGDYGGVKWGQHSLEAYLNFLWERDLDDSLVFNADYLGIFQRSFWLSLLTTLGC
FT                   LALGFPTALYLALQPERRRNLLLFLVTVPFWTNLLVRVYAWILLLRNGGLVDAGLQGIG
FT                   LTDTGLGLLYTDNAVIIGLLYTYLPFMVLPIYSSLEKMDWRLVEAAFDLGANRWKALRR
FT                   VIVPLAMPGIVAGCILVFIPALGSYIIPELLGGGKALMIGNLIQLQFGTAHNWPFGAAL
FT                   SFALLAFVLLAMLIYNLRFRANAGGGQP"
FT   gene            complement(366080..367129)
FT                   /locus_tag="PA0326"
FT   CDS_pept        complement(366080..367129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0326"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03715"
FT                   /db_xref="GOA:Q9I6G5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6G5"
FT                   /protein_id="AAG03715.1"
FT                   /translation="MTSAIAIERICMEFGTPGQGLKALDDVSLDIHANEFFTLLGPSGC
FT                   GKTTLLRLIAGFEQPSSGSIRLYGEHMEGLPPFRRPVNTVFQSYALFPHMSVADNIGFG
FT                   LEMQGRPRSEIDATVSRMLDLVKLPEVGKRRADQLSGGQQQRIALARALASRPKVLLLD
FT                   ESLSALDLKLRKEMQIELKRLQHETGITFIFVTHDQEEALTMSDRIAVMSKGKVLQVGT
FT                   PSDIYEAPLNRAVADFIGETNFLEGQADADGVRLADGQRLAATTPGSGAVTLAIRPERT
FT                   ELAADGQLEGVLENIVYVGTDTVYHLNVAGQPGFRVRQQNRDGARCPHSPGAKVRVRIP
FT                   AAAIRVLAE"
FT   gene            367457..368422
FT                   /locus_tag="PA0327"
FT   CDS_pept        367457..368422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0327"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03716"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6G4"
FT                   /protein_id="AAG03716.1"
FT                   /translation="MTIHAQTPEPFSMSRAFTPRRLLLAVLLVALSALVLLGQSFRVFD
FT                   RAWFAVQEWRHADAWKERSIWLPDYRVRIEAQPIEGLNDDVSALTFDPDRRTLFTVTNQ
FT                   PAQIIELSLQGKVLRTIPLTGFGDAEAIEYISRGVYVITDERQQRLVKVRLEDDTRFID
FT                   AADAQQLSLGIGLNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADKPFAV
FT                   HVVDDPGRDKRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDTDGEPVSTLSLLRGMH
FT                   GLKRSVPQAEGVAMDDRGVLYLVSEPNLFYVFSKDEPAQP"
FT   gene            complement(368462..370405)
FT                   /locus_tag="PA0328"
FT   CDS_pept        complement(368462..370405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0328"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03717"
FT                   /db_xref="GOA:Q9I6G3"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6G3"
FT                   /protein_id="AAG03717.1"
FT                   /translation="MFKPLAVAVGLGCAALSLGANAYQYGEYAGETLERLITDYPGRYR
FT                   GTASFAGASKLMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKFLVLGAHYDTY
FT                   YGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVESLDA
FT                   SQRANLLGMINLDSLVTGDKMYAHAGSNSVSNPALGAYREQILRIARELDIPLFTNPGL
FT                   NAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDNPAIPGGSTWHDPAE
FT                   DNKEVLTNALGQERIEQRMRDFSRLLTRLVLEQTNADLLASTASGGALARQMEDQLQRQ
FT                   HQALTRLHDRRWLTLLGSNRPVGSFDGEVGAEGEVSPDSGFDMPGNPESRRAGVHLLGD
FT                   YRYSEALTLGGSLAFQRSRDKLDHGGRIEGDTWQLGLFGLYNDGGPEWLAGELNLGHTR
FT                   YDSKRSVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGPLAGLDYMHY
FT                   RIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYASLRWVRELAD
FT                   GRLDDMDLTSRGDGRVRVADMGGVDKDFGRAQLGAQLAITEQLGVFAEANSRFAHSEGN
FT                   QAGYSLGVNWQF"
FT   gene            complement(370706..371038)
FT                   /locus_tag="PA0329"
FT   CDS_pept        complement(370706..371038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03718"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6G2"
FT                   /protein_id="AAG03718.1"
FT                   /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALGGIES
FT                   VRKNSQRDGAFEVKPANNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRATPEA
FT                   GLSDES"
FT   gene            complement(371162..371833)
FT                   /gene="rpiA"
FT                   /locus_tag="PA0330"
FT   CDS_pept        complement(371162..371833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="PA0330"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03719"
FT                   /db_xref="GOA:Q9I6G1"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="PDB:4X84"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6G1"
FT                   /protein_id="AAG03719.1"
FT                   /translation="MNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALAR
FT                   HKAEFDGAVASSEATAKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGAAL
FT                   TREKIVAAVAKTFICIADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVYREG
FT                   VLTDNGNIILDVHNLRIDSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGVKTLK
FT                   A"
FT   gene            372091..373605
FT                   /gene="ilvA1"
FT                   /locus_tag="PA0331"
FT   CDS_pept        372091..373605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA1"
FT                   /locus_tag="PA0331"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03720"
FT                   /db_xref="GOA:Q9I6G0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6G0"
FT                   /protein_id="AAG03720.1"
FT                   /translation="MLEQYVKKILTSRVYDVAVETPLQPARQLSERLGNQVLLKREDLQ
FT                   PVFSFKIRGAYNKVAQLTEEEKARGVIAASAGNHAQGLALAAKRQGIRAVIVMPKTTPE
FT                   IKVQAVRAHGAKAVLHGDAFPEALAHALKLVDEKGYTFVHPYDDPDTIAGQGTVAMEIL
FT                   RQQPGRLDAIFVPVGGGGLVAGIAAYVKYLRPEIKVIGVEPDESNCLQAAMAAGERVVL
FT                   GQVGLFADGVAVAQIGQHTFDICKDHVDEVITVSTDEICAAIKDIYDDTRSITEPAGAL
FT                   AVAGIKKYVERERAEGQTLVAIDSGANVNFDRLRHVAERAELGERREAIIAVTIPERPG
FT                   SFKAFCEAVGKRQITEFNYRYHSGSEAHIFVGVQTHPENDPREALVAYLREKGFPVLDL
FT                   TDNELAKLHIRHMVGGHAVKVSDEMVFRFEFPERPGALFNFLTKLGGRWNISMFHYRNH
FT                   GAADGRVVAGLQVPEDERHLIPQTLEAIGYPYWDETANPAYQLFLG"
FT   gene            373725..374192
FT                   /locus_tag="PA0332"
FT   CDS_pept        373725..374192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0332"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03721"
FT                   /db_xref="GOA:Q9I6F9"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6F9"
FT                   /protein_id="AAG03721.1"
FT                   /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRTGDAARVARGF
FT                   KRVRLIGWPLLGLSLLALPVSGWWLVHLAGWPLGQSWLLFGACLYLLGCIFWLVLAGRL
FT                   ARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
FT   gene            374243..375514
FT                   /locus_tag="PA0333"
FT   CDS_pept        374243..375514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0333"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03722"
FT                   /db_xref="GOA:Q9I6F8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6F8"
FT                   /protein_id="AAG03722.1"
FT                   /translation="MRILLVGAGGFVGRHLLPALLAAGHELLLTARRPPVDAPAGVRWL
FT                   ALDLERLAERPDSFAWPAGVDLLINAAGTMSLDEASMARVQDSGARTLFDLAAAHGAKV
FT                   LQISALGAGAHPDVAFLASKAAADRHLLELGIPALVLRPSLLLGPGGASSAWLERLSPL
FT                   PLIPLLDNRARLQPLHVEDLVGAVLALLRCWPERAQVIPLVGPQALTQGELLDELRRAQ
FT                   GWPRGRYVVPPAALLDALGGLGRRAGWRTLSPSMLKLVRHDNLADPALLDEACGYRCAP
FT                   LASRLLGWPQAARSLAALMRPLMLAALVLIWLGTLVACLGPGYGWGLRILGEAGIHGWP
FT                   ASLAVIAGALLDGALGVGLLLRRWRRRALLAQFWLMLGYSLAISLILPHYWYDPYMAVG
FT                   KNIVLMVATLWLLGDEPRTREARG"
FT   gene            complement(375951..377189)
FT                   /locus_tag="PA0334"
FT   CDS_pept        complement(375951..377189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0334"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03723"
FT                   /db_xref="GOA:Q9I6F7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6F7"
FT                   /protein_id="AAG03723.1"
FT                   /translation="MPHTPAPGSLRPVVIVALVTALCLAGDSMLYIALPIYWHEVGLEA
FT                   LWQVGVLLSINRLIRLPFNPLIGRLYKHLALKTGLLLAVVIGVLSTAGYGLASGFLAWV
FT                   LLRGLWGIGWSFFRIGGLSAVVYCAADHQRGHAMGLYNGLYRLGSLVGMLLGGLLVPVL
FT                   GLPALALSFALLALLGLPLLAKGFDLPENPAGHARTSAATASTSVARRPPPRGLVILSG
FT                   FATALLIQGVLAATLSALIARSFGTEVSLLGLALSAAGLSGIIQALRWSWEPWLAGRFG
FT                   AWSDGPRGRRRFYVAALLVGAMGFGLLSSRLPILAWLAIALLVMLVATALTTLTDALAA
FT                   DVARAGDVVGFMTRYSIVQDLGAALGPALAFLLLERPGGFAWLYWGGSLAFLVLALLWL
FT                   RRADPQTGLLTIR"
FT   gene            complement(377239..377892)
FT                   /locus_tag="PA0335"
FT   CDS_pept        complement(377239..377892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0335"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03724"
FT                   /db_xref="GOA:Q9I6F6"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6F6"
FT                   /protein_id="AAG03724.1"
FT                   /translation="MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFYA
FT                   DYVAGKLDVLAYQAFTQAILGRTEMAQLETWHRQFMQEVIEPIVLAKGEALLAEHRAAG
FT                   DRLVIITATNRFVTGPIAERLGVETLIATECEMRDGRYTGQTFDVPCFQGGKVVRLQRW
FT                   LDENGLDLEGASFYSDSLNDLPLLEKVSRPVAVDPDPRLRAEAEKRGWPIISLR"
FT   gene            378096..378575
FT                   /gene="ygdP"
FT                   /locus_tag="PA0336"
FT   CDS_pept        378096..378575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygdP"
FT                   /locus_tag="PA0336"
FT                   /product="Nudix hydrolase YgdP"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03725"
FT                   /db_xref="GOA:Q9X4P2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X4P2"
FT                   /protein_id="AAG03725.1"
FT                   /translation="MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRET
FT                   PEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRL
FT                   MSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD"
FT   gene            378598..380877
FT                   /gene="ptsP"
FT                   /locus_tag="PA0337"
FT   CDS_pept        378598..380877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="PA0337"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase
FT                   PtsP"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03726"
FT                   /db_xref="GOA:G3XD36"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:G3XD36"
FT                   /protein_id="AAG03726.1"
FT                   /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLDT
FT                   ETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAETGE
FT                   ERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSI
FT                   RGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIALFKQA
FT                   LEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQGALRQ
FT                   VVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVSEELSPA
FT                   MLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDLIVDGYHG
FT                   EVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTGLLADVARA
FT                   QERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTLDIGGDKALS
FT                   YFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPMISGTHELEEA
FT                   LHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSVGSNDLTQYLLA
FT                   VDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDPAAAVLLMAMGFD
FT                   SLSMNATNLPKVKWLLRQITLDKARDLLGQLLTFDNPQVIHSSLHLALRNLGLGRVINP
FT                   AATVQP"
FT   gene            380903..382033
FT                   /locus_tag="PA0338"
FT   CDS_pept        380903..382033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0338"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03727"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6F5"
FT                   /protein_id="AAG03727.1"
FT                   /translation="MRRLRFPRKRIDCLPFGRGHWPVERARDCRKMDERASKPPGLLPL
FT                   SREDLEKTLRYALEIVSDGIWDWNIATNQVSRSAGWYLMLGYPPHSLPESVETWKSIIH
FT                   PEDYPRVMASFQAYLDGESPEYCEEYRCRTYSGDYLWISDRGRFVEFDERGEPRRMIGA
FT                   HHEIHQRKLVELELQQRNEELFDWNLRLEELVAERTEALHRVNQALASKMAEAQRLSEI
FT                   DPLTELYNRRKFEQCLHHEWMRRQRHGRATALVMIDVDHFKRINDLFGHSTGDRVLVAF
FT                   GRLVASELREVDVLARWGGEEFILLLPETGLEAAAALAERLRQRVRSQSFEMGERLTAS
FT                   FGVGVLNDGETLDLLLCRVDDALYRAKQRRDCVACC"
FT   gene            complement(382037..382792)
FT                   /locus_tag="PA0339"
FT   CDS_pept        complement(382037..382792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0339"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03728"
FT                   /db_xref="GOA:Q9I6F4"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6F4"
FT                   /protein_id="AAG03728.1"
FT                   /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFAG
FT                   RDLEAGGTWLGLGPAGRFAALTNVRDPSQALGKRSRGELVADFLRGGGNPADYLAQVAG
FT                   RAADYSGFNLLIGDRHQLWHYNPRVGPPRLLPAGIYGLSNAALDTPWPKLLKARAALAE
FT                   RLAEPHPQALLELLADAAPAADGQLPDTGVGLATERLLSSVFIASPSYGTRASSVVRVH
FT                   ADGTREMIERSFGPSGARLGEVSLVLPPG"
FT   gene            382914..383717
FT                   /locus_tag="PA0340"
FT   CDS_pept        382914..383717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03729"
FT                   /db_xref="GOA:Q9I6F3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6F3"
FT                   /protein_id="AAG03729.1"
FT                   /translation="MEFLLYIVLGACAGVLAGLFGVGGGLIIVPALVFSFTAHGFGGDV
FT                   LTQMAVGTSLATIVFTSINSILEHHRRGAVRWPVFAWMTLGILIGSALGALTAAQIKGP
FT                   LLQKIIGVFAILVALQMVLDLKPKGSREVPGKGGLTLAGAVIGWASAIFGIGGGSLTVP
FT                   FLSWRSVPMQQAVATSSACGLPIAISGALSFIAVGWHNPQLPEWSLGYVYLPALVGIAA
FT                   TSMLFARFGARLAHRLSPRVLKRLFALLLFSVGISFLTPDLAFLS"
FT   gene            383727..384527
FT                   /gene="lgt"
FT                   /locus_tag="PA0341"
FT   CDS_pept        383727..384527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="PA0341"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03730"
FT                   /db_xref="GOA:Q9I6F2"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6F2"
FT                   /protein_id="AAG03730.1"
FT                   /translation="MLTYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRMKRFD
FT                   PTWTKERLSDLVFWVACGVILGGRLGYVLFYNLDEYIANPTLIFEVWKGGMSFHGGLLG
FT                   VMLAVWWFGKRHGKSFFQLMDFIAPLVPIGLGAGRIGNFINSELWGKVSDVPWAMVFPN
FT                   GGPLPRHPSQLYQFALEGVALFVILWLFTRKPRPTASVSGLFVLCYGIFRFVVEFVRVP
FT                   DAQLGYLAWGWLTMGQVLCVPMVLAGIALMVWAYRRDAAQPKAA"
FT   gene            384733..385527
FT                   /gene="thyA"
FT                   /locus_tag="PA0342"
FT   CDS_pept        384733..385527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="PA0342"
FT                   /product="thymidylate synthase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03731"
FT                   /db_xref="GOA:Q9I6F1"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6F1"
FT                   /protein_id="AAG03731.1"
FT                   /translation="MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPLV
FT                   TTKKCHLKSIVHELLWFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAP
FT                   DGRHIDQIANLMAMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQL
FT                   YQRSADIFLGVPFNIASYALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTR
FT                   EPLPLPSMKLNPEVKDLFDFRFEDFELVGYEAHPHIKAPVAV"
FT   gene            complement(385554..386351)
FT                   /locus_tag="PA0343"
FT   CDS_pept        complement(385554..386351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0343"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03732"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6F0"
FT                   /protein_id="AAG03732.1"
FT                   /translation="MPFVSYAQNLEDVRLWRALKLFPRGFYIDVGANHPRIDSVTLAFY
FT                   ERGWRGINIEPLPHLHRELERERPEDLNLNLAIGEREGRATLYEMAASGLSTLDPELAR
FT                   QRQAEGCTATPREVKVSTLDAICAAHVEGPIHFLKIDVEGLEGAVLRGLDLNRWRPWLI
FT                   LAETPFDHDPEWKAPLLAAGYRFVHFDGLNGYYLAEEQARLEGAFALPPNLLDDFQLCH
FT                   GHAMSHPVAPLEQALEQALQRAEDAERALRDWRALPWYRRLFG"
FT   gene            complement(386386..387765)
FT                   /locus_tag="PA0344"
FT   CDS_pept        complement(386386..387765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0344"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03733"
FT                   /db_xref="GOA:Q9I6E9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E9"
FT                   /protein_id="AAG03733.1"
FT                   /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVEG
FT                   ARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGRFE
FT                   QEAKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLTGCGRPLLPVLNFVASPQHREEE
FT                   WRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHETQAAARL
FT                   RAGQRLIAELLVDVAACRRLVPGGESAVQEATRDLHQQVRKREQACVEALLRLYAFARD
FT                   DARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVTLGAAAA
FT                   LGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQTRGHAAVE
FT                   AIRLETPEDKQWREGKLPEALRKARAHPEWSSLNGRRVGGSDRQEQIDALAELLESGRG
FT                   E"
FT   gene            complement(387758..389143)
FT                   /locus_tag="PA0345"
FT   CDS_pept        complement(387758..389143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0345"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03734"
FT                   /db_xref="GOA:Q9I6E8"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E8"
FT                   /protein_id="AAG03734.1"
FT                   /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEAVRQALAQGGSLP
FT                   RRILTRAHWLGRREGLLDALRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPVNV
FT                   FWALASLLGLHLLTLLGWALGLLAGGEAAGALGRLWLWLSGKLARDARAAHLAPALLVL
FT                   LGRRRLARWGLGALVHGLWLLGLLTALAMLLGLLATRRYGFVWETTILGSDTFIALTQA
FT                   LGALPALLGFPLPDAELIRASGDAALASEAARHAWAGWLVGVLLVYGVLPRALLGLLCL
FT                   WRWKRGLAHLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSGQEAAGAV
FT                   LVAVELDDRRPWPPKLAEGVADAGILDDGQQRRRLLEQLTRYPPARLAIACDPRRSPDR
FT                   GTLALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHAALERLQLPHGETSPLAWLET
FT                   GHD"
FT   gene            389334..389696
FT                   /locus_tag="PA0346"
FT   CDS_pept        389334..389696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0346"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03735"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E7"
FT                   /protein_id="AAG03735.1"
FT                   /translation="MKVVRRYPLALLLGMAGALADELPDGSLLQRYGVQADQLPTLAAD
FT                   PPSRKEEKETPSRFRVEPEQPLVTFGVKDHKGMEPTGNPSIDAMHERDRRICRNIRRQA
FT                   LEKGKAQPFDGYIECP"
FT   gene            complement(389733..390884)
FT                   /gene="glpQ"
FT                   /locus_tag="PA0347"
FT   CDS_pept        complement(389733..390884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="PA0347"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   periplasmic"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03736"
FT                   /db_xref="GOA:Q9I6E6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E6"
FT                   /protein_id="AAG03736.1"
FT                   /translation="MQPAFLRRHLGAACLMLAAGLASAAHADTGNVQRAIDWAQGQASV
FT                   RHPASDERSPLVIAHRGASGYVPEHTLGAYALAVMMGADYVEPDLVMTRDGKLVARHDN
FT                   ELGLTTDVAQHPEFADRKRTQKVDGVELTGWFSEDFTLAELKTLRAIERIPTIRPGNAR
FT                   LDGTFEIPTLQEIIDLVKSLQISQQRTIGLYPEIKHGTHFQRLGLAMERPLVKTLHRNG
FT                   YLGPRAPVFIQSFEVNNLKELKRLTGIRLVQLYGSGQPYDQQAAGGSLTYAEMATAKGL
FT                   RQVARYAYGVGPDKSYVIPRDANGNLGQPTRFVGDAHAAGLKVHPYTFRAENSFLPAEF
FT                   RSADGNPQSRGDLAGEIRAYLDAGIDGLFSDQPDVAVRLREQR"
FT   gene            391094..392188
FT                   /locus_tag="PA0348"
FT   CDS_pept        391094..392188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0348"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E5"
FT                   /protein_id="AAG03737.1"
FT                   /translation="MASAQPASAFPCLSLQLACLLLGAWLAFDAHGGGQAVAPPARVEA
FT                   RVPTAATDDWGRQPDSLMSAVPPRTLEASVGARGSGSASSRLWIADTDFRLHDDIGFFI
FT                   QRMLIRMEPTRPGAPLSLDDPTAMVARIQAGEIFVSDATLATLLNQDLAASRAAVRNLS
FT                   MNTRKDGQEVRGELLRKGRWRPLRMLTEIELSGPLEVTLVPRRIFVDGVEVTSSLAAAS
FT                   IEMSEVLKLKTRHMELVGNRIRVDLDGLFPPPRLDFRVSRLALADGGMQLALGDSLADL
FT                   QWPALRAPDSYMFIEGGDIKMARTVLVKAYALFTSLSPGQPLLFNLYDYRRQLQNGVIR
FT                   LREDGMVQIAVSPVKAPAPLEARL"
FT   gene            392185..393225
FT                   /locus_tag="PA0349"
FT   CDS_pept        392185..393225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0349"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03738"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E4"
FT                   /protein_id="AAG03738.1"
FT                   /translation="MSRRPWGVLLGCCLLAASAAQAESAIDRQQRELALLREGWYRQVP
FT                   PAPVPLPMRTAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPVDFD
FT                   RPQDMHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRVRPLG
FT                   VGPWLPLRLGGGVEVDAASGALVYRPDQLRVIGLPLYGAMSLVGLPMSALVSLDRPGAS
FT                   LVGSAMRLDYRKVFPLLGIDGHVQEAWLDDQGLHLRFSQAPGQPSPVFSPPAAAGPSFL
FT                   WLQSGDLKIFEILITYAQVLLKTETPDQVLTFNLQDYRKVLATGTTQVNEDGTFFMQVP
FT                   PYANPL"
FT   gene            393308..393814
FT                   /gene="folA"
FT                   /locus_tag="PA0350"
FT   CDS_pept        393308..393814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="PA0350"
FT                   /product="dihydrofolate reductase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03739"
FT                   /db_xref="GOA:Q9I6E3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E3"
FT                   /protein_id="AAG03739.1"
FT                   /translation="MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIM
FT                   GRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELMLI
FT                   GGAQLYAEALPRAARLYLTRVGLAPEGDAFFPEIDGAAWRLASSIEHAAADDAPAYAFE
FT                   VWERR"
FT   gene            complement(393830..394303)
FT                   /locus_tag="PA0351"
FT   CDS_pept        complement(393830..394303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03740"
FT                   /db_xref="GOA:Q9I6E2"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E2"
FT                   /protein_id="AAG03740.1"
FT                   /translation="MPQSRRPLRIGLIADTHGLLRPEALERLRGCDQLIHAGDIGKPEI
FT                   LAELERLAPLSVVRGNNDTQDWAADIPERLLLKIGRLTLYVLHDLKRLDLDPAAEGIDV
FT                   VVAGHSHKPLKEERDGVLYLNPGSAGPRRFSLPIGIGVLEVAGKKIEAELITL"
FT   gene            complement(394442..395827)
FT                   /locus_tag="PA0352"
FT   CDS_pept        complement(394442..395827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0352"
FT                   /product="probable transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03741"
FT                   /db_xref="GOA:Q9I6E1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6E1"
FT                   /protein_id="AAG03741.1"
FT                   /translation="MSSLQSPSDASARNDLVYGLDDRPSAPIALLAALQHLLAIIVPIV
FT                   TPGLLICQALGVSPRDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFVGP
FT                   LIAGGALMVKQGTPVESVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTGIVVLMI
FT                   GLTLIKVGLISMGGGFSAMSNGTFANGENLLLSGVVLGIIVVLNRIPVVWMRSCAIVIA
FT                   LAVGYALAGYLGRLDFTGMHQAELFQVPTPLHFGLDFSWPLFIPMLVIYLVTSLEAIGD
FT                   VTATSKVSKQPVEGPLWMQRIKGGVLVNGANSFLAGIFNTFPSSVFAQNNGVIQLTGVA
FT                   SRYVGLWIAAMLVLLGLFPSVAGVIQAVPEPVLGGAAMVMFGAVAASGINILAGIQLDR
FT                   RALLIIAVSLALGLGVSQVPEFLAHMPAALRNVLESGVATGGICALLLNWFLPESPVQK
FT                   AGH"
FT   gene            complement(396057..397895)
FT                   /gene="ilvD"
FT                   /locus_tag="PA0353"
FT   CDS_pept        complement(396057..397895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="PA0353"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03742"
FT                   /db_xref="GOA:Q9I6E0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6E0"
FT                   /protein_id="AAG03742.1"
FT                   /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLASHGLDLV
FT                   DAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTLAT
FT                   HADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIANFKAFENAMTLDIAMGGSTNTIL
FT                   HLLAAAQEAEVPFDLRDIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSILGELARG
FT                   GLLHTDVPTVHSPSMADAIAQWDITQTRDEAVHTFFKAGPAGIPTQTAFSQNTRWPSLD
FT                   DDRAEGCIRSVEHAYSKEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGSAKIFESQDA
FT                   AVKGILGDEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVQDGDKVLIDIPNRSINLLVSDEELAARRAEQDKKGWK
FT                   PAAPRARRVSTALKAYALLATSADKGAVRNKALLDG"
FT   gene            complement(398224..399420)
FT                   /locus_tag="PA0354"
FT   CDS_pept        complement(398224..399420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03743"
FT                   /db_xref="GOA:Q9I6D9"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D9"
FT                   /protein_id="AAG03743.1"
FT                   /translation="MTLPSLRLKANAERRLRAGHLWVYSNEVDVAATPLNAFAAGDQAV
FT                   LEMANGKPLGIVALSPNNLICGRLISRDTKHVLDKSLLVHRINIALSLRERLFDKPFYR
FT                   LVYGDSDLLPGLVVDRFGDVLVVQLASAAMELRKDEVLAALLQVLKPAAVLWKNDSSAR
FT                   DAEGLERYVANAYGEVPEWVALEENGVKFEAPVLAGQKTGWFYDHRMNRARLAPYVQGK
FT                   RVLDLFSYIGGWGIQAAAFGASEVMCVDASAFALDGVERNAALNGVAEKVACVEGDVFE
FT                   ALRELKAADERFDVVIADPPAFIKRKKDLKNGEAAYRRLNEQAMRLLSKDGILVSASCS
FT                   MHLPEDDLQNILIGSARHLDRNIQLLERGGQGPDHPVHLAIAETRYIKSLTCRLLPNG"
FT   gene            complement(399493..400032)
FT                   /gene="pfpI"
FT                   /locus_tag="PA0355"
FT   CDS_pept        complement(399493..400032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpI"
FT                   /locus_tag="PA0355"
FT                   /product="protease PfpI"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03744"
FT                   /db_xref="GOA:Q9I6D8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D8"
FT                   /protein_id="AAG03744.1"
FT                   /translation="MTQSLHGKVVAALVTDGFEQVELTGPKKALEDAGATVRILSDKAG
FT                   EVRGWNHHQPAEAFRVDGTFEDASLDDYDALLLPGGVINSDQIRSLAKAQELAIRAEQA
FT                   SKPVAVICHGAWLLISAGLVQGRTLTSWPSLKDDINNAGGHWVDQEVAVDGKLVSSRKP
FT                   EDIPAFNRRFIEILAG"
FT   gene            400248..401072
FT                   /locus_tag="PA0356"
FT   CDS_pept        400248..401072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0356"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03745"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D7"
FT                   /protein_id="AAG03745.1"
FT                   /translation="MPPQPQIMVDLQMEQVMPNPDLKNIARLISQDPGLSGALLKLVNS
FT                   PFFGLANRITSIQRAVNLLGSRSVINLINAQSIKGEMSDDTIVTLNRFWDTAQDVAMSC
FT                   LSLAKRIGYESVDEAYALGLFHNCGIPLMLKRFPHYMAVLEEAYAAASDERRVVDTENR
FT                   VLNTNHAVVGYYTARSWRLPEHVCEAIANHHNALSIFGDESARDTQLKNLLAILKMAEH
FT                   ICGSHRVLGNQPEDHEWNSIGALVLDYVGLTDYDFENLKGSILELGVGQGSY"
FT   gene            401131..401943
FT                   /gene="mutM"
FT                   /locus_tag="PA0357"
FT   CDS_pept        401131..401943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="PA0357"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03746"
FT                   /db_xref="GOA:Q9L7T2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9L7T2"
FT                   /protein_id="AAG03746.1"
FT                   /translation="MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVRL
FT                   SGQRIVSVERRAKYLLLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGMAL
FT                   RYTDPRRFGAMLWSLAPLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIMDNA
FT                   VVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTLRDFV
FT                   GGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR"
FT   gene            402020..402598
FT                   /locus_tag="PA0358"
FT   CDS_pept        402020..402598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0358"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03747"
FT                   /db_xref="GOA:Q9I6D6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D6"
FT                   /protein_id="AAG03747.1"
FT                   /translation="MSGNYLPRNTLVESLGHAMLKLSGWKIEGQLPALDKFVVIGAHHT
FT                   SNWDFVAFLAAKFVLRLNARWFGKHTLFNGPLGGLMRRWGGIPIQRHLKLNTVDQAIQA
FT                   FREHREFMLIIAPEGTRKKVDRWRMGFYHIARGAGVPVVPAALDYENRRIVIGEPFWPT
FT                   GNEDADLCSLIGFYRPFIPKKPHYAFLGD"
FT   gene            402681..403025
FT                   /locus_tag="PA0359"
FT   CDS_pept        402681..403025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0359"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03748"
FT                   /db_xref="GOA:Q9I6D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D5"
FT                   /protein_id="AAG03748.1"
FT                   /translation="MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTVEAPPAY
FT                   AMIGDLLIARPFLIAATAVGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCLGC
FT                   TTSGYNHDES"
FT   gene            403295..404281
FT                   /locus_tag="PA0360"
FT   CDS_pept        403295..404281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0360"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03749"
FT                   /db_xref="GOA:Q9I6D4"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D4"
FT                   /protein_id="AAG03749.1"
FT                   /translation="MFSQWVFLSVLALAVPSFAWAEDAVSDLAREQSKAEQGDKRGDEL
FT                   FAEFTRLRQAAETGEPQALFDFGAYFYQQQNYASAREWWGKAAAAGMVRAQIQLAMLYR
FT                   DGDGGPQDKTEAARWFRKAAEQGDAAAQNEMGVLYWRGEGVDQDRVKAGTWFERAAASG
FT                   SEDAETNLGWFYLDDSQGVYSATSDEEAALLDRYAGSREKAFQWFCKAATQGDARAQFK
FT                   VGEAYWNGSGAGMNKLQARLWLEKAAQQQDADAIAWLESAANAAWYTRLENWIHAALDG
FT                   ELSGVADCSGAADRRHSGRGMEGAPSDPEAVEASAEDAQQAVEAASQ"
FT   gene            complement(404386..406119)
FT                   /locus_tag="PA0361"
FT   CDS_pept        complement(404386..406119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0361"
FT                   /product="probable gamma-glutamyltranspeptidase precursor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03750"
FT                   /db_xref="GOA:Q9I6D3"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D3"
FT                   /protein_id="AAG03750.1"
FT                   /translation="MSFLNLPVRTLVAACGLSLLSLAAHADSFRGDAHAPQQAAVATPH
FT                   PAATVAGLETLANGGNAFDAAAAIAAALAVAEPYGSGLGGGGFFLLRQAGAQPTYRFLD
FT                   ARERAPKAAYADMYRRNGKVDPRLSVDGPLAAAIPGLPAALVELSSRYGRKPLADNLVP
FT                   AIRLAVDGVSVDRIYRDRAAMRLEAMRKDPETARIFLDKGGIPDEWNLLRQPQLARTLE
FT                   RLGRYGRIGFYEGETADKLLTGVRAGGGIWSAADLRDYRVIERRPLEVKLANGRELISA
FT                   PPPSAGGVALAQSLQMLEQLPWQKAEPVQRAHYVLEVLRRAYRDRGLLGDPDFVANPLP
FT                   SLLAPDYLKRLAAGIDPRRATPSSALPEAPAWREGDHTTHFAVIDAQGNAVAATLSVNL
FT                   PFGAAFTVPDTGVVLNNEMDDFAADTQGANSYGLAGSQANAVAAGKRPLSSMSPSFLES
FT                   PTDFAAFGTPGGSRIPSMVLISMLQYFDGRPVGQWVAAPRYHHQYKPDVVEYEPRAFSD
FT                   AEAAELRRRGYQLKRLERSYGNQQVLYWDKRSGRVDAASDPRGIGYSSLSLEAQAQPRP
FT                   H"
FT   gene            complement(406247..406498)
FT                   /gene="fdx1"
FT                   /locus_tag="PA0362"
FT   CDS_pept        complement(406247..406498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx1"
FT                   /locus_tag="PA0362"
FT                   /product="ferredoxin (4Fe-4S)"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03751"
FT                   /db_xref="GOA:Q9I6D2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="PDB:2FGO"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D2"
FT                   /protein_id="AAG03751.1"
FT                   /translation="MSLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGHY
FT                   DEPQCQQVCPVDCIPLDDANVESKDQLMEKYRKITGKA"
FT   gene            complement(406619..407098)
FT                   /gene="coaD"
FT                   /locus_tag="PA0363"
FT   CDS_pept        complement(406619..407098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="PA0363"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03752"
FT                   /db_xref="GOA:Q9I6D1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:5X6F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6D1"
FT                   /protein_id="AAG03752.1"
FT                   /translation="MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLF
FT                   SLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANM
FT                   NRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFKR"
FT   gene            complement(407250..408845)
FT                   /locus_tag="PA0364"
FT   CDS_pept        complement(407250..408845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0364"
FT                   /product="probable oxidoreductase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03753"
FT                   /db_xref="GOA:Q9I6D0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6D0"
FT                   /protein_id="AAG03753.1"
FT                   /translation="MPVPDLFAEGLARGWKTYNGSRLDDDLELEADVVVVGTGAGGGTT
FT                   AEILSAAGLKVLLVEEGPLKTSSDFKMQEADAYPELYQEGIGRMSKDGAITILQGRAVG
FT                   GTTLINWTSSFRTPEPTLQHWAQVYGVKGHSAEDMAPWFEKMEQRLHVAPWALPPNANN
FT                   DVIRLGCEKLGYHWKVIPRNVLGCWNLGYCGMGCPVNAKQSMLVTTIPATLDKGGELLY
FT                   LARANRLLLDGDKVTGLECLGMDERCVAPNGRRIRVRARHYVLSGGGINTPAILLRSKA
FT                   PDPSQRVGKRTFLHTVNFSAGLFDRVINPFYGAPQSIYSDHFQWDDGVTGRMSYKLEVP
FT                   PLQPSLASVLLGGFGSDNALRMEQLPHTNMMLALLRDGFHPDSAEGSVGLRGDDTPVLD
FT                   YRMTDYTWDGIRRAFHTMAEIQFAAGAREVRPVHSDARSAKNLQEARGIIDGLRLEIYR
FT                   TRLGSAHVMGGCAMGEDPAVAVADSLGRHHHLRNLSIHDGSLFPTSIGANPQLSVYGLT
FT                   AQLASALAERLARA"
FT   gene            complement(408901..409449)
FT                   /locus_tag="PA0365"
FT   CDS_pept        complement(408901..409449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0365"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03754"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C9"
FT                   /protein_id="AAG03754.1"
FT                   /translation="MSDTTLESAGLSRRSLMKVGLIGGAFLATAGVTASLTGCSAEKPA
FT                   SGLEKVRESDLPFLRALLPVMLLGAVSAEQMPKAVEGAIQSLDHNLARLSPEMFKLTQQ
FT                   LFDVLALPLTRGPLTGIWGSWENASGDDVRAFLSRWENSFIGLLRMGHSSLMQLAMMAW
FT                   YARPEAWAHCGYPGPPKIA"
FT   gene            complement(409504..410934)
FT                   /locus_tag="PA0366"
FT   CDS_pept        complement(409504..410934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0366"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03755"
FT                   /db_xref="GOA:Q9I6C8"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6C8"
FT                   /protein_id="AAG03755.1"
FT                   /translation="MVADIAYLQQSQQEINQLEALFARQRAAYLAQPMPDATQRVQWLK
FT                   ALRDLLFKEQQALIEAIDRDFSARSADETLLAEIMPSLHGIHYAAKRVKKWMKPARRAV
FT                   GLQFQPASAQVVYQPLGVVGVIVPWNYPLFLSIGPLTGALAAGNRVMIKMSESTPATGR
FT                   LLKDLLARIFPEDQVAVVLGEVDVGVAFSKLPFDHLLFTGATSVGKHVMRAAAENLTPV
FT                   TLELGGKSPAIVSDSVPMKDAAERIAFGKSLNAGQTCVAPDYVLVPSRRVEEFVSQYKE
FT                   VVQGFFPRLSDNPDYTAIINERQLGRLRGYLDDAREKGATLVPLFAEGQQRRLPQTLLL
FT                   NVSDDMKVMQEEIFGPLLPVIPYERLEDALAYVNQRPRPLALYYFGYDKAQQQRVLHET
FT                   HSGGVCLNDTLLHVAQDDIPFGGVGPSGMGHYHGHEGFLTFSKAKGVFSKPRFNAARMI
FT                   YPPYGKSIQKLVYKLFVR"
FT   gene            411224..411871
FT                   /locus_tag="PA0367"
FT   CDS_pept        411224..411871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0367"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03756"
FT                   /db_xref="GOA:Q9I6C7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C7"
FT                   /protein_id="AAG03756.1"
FT                   /translation="MAPRIKTRDRIAQASLELFNAQGERSVTTNHIATHLGISPGNLYY
FT                   HYPNKQAIIAELFAEYESHVESFLRLPEGRGLTVDDKTFYLEALLAAMWRYRFLHRDLE
FT                   HLLESDPELAARYRAFAQRCLVNAKAIYRGFTEAGILRMNETQLEALTLNAWIILTSWV
FT                   RFLCTTLDLDGDLSEAQLRRGIYQVLALESGHIEAQAQDAVDGISERLYVPL"
FT   gene            complement(412329..413327)
FT                   /locus_tag="PA0368"
FT   CDS_pept        complement(412329..413327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03757"
FT                   /db_xref="GOA:Q9I6C6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C6"
FT                   /protein_id="AAG03757.1"
FT                   /translation="MTASPTFQPAWWLPNPHLQTLWSPFFRRGPTLERQRERLWLADGD
FT                   FIDLDWAGPHDAETPLVLALHGLTGSSSSHYILGLQRALLERGWASVALNWRGCSGEPN
FT                   RLPRGYHSGVSDDLAEVVAHLRARRPQAPLYAVGYSLGGNVLLKYLGETAGDCPLLGGV
FT                   AVSVPFRLDECADRIGLGFSRVYQAHFMKAMLAYVQDKQRLFGEQGQAEGLAALQRLGP
FT                   LEGMRTFWDFDGRVTAPLHGFADARDYYRRASSRYYLPDIRTPSLIIHSSDDPFVFARS
FT                   LPDRSELAPCTELELHARGGHVGFVDGSPRQPTYYLERRIPDWLEARLRQH"
FT   gene            complement(413364..413654)
FT                   /locus_tag="PA0369"
FT   CDS_pept        complement(413364..413654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0369"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03758"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C5"
FT                   /protein_id="AAG03758.1"
FT                   /translation="MADQGADPFILETGSGRILFDLHGGRGWDPAPCFDDLWQMAASLA
FT                   CFGEVWSGAGEDILLDDCSVAPRYRQQLVDELQPILGSRQRAEDLADEFGW"
FT   gene            complement(413933..414529)
FT                   /locus_tag="PA0370"
FT   CDS_pept        complement(413933..414529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03759"
FT                   /db_xref="GOA:Q9I6C4"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C4"
FT                   /protein_id="AAG03759.1"
FT                   /translation="MSKPTAKAPGRHGGQGQLRIIGGEWRSRRFVFPDGPGLRPTPDRV
FT                   RETLFNWLAPYVEGARVLDPFAGSGALFLEALSRGAREGLALDTNGEAVAALRNHLDAL
FT                   KCGTAQLVLGDAVRYLGNQAPSAFDLVFLDPPFHQNLLQDACRLLETRGWLNPDAWIYT
FT                   ESESVPSSLGLPGNWRLHREKKAGNVHYALWQRGA"
FT   gene            complement(414529..416016)
FT                   /locus_tag="PA0371"
FT   CDS_pept        complement(414529..416016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0371"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03760"
FT                   /db_xref="GOA:Q9I6C3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C3"
FT                   /protein_id="AAG03760.1"
FT                   /translation="MSERTGLRYGLLGLIVIALLAALAYFVARPPQTPAAAHAAAVEEN
FT                   QLQSLKDVAKQAPVHRKLDIQEWKTAEGAKVLFVEAHELPMFDLRLTFAAGSSQDAGTP
FT                   GLSMLTNAMLNEGVPGKDTTAIAAGFEDLGASFSNGSYRDMAVAGLRSLSEADKRTQAL
FT                   KLFEQVIGQPTFPEDALARIKNQVLAGFEYQKQNPGKLAGLELFKRLYGEHPYAHSSDG
FT                   DEKSVPTISREQLQAFHKKAYAAGNVVIALVGDLSRQEAEAIAAEVSKALPQGPALAKT
FT                   VQPETPKPGLTHIDFPSEQTHLMLAQLGIDRQDPDYAALYLGNQILGGGGFGTRLMDQV
FT                   REKRGLTYGIYSGFTAMQARGPFMINFQTRAELSEGALKLVQDIVRDYLANGPTQKELD
FT                   DAKRELAGSFPLSTASNADIVGQLGAIGFYGLPLDYLESFLKQVEGLSVEQVRTAMAKH
FT                   LDADAFVIVSAGPSVPQKPLPPPTAKPAQQPSGVPEH"
FT   gene            complement(416009..417406)
FT                   /locus_tag="PA0372"
FT   CDS_pept        complement(416009..417406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0372"
FT                   /product="probable zinc protease"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03761"
FT                   /db_xref="GOA:Q9I6C2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="PDB:4NNZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C2"
FT                   /protein_id="AAG03761.1"
FT                   /translation="MAARKVQITMKTPARRRVGLLLASLCLPLFAQAAETQPTHEFSLD
FT                   NGLKVIVREDHRAPVVVSQLWYRIGSSYETPGLTGLSHALEHMMFKGSRKLGPGEASRV
FT                   LRDLGAEENAFTTDDYTAYYQVLARDRLPVALEMEADRMAHLSLPVDQFKSEIEVIKEE
FT                   RRLRTDDNPNALAFERFKAAAYPASGYHTPTIGWMADLQRMTIDDLRHWYESWYAPNNA
FT                   TLVVVGDVTADEVKTLAKRYFGEIPWRQLPPARKPLELAEPGERRLKLYVRTQLPNLIM
FT                   GFNVPSLGSSENPREVNALRLIGALLDGGYSARLASRLERGEELVAGASTYYDAFNRGD
FT                   SLFVLSATPNVQKGKTLEQVEAGLWKQLDDLKQNPPSAAEIERVRAQMIAGMVYEKDSI
FT                   AAQASSIGQLESVGLSWKLIDQDLEALKAVTPDDIQKAARTYFTPSRLTLAQVLPVKAE
FT                   EKEARHE"
FT   gene            417527..418894
FT                   /gene="ftsY"
FT                   /locus_tag="PA0373"
FT   CDS_pept        417527..418894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PA0373"
FT                   /product="signal recognition particle receptor FtsY"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03762"
FT                   /db_xref="GOA:Q9I6C1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C1"
FT                   /protein_id="AAG03762.1"
FT                   /translation="MFGSNDDKKAPQGGEKKGLFGWWRKKPQAGEQPADQPVEPVSETA
FT                   AAEQRAPADDVAQSLTEQPGRQQPSAAEPAEPPAPVAEAPLAGDEPASAEEHSPRPEAP
FT                   VAQPEPILAAEPEPEPEPEPEPEPEPVAPLAAAPAVSEPATRPGFFARLRQGLSKTSAS
FT                   IGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGAL
FT                   YKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVM
FT                   LAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTA
FT                   GRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGL
FT                   ALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAERENA"
FT   gene            418891..419562
FT                   /gene="ftsE"
FT                   /locus_tag="PA0374"
FT   CDS_pept        418891..419562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PA0374"
FT                   /product="cell division protein FtsE"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03763"
FT                   /db_xref="GOA:Q9I6C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6C0"
FT                   /protein_id="AAG03763.1"
FT                   /translation="MIRFEQVGKRYPNGHVGLHEVSFRVHRGEILFVTGHSGAGKSTLL
FT                   RLILAMERPTSGKLLLGGQDLGRITTAQIPFLRRQIGVVFQNHQLLTDRTVADNIALPL
FT                   QILGMPKPEIAKRVASALERVNLKEKGEALPSDLSTGQQQRVGIARAIVHQPALLLADE
FT                   PTGNLDPRLASEIMGVFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRIIADREDE
FT                   A"
FT   gene            419562..420569
FT                   /gene="ftsX"
FT                   /locus_tag="PA0375"
FT   CDS_pept        419562..420569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PA0375"
FT                   /product="cell division protein FtsX"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03764"
FT                   /db_xref="GOA:Q9I6B9"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6B9"
FT                   /protein_id="AAG03764.1"
FT                   /translation="MSANDLPRGPEEGAPERKTREKPSQEQTDWSGSFSAYLESHRASL
FT                   VDSLRRLFGHPFGSFFTCLVMGITLSLPMGLSLLLNNVERLGGSWQRAAQISLFLDLKT
FT                   SENQGQDLREQIERLPDVIEAQLISREQALSELQEQSGLGEALKELPENPLPPVISVTP
FT                   KQIDRAGLEALRQQLAELPHVQQAQLDLVWVERLSAILKLGERFVFGLTILLVLTLLLV
FT                   VGNTIRLHIENRRNEIEVIKLVGGTDGYVRRPFLYMGALYGLGAGILSWALLAYSLNWL
FT                   NGSVVNLSGLYGSDFGLQGVPLDDGLSLTVGAVLLGWVGAWLAVARHLRELAPR"
FT   gene            420683..421537
FT                   /gene="rpoH"
FT                   /locus_tag="PA0376"
FT   CDS_pept        420683..421537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="PA0376"
FT                   /product="sigma factor RpoH"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03765"
FT                   /db_xref="GOA:P42378"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42378"
FT                   /protein_id="AAG03765.1"
FT                   /translation="MTTSLQPVHALVPGANLEAYVHSVNSIPLLSPEQERELAERLFYQ
FT                   QDLEAARQMVLAHLRFVVHIAKSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVS
FT                   FAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNEEVHRVAESLG
FT                   VEPREVREMESRLTGQDMAFDPAADADDESAYQSPAHYLEDHRYDPARQLEDADWSDSS
FT                   SANLHEALEGLDERSRDILQQRWLSEEKATLHDLAEKYNVSAERIRQLEKNAMSKLKGR
FT                   ILA"
FT   gene            421602..422207
FT                   /locus_tag="PA0377"
FT   CDS_pept        421602..422207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0377"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03766"
FT                   /db_xref="GOA:Q9I6B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6B8"
FT                   /protein_id="AAG03766.1"
FT                   /translation="MPRNTRWLFYLSLAVLTFVVGAWLVRTPEPARPLPWLADWQEQVL
FT                   APLADNALTLRQLHDAVDGELWVDPRLDGVRLAFRGRLLGDGGPWQVEGELGLSAEEQL
FT                   SLQRASALQPGSAPQPLSAGLEGQLGDKPIVALSMIPEGRVGAERLLASLGQPRLRLQL
FT                   AQGEAWVYPQLGLTAHLPDDDLRLMLAVPRQALEKPPR"
FT   gene            complement(422212..422943)
FT                   /locus_tag="PA0378"
FT   CDS_pept        complement(422212..422943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0378"
FT                   /product="probable transglycosylase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03767"
FT                   /db_xref="GOA:Q9I6B7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6B7"
FT                   /protein_id="AAG03767.1"
FT                   /translation="MAAPFFQAKPRMLRSLFRRLFKYLLWFMAASVVLVAVLRWVPPPG
FT                   TMVMVERKVGSWVDGQPIDLQRDWRSWEQLPDSLKVAVIAGEDQHFAEHHGFDLPAIQQ
FT                   ALAHNERGGSIRGASTLSQQVAKNVFLWSGRSWLRKGLEAWFTLLIETLWTKQRILEVY
FT                   LNSAEWGPGVFGAQAAARYHFGLDAERLSRTQASQLAAVLPSPLKWSAARPGPYVRQRA
FT                   AWIRQQMWQLGGDDYLLRLER"
FT   gene            422980..423357
FT                   /locus_tag="PA0379"
FT   CDS_pept        422980..423357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03768"
FT                   /db_xref="GOA:Q9I6B6"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6B6"
FT                   /protein_id="AAG03768.1"
FT                   /translation="MLRPFLLLAAFFGFTGVALGAFAAHGLKKQLSAEYLAVFQTGVHY
FT                   QLIHALALFGVALLATRLDGRLVSAAGGLFTLGILLFSGSLYLLTLSGIGKLGIVTPFG
FT                   GVSFLAGWLCLGLAAWRLGNA"
FT   gene            423460..423660
FT                   /locus_tag="PA0380"
FT   CDS_pept        423460..423660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03769"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6B5"
FT                   /protein_id="AAG03769.1"
FT                   /translation="MQIQLNGEPFELPDAQSVADLLARLELGGRRVAVELNLDIVPRSQ
FT                   HASTALKDGDRVEIVHAIGGG"
FT   gene            423719..424516
FT                   /gene="thiG"
FT                   /locus_tag="PA0381"
FT   CDS_pept        423719..424516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PA0381"
FT                   /product="thiamine biosynthesis protein, thiazole moiety"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03770"
FT                   /db_xref="GOA:Q9I6B4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="PDB:1WV2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6B4"
FT                   /protein_id="AAG03770.1"
FT                   /translation="MSQASSTDTPFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAE
FT                   IVTVAVRRTNIGQNPDEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLDGHN
FT                   LVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPL
FT                   AGLIGSGLGICNPYNLRIILEEAKVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHA
FT                   KDPVMMAEAMKHAIVAGRLAYLAGRMPRKLYASASSPLDGLID"
FT   gene            424670..425341
FT                   /gene="micA"
FT                   /locus_tag="PA0382"
FT   CDS_pept        424670..425341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="micA"
FT                   /locus_tag="PA0382"
FT                   /product="DNA mismatch repair protein MicA"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03771"
FT                   /db_xref="GOA:Q9I6B3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6B3"
FT                   /protein_id="AAG03771.1"
FT                   /translation="MRTVKSFVMRAGRMTEGQQRGLDLGWPKFGLELSDEVQDFDAIFG
FT                   RQAPRTFEIGFGMGHSTLEMAAAAPDIDFIGVEVHKPGVGALLNGLLTQGLGNVRVYSC
FT                   DALEVLRHCVADASLDRLLLFFPDPWHKKRHHKRRIVQPEFAELVRRKLKVGGVLHMAT
FT                   DWEPYAEHMLDVMSAAPGYRNQAEDGRFVPRPQERPVTKFERRGERLGHGVWDLKFERV
FT                   D"
FT   gene            425504..426850
FT                   /locus_tag="PA0383"
FT   CDS_pept        425504..426850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03772"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6B2"
FT                   /protein_id="AAG03772.1"
FT                   /translation="MLKKLGILLLGAGCAWAAQAKVDEVQAARLDQDLTPLGAERAGNA
FT                   DGSIPPWTGGITQAPAGYRPGMHHLDPFAADRPRLVLDSRNMAAYQALLTPGTQALLQA
FT                   NPDYHLRVFPTRRSASLPQRLYDATRANASRAELIADGNGVQGAAAGVPFPLPQSGQEA
FT                   IWNHIMRYRGEQLHLQTNQAAVLANGSYNLLKLDRYLYFVYGREGMIPENLDNTLFYYK
FT                   YKVVAPARLAGSALVVQETLDQVLSIRKAWRFNRGERRVRRLPTLAYDSLQPDTNGMAT
FT                   ADTVDVYNGAPDHYEWALLGKREMLVPYNSYAVHQKGLAYGDILKSRFINPDLLRYELH
FT                   RVWVVEATLRKGFSHPYAKRRFYLDEDSWQILAADIYDKDGVLTRAQEVHPINYYDVPL
FT                   VSSTLEAIYDFKGGRYFVDGLDNNEPMYDFGVQVGPRDFTPQALRREGN"
FT   gene            complement(426863..427120)
FT                   /locus_tag="PA0384"
FT   CDS_pept        complement(426863..427120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0384"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03773"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6B1"
FT                   /protein_id="AAG03773.1"
FT                   /translation="MKPIKHLYLHFTDGQRLSLRFPRQQDDPAEVARSIRQQLDTPYLS
FT                   VEVDGDLLLIPRDSIKYLQISPAPARLDDDGTLRGAELIV"
FT   gene            complement(427182..427505)
FT                   /locus_tag="PA0385"
FT   CDS_pept        complement(427182..427505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0385"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03774"
FT                   /db_xref="GOA:Q9I6B0"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6B0"
FT                   /protein_id="AAG03774.1"
FT                   /translation="MDYALDLIATLSRWSRSHLSDISLAIMATLLVLFGPAINAWVQQR
FT                   IGSLNFVFRTLLFVLICAVGYGLAMVFVTPWLAKGLGYFNNYTLAPVLLLVFFVIGMIA
FT                   DRS"
FT   gene            complement(427586..428740)
FT                   /locus_tag="PA0386"
FT   CDS_pept        complement(427586..428740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0386"
FT                   /product="probable oxidase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03775"
FT                   /db_xref="GOA:Q9I6A9"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6A9"
FT                   /protein_id="AAG03775.1"
FT                   /translation="MTQATPFQLPPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYV
FT                   DALLADLEQDLRHVHGRRLGSIFFGGGTPSLFSAKALGRLLEGVERRVGFADGIEITLE
FT                   ANPGTFEQVKFADYRRLGINRLSIGVQSFQADKLQALGRIHDGAEAVRAADMARQAGFD
FT                   NFNLDLMHGLPGQSLDDALADLRQALALAPTHLSWYQLTMEPNTVFWSQPPELPEDDIL
FT                   WDIQEAGQALLDEHGYRQYETSAYARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDG
FT                   RIVRTWKTRLPKDYLNPQKAFQAGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQ
FT                   PLAAIADACAAARDAGLLADDPQHLRPSERGQLFLNDLLQHFLP"
FT   gene            complement(428861..429454)
FT                   /locus_tag="PA0387"
FT   CDS_pept        complement(428861..429454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03776"
FT                   /db_xref="GOA:Q9I6A8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I6A8"
FT                   /protein_id="AAG03776.1"
FT                   /translation="MIKLEQLVLASHNAGKLKELQAMLGASVKVRSIGEFSQVEPEETG
FT                   LSFVENAILKARNAARLSGLPALADDSGLAVDFLGGAPGIYSARYADGRGDAANNAKLL
FT                   EAMKDVPDAERGAQFVSVLALVRHADDPLPILCEGIWEGRILREARGAHGFGYDPLFWV
FT                   PERDCSSAELAPEEKNRLSHRARAMALLKQRLGL"
FT   gene            complement(429451..429870)
FT                   /locus_tag="PA0388"
FT   CDS_pept        complement(429451..429870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0388"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03777"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="PDB:3UC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6A7"
FT                   /protein_id="AAG03777.1"
FT                   /translation="MRRFTAFVLGLCLSLPVLAEQVQRFGDLDVHYNVFNSSFLQPNVA
FT                   SAVGLVRSKAQGVINVVPMEKGKPVEAAVTGSAKDLTGKVIPLEFRRVSEEGAIYNLAQ
FT                   FPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE"
FT   gene            complement(430002..430622)
FT                   /locus_tag="PA0389"
FT   CDS_pept        complement(430002..430622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0389"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03778"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6A6"
FT                   /protein_id="AAG03778.1"
FT                   /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLAWLRDHKQVSGYGLEI
FT                   DPDNIARCIENGVNVIEQDLDKGLGNFASDSFDVVVMTQALQAVHYPDKILEEMLRVGK
FT                   TCIITFPNFGHWRCRWYLARNGRMPVSEFLPYTWYNTPNIHFCTFQDFERLCRQLRMRV
FT                   LDRLAVDRDHRHGWASRLWPNLLGEIGIYRVTGPGVQTRNLAV"
FT   gene            complement(430630..431769)
FT                   /gene="metX"
FT                   /locus_tag="PA0390"
FT   CDS_pept        complement(430630..431769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="PA0390"
FT                   /product="homoserine O-acetyltransferase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03779"
FT                   /db_xref="GOA:P57714"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57714"
FT                   /protein_id="AAG03779.1"
FT                   /translation="MPTVFPDDSVGLVSPQTLHFNEPLELTSGKSLAEYDLVIETYGEL
FT                   NATQSNAVLICHALSGHHHAAGYHSVDERKPGWWDSCIGPGKPIDTRKFFVVALNNLGG
FT                   CNGSSGPASINPATGKVYGADFPMVTVEDWVHSQARLADRLGIRQWAAVVGGSLGGMQA
FT                   LQWTISYPERVRHCLCIASAPKLSAQNIAFNEVARQAILSDPEFLGGYFQEQGVIPKRG
FT                   LKLARMVGHITYLSDDAMGAKFGRVLKTEKLNYDLHSVEFQVESYLRYQGEEFSTRFDA
FT                   NTYLLMTKALDYFDPAAAHGDDLVRTLEGVEADFCLMSFTTDWRFSPARSREIVDALIA
FT                   AKKNVSYLEIDAPQGHDAFLMPIPRYLQAFSGYMNRISV"
FT   gene            complement(431858..433825)
FT                   /locus_tag="PA0391"
FT   CDS_pept        complement(431858..433825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0391"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03780"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6A4"
FT                   /protein_id="AAG03780.1"
FT                   /translation="MSMERLSHQIDAYVAWKRELMREITRYRGWLERSRLNSPAVEAKL
FT                   ERALRQLRADHITLAFVGEFSRGKTELINSLFFAGYGQRMLPSHAGRTTMCPTELFHDP
FT                   RAERSYIRLLPIETRLADASVAQFKRVPRHWVNIPLDTGDPEGMAQAFAQVAKTKALPV
FT                   EQAIQLGFHPDALEAADEPDQVRVPAWRHALVNFDHPLLRQGLRILDTPGLNALGSEPE
FT                   LTLSMLPNAQAILFLLSADAGVTASDMEIWQKYIQPLREDGHSSLFAVLNKIDVLWDDL
FT                   SGERFVQNAIRLIQDGTARQLGLQRGDVLPLSAKQALLAKVRGEPALLERSRLDRLEAL
FT                   LCERIVAQKEALLENAVLGQVLGLLHNSQQLLRLRLEKVEEQRALLDDKQRDSGQLLFE
FT                   LTAKTKDDHGRHHRRLLNLKTNQRLLQHQGATLRETIRSERMEQHLQKVRRNLNGSLTT
FT                   VGINQAILAFFRAVEHDLDNLEHEAGMANRMVAAIYRRHNEENPLYALDAPQLRVQRYQ
FT                   RELLQLKKKGDQFRLQLKTVLTEQRLLTRRFFATLVQEVVGLHQRLREETERWANDALM
FT                   PLMQHTLENKQLLESHMLRLKGLAQETQQVRQRSQAFAGFAGELQEQLREAGDILRQLR
FT                   RPSPLQRQAKVVNLPGSQRA"
FT   gene            complement(434226..434819)
FT                   /locus_tag="PA0392"
FT   CDS_pept        complement(434226..434819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03781"
FT                   /db_xref="GOA:P25254"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25254"
FT                   /protein_id="AAG03781.1"
FT                   /translation="MIGLNTAAIYILQTLGSLYLLIVLLRFILQLVRADFYNPLSQFIV
FT                   RATKPLLNPLRRIIPGFGGIDLASLVLAILIQLVLMILILMLMGYGVGGFIMQLLIWSI
FT                   IAVTSLFLKVFFFALIISVILSWVAPGSYNPGAQLVNQICEPLLMPFRKLLPNLGGLDL
FT                   SPIFAFLALKLIDMLVINNLAAMTGMPQQLSIFL"
FT   gene            complement(434830..435651)
FT                   /gene="proC"
FT                   /locus_tag="PA0393"
FT   CDS_pept        complement(434830..435651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="PA0393"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03782"
FT                   /db_xref="GOA:P22008"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22008"
FT                   /protein_id="AAG03782.1"
FT                   /translation="MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKI
FT                   AGEFAIDVVESNAEAVADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCAS
FT                   LEAWLGQPRPVVRCMPNTPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDE
FT                   AQIDAVTAVSGSGPAYFFLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVE
FT                   PAELRRRVTSPNGTTEAAIKSFQANGFEALVEQALNAASQRSAELAEQLGQ"
FT   gene            complement(435663..436355)
FT                   /locus_tag="PA0394"
FT   CDS_pept        complement(435663..436355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03783"
FT                   /db_xref="GOA:P24562"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24562"
FT                   /protein_id="AAG03783.1"
FT                   /translation="MSTIAENIAKVAARIREAAQAAGRDPATVGLLAVSKTKPAAAVRE
FT                   AHAAGLRDFGENYLQEALGKQAELADLPLNWHFIGPIQSNKTRPIAEHFQWVHSVDRLK
FT                   IAQRLSEQRPAGLPPLNVCLQVNVSGEASKSGCAPEDLPALAEAVKQLPNLRLRGLMAI
FT                   PEPTAERAAQHAAFARLRELLLDLNLGLDTLSMGMSDDLEAAIGEGATWVRIGTALFGA
FT                   RDYGAPAS"
FT   gene            436570..437604
FT                   /gene="pilT"
FT                   /locus_tag="PA0395"
FT   CDS_pept        436570..437604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="PA0395"
FT                   /product="twitching motility protein PilT"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03784"
FT                   /db_xref="GOA:P24559"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:3JVU"
FT                   /db_xref="PDB:3JVV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24559"
FT                   /protein_id="AAG03784.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHK
FT                   QVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVL
FT                   TMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKIGGGRVAAHE
FT                   IMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENAREKAKI
FT                   PENF"
FT   gene            437782..438930
FT                   /gene="pilU"
FT                   /locus_tag="PA0396"
FT   CDS_pept        437782..438930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilU"
FT                   /locus_tag="PA0396"
FT                   /product="twitching motility protein PilU"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03785"
FT                   /db_xref="GOA:G3XCX3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:G3XCX3"
FT                   /protein_id="AAG03785.1"
FT                   /translation="MEFEKLLRLMVEKGGSDLFITAGVPPSMKVNGRVMPVTKTPLSPE
FT                   QTRETVLGVMNEQQRRDFAENHECNFAISARGIGRFRVSAFYQRNLVGMVLRRIETNIP
FT                   TLEELKLPEILKKLALTKRGLVIFVGATGTGKSTSLAAMIGYRNKNSTGHIISIEDPIE
FT                   YIHQHQGCIVTQREVGLDTDSFEVALKNTLRQAPDVIMIGEVRSRETMDHAVAFAETGH
FT                   LCLATLHANNANQALERIIHFFPADRHGQVWMDLSLNLKAIVAQQLVPTPDGKGRRAVI
FT                   EVLLNTPLAADLIRKGEVHELKPLMKRSTEQGMQTFDQALYQLYTQGEITYEDALAHAD
FT                   SANDLRLMIKLGSESDADHLSSLTQGLSLEITDDDPAGRRFR"
FT   gene            complement(438938..439837)
FT                   /locus_tag="PA0397"
FT   CDS_pept        complement(438938..439837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0397"
FT                   /product="probable cation efflux system protein"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03786"
FT                   /db_xref="GOA:Q9I6A3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6A3"
FT                   /protein_id="AAG03786.1"
FT                   /translation="MSAGHEHSFAQTNSTRLKWALLLTGSFLVAEVVGGILTGSLALIS
FT                   DAAHMLTDAVALAIALAAINIARRPTNDRLTYGYHRFEILAAAFNAFLLFGVAFYILYA
FT                   AYERLNQPAEIQSVGMLVIAVLGLLVNLASMRLLAPAQGNSLNVKGAYLEVWSDMLGSL
FT                   GVIVAAIVIRFTGWAWVDSLVAVLIGFWVLPRTWILLRESLHVLLEGVPKEIQLAELRE
FT                   ALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPALVDAEALLGTVKALLHDRYEIEHS
FT                   TLQLETSACAQAEEPLAY"
FT   gene            439991..440395
FT                   /locus_tag="PA0398"
FT   CDS_pept        439991..440395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0398"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03787"
FT                   /db_xref="GOA:Q9I6A2"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6A2"
FT                   /protein_id="AAG03787.1"
FT                   /translation="MTQQHDTHSKAIGYLLWIFGFTGSHRFYYGKPITGTIWFFTFGLF
FT                   FIGWIIDLFLIPSMDREADRRFQGGNLDYNVAWILLTFLGVLGVHRMYMGKWITGIIYL
FT                   FTGGLFFLGVLYDFWTLNGQVSERNGPQRI"
FT   gene            440638..442011
FT                   /locus_tag="PA0399"
FT   CDS_pept        440638..442011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0399"
FT                   /product="cystathionine beta-synthase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03788"
FT                   /db_xref="GOA:Q9I6A1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6A1"
FT                   /protein_id="AAG03788.1"
FT                   /translation="MTSDSRPAVLDLIGNTPLVRVTRFDTGPCTLYLKLESQNPGGSIK
FT                   DRIGVAMIEAAERDGRLRPGGTIVEATAGNTGLGLALVGRAKGYRVVLVVPDKMSTEKV
FT                   LHLRAMGAEVHITRSDVGKGHPEYYQDVAARLAQDIPGAFFADQFNNPANPLAHECGTG
FT                   PELWAQTGHDLDAIVVGVGSSGTLTGLTRFFQKVQPELEMVLADPEGSIMAEYSRSGTL
FT                   GTPGSWAVEGIGEDFVPAIADLSSVRHAYSISDEESFAMARELLRVEGIPGGSSTGTLL
FT                   AAALRFCREQKEPKRVVSFVCDTGTRYLSKIYNDQWMTDQGLLQRKHYGDLRDIIARRF
FT                   EEGRVISVGPDDTLLTAFQRMRLADVSQLPVLDDGKLVGVIDESDILLGVHADAPRFRD
FT                   AVSSAMNAAPETLAPGASLAQLQAVLDRGLVAIVADASGFHGLITRFDLLNHLRRKLA"
FT   gene            442008..443192
FT                   /locus_tag="PA0400"
FT   CDS_pept        442008..443192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0400"
FT                   /product="probable cystathionine gamma-lyase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03789"
FT                   /db_xref="GOA:Q9I6A0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I6A0"
FT                   /protein_id="AAG03789.1"
FT                   /translation="MSQHDQHPDAPAQAFATRVIHAGQAPDPSTGAIMPPIYANSTYIQ
FT                   ESPGVHKGLDYGRSHNPTRWALERCVADLEGGTQAFAFASGLAAISSVLELLDAGSHIV
FT                   SGNDLYGGTFRLFERVRRRSAGHRFSFVDPTDLQAFEAALTPETRMVWVETPSNPLLRL
FT                   TDLRAIAQLCRARGIISVADNTFASPYIQRPLELGFDVVVHSTTKYLNGHSDVIGGIAI
FT                   VGDNPDLRERLGFLQNSVGAISGPFDAFLTLRGVKTLALRMERHCSNALALAQWLERQP
FT                   QVARVYYPGLASHPQHELAKRQMRGFGGMISLDLRCDLAGARRFLENVRIFSLAESLGG
FT                   VESLIEHPAIMTHASIPAETRADLGIGDSLIRLSVGVEALEDLQADLAQALAKI"
FT   gene            complement(443419..444690)
FT                   /locus_tag="PA0401"
FT   CDS_pept        complement(443419..444690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0401"
FT                   /product="noncatalytic dihydroorotase-like protein"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03790"
FT                   /db_xref="GOA:Q51551"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51551"
FT                   /protein_id="AAG03790.1"
FT                   /translation="MTISIRGARVIDPASDLDQVGDLHIEAGKIVAIGAAPAGFSAQKT
FT                   LDGAGLVAAPGLVDLSVALREPGYGRKGNVESETRAAAAGGTTSLCCPPYTRPVLDTPA
FT                   VAELILDRAREAGNAKVYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRIL
FT                   RRALEYAATFDLTVIFTSQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLV
FT                   EQSGVRAHFSQLTSARGIELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPP
FT                   LRTRADREALREAVKNGVVQAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLV
FT                   QDGLLDLPTLLARLSHGPAQALRLPAGRLAVGQAADLVLFDPQGSTLAGESWYSKGQNS
FT                   PFVGHCLPGRVRYTLVDGHLTHEG"
FT   gene            complement(444687..445691)
FT                   /gene="pyrB"
FT                   /locus_tag="PA0402"
FT   CDS_pept        complement(444687..445691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="PA0402"
FT                   /product="aspartate carbamoyltransferase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03791"
FT                   /db_xref="GOA:Q59653"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59653"
FT                   /protein_id="AAG03791.1"
FT                   /translation="MPTDAKRPLQLNDQGQLRHFISLDGLPRELLTEILDTADSFLEVG
FT                   ARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLTD
FT                   TLRNLEAMAADMFVVRHSDSGAAHFIAEHVSPNVAVINGGDGRHAHPTQGMLDMLTIRR
FT                   HKGNFEQLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPRTLLPIGLEEQYGVRVF
FT                   TNADEGLKDVDVVIMLRLQRERMQGGLLPSEGEFFKLYGLTEKRLKLAKPDAIVMHPGP
FT                   INRGVEIESAVADGAQSVILNQVTYGIAIRMAVLSMAMSGQNTQRQLEQEDAE"
FT   gene            complement(445715..446227)
FT                   /gene="pyrR"
FT                   /locus_tag="PA0403"
FT   CDS_pept        complement(445715..446227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="PA0403"
FT                   /product="transcriptional regulator PyrR"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03792"
FT                   /db_xref="GOA:Q9X6W6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X6W6"
FT                   /protein_id="AAG03792.1"
FT                   /translation="MSLPNPAELLPRMASDLRAHLAERGIERPRFVGIHTGGIWVAEAL
FT                   LRELGNQEPLGTLDVSFYRDDFTQNGLHPQVRPSALPFEIDGQHLVLVDDVLMSGRTIR
FT                   AALNELFDYGRPASVTLVCLLDLNARELPIRPDVVGQTLSLGRDERVKLVGPAPLALER
FT                   KVLSSAS"
FT   gene            complement(446339..446773)
FT                   /locus_tag="PA0404"
FT   CDS_pept        complement(446339..446773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03793"
FT                   /db_xref="GOA:Q9I699"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I699"
FT                   /protein_id="AAG03793.1"
FT                   /translation="MASDKPLRLLLGFDYGTRQIGVAVGQAVTGQARELCVLKAQNGVP
FT                   DWNRVEALIKEWQPDAIVVGLPLNMDGSPSEMSERAEKFGRRLNGRFNLPVFTHDERLT
FT                   TYAAKGERLAQGQRDGYRERPVDALAAALLLEGWLAEHPD"
FT   gene            complement(446773..447342)
FT                   /locus_tag="PA0405"
FT   CDS_pept        complement(446773..447342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03794"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="PDB:2MUI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RQ16"
FT                   /protein_id="AAG03794.1"
FT                   /translation="MKQSSPTYLKHHFLIAMPHMADPNFAQTVTYLVEHNEQGAMGLVI
FT                   NRPSGLNLAEVLEQLKPDALPPARCQHIDIYNGGPVQTDRGFVLHPSGLSYQSTLELGE
FT                   LAMSTSQDVLFAIAAGTGPEKSLISLGYAGWEAGQLEAELSDNAWLTCPADPAILFDLP
FT                   PEERLSAAAARLGVNLSLLTAQAGHA"
FT   gene            complement(447391..448350)
FT                   /gene="tonB3"
FT                   /locus_tag="PA0406"
FT   CDS_pept        complement(447391..448350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB3"
FT                   /locus_tag="PA0406"
FT                   /product="TonB3"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PA0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03795"
FT                   /db_xref="GOA:Q9I698"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I698"
FT                   /protein_id="AAG03795.1"
FT                   /translation="MRHRLFRPPSADFAPRQPPRSAMNAAVLKSPSAAAGVRPADRLGF
FT                   TLFIAAILHVAFILGVGFSMPAPSQISKTLEITLATFKSDKAPEKADYLAQMNQQGSGT
FT                   LEHKAAPKTTEVAPFQDNQVKKVAPPATPKQARSEEAPKVAVTTTRQRQQKAPSKTQAQ
FT                   KAEQVAKPAPHFDSTQLSAEIASLEADLAKEQQAYAKRPRIHRLSAASTMRDKGAWYKE
FT                   DWRKKIERIGNLNYPDEARRQKLYGSLRLLVSINRDGTIYEVQVLESSGEPILDQAAQR
FT                   IVRLAAPYAPFSGDLADIDRLEIIRTWRFERGDRLSSK"
FT   gene            complement(448431..449384)
FT                   /gene="gshB"
FT                   /locus_tag="PA0407"
FT   CDS_pept        complement(448431..449384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="PA0407"
FT                   /product="glutathione synthetase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03796"
FT                   /db_xref="GOA:Q9I697"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I697"
FT                   /protein_id="AAG03796.1"
FT                   /translation="MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDLY
FT                   QKAGVARGRMRPLKVFNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYLLE
FT                   QAERAGALVVNRPQSLRDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIILKPL
FT                   DGMGGSSIFRHREGDPNLSVILETLTQHGSQQIMAQRYLPEIKDGDKRILMIDGEPVPY
FT                   CLARIPAQGETRGNLAAGGRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVIGDYLT
FT                   EINVTSPTCIREIDQAFDTRIGDKLMDAIAAQLAAR"
FT   gene            449639..450046
FT                   /gene="pilG"
FT                   /locus_tag="PA0408"
FT   CDS_pept        449639..450046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="PA0408"
FT                   /product="twitching motility protein PilG"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03797"
FT                   /db_xref="GOA:P46384"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46384"
FT                   /protein_id="AAG03797.1"
FT                   /translation="MEQQSDGLKVMVIDDSKTIRRTAETLLKKVGCDVITAIDGFDALA
FT                   KIADTHPNIIFVDIMMPRLDGYQTCALIKNNSAFKSTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQYLTKPFSKEELLGAIKAHVPSFTPVDAVS"
FT   gene            450093..450458
FT                   /gene="pilH"
FT                   /locus_tag="PA0409"
FT   CDS_pept        450093..450458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilH"
FT                   /locus_tag="PA0409"
FT                   /product="twitching motility protein PilH"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03798"
FT                   /db_xref="GOA:P43501"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43501"
FT                   /protein_id="AAG03798.1"
FT                   /translation="MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGGDGVALARQEK
FT                   PDVVLMDIVMPGLNGFQATRQLTKDAETSAIPVIIVTTKDQETDKVWGKRQGARDYLTK
FT                   PVDEETLLKTINAVLAG"
FT   gene            450509..451045
FT                   /gene="pilI"
FT                   /locus_tag="PA0410"
FT   CDS_pept        450509..451045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="PA0410"
FT                   /product="twitching motility protein PilI"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03799"
FT                   /db_xref="GOA:P43502"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43502"
FT                   /protein_id="AAG03799.1"
FT                   /translation="MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGGR
FT                   FFVAPMGEVGEVLHEPRYTQLPGVKTWVKGVANVRGRLLPIMDLCGFLGTELSPLRKQR
FT                   RVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWLVFS
FT                   PHALAQHQGFLDVAV"
FT   gene            451130..453178
FT                   /gene="pilJ"
FT                   /locus_tag="PA0411"
FT   CDS_pept        451130..453178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilJ"
FT                   /locus_tag="PA0411"
FT                   /product="twitching motility protein PilJ"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03800"
FT                   /db_xref="GOA:P42257"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42257"
FT                   /protein_id="AAG03800.1"
FT                   /translation="MKKINAGNLFAGMRSSSVIAGLFIVLIVSIVLLFANFAYLNTQSN
FT                   HDKQYIGHAGELRVLSQRIAKNATEAAAGKGEAFKLLKDARNDFEKRWNILVNGDESTS
FT                   LPPSPEAVKPQMDVVQQDWDGLRKNADSILASEQTVLSLHQVASTLAETIPQLQVEYEE
FT                   VVDILLENGAPADQVAVAQRQSLLAERILGSVNKVLAGDENSVQAADSFGRDASLFGRV
FT                   LKGMQEGNAAMSISKVTNAEAVDRLNEIAELFEFVSGSVDEILETSPDLFQVREAANNI
FT                   FSVSQTLLDKASQLADGFENLAGGRSINLFAGYALGALALASIILIGLVMVRETNRRLA
FT                   ETAEKNDRNQAAILRLLDEIADLADGDLTVAATVTEDFTGAIADSINYSIDQLRELVET
FT                   INQTAVQVAAAAQETQSTAMHLAEASEHQAQEIAGASAAINEMAVSIDQVSANASESSA
FT                   VAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIAD
FT                   QTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAV
FT                   ISMEQTTSEVVRGARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQASSAGHISNTM
FT                   NVIQEITSQTSAGTTATARSIGNLAKMASEMRNSVSGFKLPEGVEQA"
FT   gene            453239..454114
FT                   /gene="pilK"
FT                   /locus_tag="PA0412"
FT   CDS_pept        453239..454114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilK"
FT                   /locus_tag="PA0412"
FT                   /product="methyltransferase PilK"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03801"
FT                   /db_xref="GOA:G3XCT5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:G3XCT5"
FT                   /protein_id="AAG03801.1"
FT                   /translation="MQANGVWSLQPLADMSAAEFRDWQVLLENRTGVVLNEQRRTFLQA
FT                   SLTARMRELGIGDYHSYYRQVTDGPRGAVEWATLLDRLTVQETRFFRHPPSFELLERYL
FT                   GERLRREGMPRPWALWSVGCSSGEEPYSLAMCAAQVLRGQEREDFFGVTGTDISLHALQ
FT                   RARQANYPARKLEQLEAGLVERYCERQADGSFSVKTILTERVCCARLNVLDLAKAPWSG
FT                   MDVIFCQNLLIYFRRWRRREILNRLAERLAPGGLLVIGVGEVVDWSHPELEPVADERVL
FT                   AFTRKGYSGT"
FT   gene            454126..461544
FT                   /gene="chpA"
FT                   /locus_tag="PA0413"
FT   CDS_pept        454126..461544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpA"
FT                   /locus_tag="PA0413"
FT                   /product="component of chemotactic signal transduction
FT                   system"
FT                   /note="Product name confidence: Class 1: Function
FT                   experimentally demonstrated in P. aeruginosa."
FT                   /db_xref="EnsemblGenomes-Gn:PA0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03802"
FT                   /db_xref="GOA:Q9I696"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I696"
FT                   /protein_id="AAG03802.1"
FT                   /translation="MGDRHDYVALEWVKGEIAETLKQARQALEAFVENPQDPTRMRFCL
FT                   TYVHQVQGTLQMVEFYGAALLAEEMEQLVQALLDGRVPNQGEALEVLMQAILQLPVYLD
FT                   RIQTARRDLPMVVLPLLNDLRAARGEKLLSETSLFAPDLSQRQPQLDGEAIAQLRTDEL
FT                   GGLLRKLRQTQQMALVGLLRNQDVATSLGYLARVYARLEGLCREAPLGPLWSIASGLVE
FT                   GLANGSVVNSASVRTLLRQLDRELKRLVEQGADGLNQAAPDELVKNLLFYVAKAPSQSP
FT                   RIRALKEQYRLDEALPDHETVDAERARLAGPDRDAMRSVVGALCEELVRIKDSLDLFVR
FT                   SDRGHPSELDALLAPLKQIADTLAVLGFGQPRKVILDQLDVIHALAQGRREPSDAILMD
FT                   VAGALLYVEATLAGMAGPGDERNSEESRLPTTDVAQIHQLVIKEARNGLEQAKDAIIEF
FT                   IASQWNHEHLARVPELLTQVRGGLAMIPLERAATLLETCNRYIQEQLLARKAVPDWQSL
FT                   DTLADAITSVEYYLERLSEDHASQSDLILDVAEDSLANLGYTLKPNSSAPAEPGLSGPA
FT                   AIESPAAEPERPEAVVEVAETAEQPPADTAPAEAAREDAPQLASDDNWTLGEVAPDAGE
FT                   PSLDLALDLPLDDSAEVPPALPEVVEESGQPQSTSAPARSLDDFSLDEIDLSGLDLPAD
FT                   AAPASGPAALADWSLPEQWGLGDDLAQPAQAGETLDLSLEEPALSFDAPLESLEPLPAL
FT                   EPFDGSAEQELVLDALDPLPLDVALPEAEGEVSAWEGSSLEELDLSDLDLPEVQLPEAE
FT                   AEAPPAAEALASEAPALSLAEVMAAPVQPINPPAQNVPVSLLPPPADEEPVDEELREVF
FT                   IEEAGEVLETIGRYLPAWKADHDDREALTEVRRAFHTLKGSGRMVRALVIGELAWSIEN
FT                   LFNRVLDRSIAASEPVQRVVDQVVALLPELVEEFAANAQRQRDDVDLLAATAHALAKGE
FT                   PLPEPPAPDDGGVPPEAGAEQPSSLDNGVQAPPLADAPQAAAEAQSDVELLDPQLLEIF
FT                   TNEAETHLEALVGFLADCARELPQPVTDALQRALHTLKGSAHMAGILPIAEIATPLEKL
FT                   VKEYKSNLLAFDLREAELLHDAEQLFRIGLEQVGAQRPLNPIPGSDALLERIEALHQER
FT                   IASLEAERYSDAGERRDPLLIEAFLVEGMDILLDAEDLLERWHEHPQERQELSALREEL
FT                   STLDRGARHAELPQVEELCQALLALYDAVEEGRLAVSPAFFEEARQAHEALIGMMDQVA
FT                   AGLQVTPRPERVAALQELLEAPAAEAVPFIDPESLGADDFPPEDEEPALPEAVYEEAGA
FT                   PAEETVPAAPAPAPGRELDEEMVSIFLEEAVDILESAGQALAQWQAEPGALSSLSALQR
FT                   DLHTLKGGARMAEIAEIGDLAHELEALYEGLVDRRYQHSPQLAGLLQACHDRLAEQLDQ
FT                   LSAGQPLADPHDLIQSIRRFRQGPVAEAATPGEAESPVEELVAPAVEEPAAPAAEAFEE
FT                   RDPELVEIFLEEGFDILDSAAAALQRWMDDVDNTIELEALQRDLHTLKGGARMAEIGEI
FT                   GDLAHELEFLYEGLCGGRLRASPALFGLLQRCHDELAEMLEAVRGHRTLPDGQALIAEI
FT                   RRLRSDPDEQLSVPTSVSLKPLAAKGAAADESEILDIFLEEADDLLENLELALGRWDGG
FT                   NGDAQPLDDLLRILHTLKGGARLAGQTELGNLAHDLEQHLTDAQQQGAPWPDSLLLDAQ
FT                   SGLEGLQRQVDLLRERLAEDDEAGERPEPAQALVQADDTDRAVASALAELTRLAPAAGA
FT                   IMAAEAAPPAAPATTLPFVRKAQEAAQEAASRRAPQELVKVPAELLENLVNLAGETSIF
FT                   RGRVEQQVSDVGFTLGEMESTIERVRDQLRRLDTETQAQILSRHQADAERAGYEEFDPL
FT                   EMDRYSQLQQLSRALFESASDLLDLKETLAAKNRDAETLLLQQARVNTELQEGLMRTRM
FT                   VPFDRLVPRLRRIVRQVAGELGKQVEFVVGNADGEMDRTVLERIVAPLEHMLRNAVDHG
FT                   IESGETRRAAGKPEHGTIRLNIGREGGDILLTLSDDGAGIRLDAVRRKAIERGLMSADS
FT                   DLSDHEVLQFVLESGFSTAEKVTQISGRGVGLDVANSEVKQLGGSVSIQTEPGQGTRFN
FT                   VRLPFTVSVNRALMVLSGEDLYAVPLNTIEGIVRVSPYELEALYDQRGEAGLDTPSFEY
FT                   AGQSYELKYLGELLNNGQEPKLVGQSLPLPVILVRSSEHAVAVQVDSLAGSREIVVKSL
FT                   GPQFAGVAGISGATLLGDGRVVVILDLLATIRSRHALLGQESRRERLALRQEMAASESE
FT                   QQRPPLVMVVDDSVTVRKVTTRLLERNGMNVLTAKDGVDAIAQLQEHRPDILLLDIEMP
FT                   RMDGFEVATLVRHDERLGNLPIIMITSRTGEKHRERALGIGVNQYLGKPYQETELLEAI
FT                   QSLVGQHE"
FT   gene            461537..462568
FT                   /gene="chpB"
FT                   /locus_tag="PA0414"
FT   CDS_pept        461537..462568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpB"
FT                   /locus_tag="PA0414"
FT                   /product="probable methylesterase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03803"
FT                   /db_xref="GOA:G3XD63"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:G3XD63"
FT                   /protein_id="AAG03803.1"
FT                   /translation="MSERVTPRVAVIADTSLQRHVLQQALLGHGYEVVLNADPARVDDA
FT                   ALECAPDLWLVDLTQQDDSPLLDSLLEQDRAPVLFGEGHAPERHTEHYPRWERRLIGKL
FT                   KRLIGDPSDGVGDSLGALLDEERPPRLEIPGDLAAMPLQAGEAAREVWLLAASLGGPAA
FT                   VKAFLDALPGGLPIGFLYAQHIDASFEQNLPQAVGRHSQWHVKNVRDGEALRCGEVMVV
FT                   PVLHELGFHHDGRLKCSQRSWPEPYTPSIDQMMLNLAQQFGPDCGVIVFSGMGSDGSAA
FT                   AAYVRRQGGEVWTQRADSCVCSSMPDSLREAGYSSFNASPRELAEALVKHLAARCAPTG
FT                   VET"
FT   gene            462565..463071
FT                   /gene="chpC"
FT                   /locus_tag="PA0415"
FT   CDS_pept        462565..463071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpC"
FT                   /locus_tag="PA0415"
FT                   /product="probable chemotaxis protein"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03804"
FT                   /db_xref="GOA:G3XD95"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:G3XD95"
FT                   /protein_id="AAG03804.1"
FT                   /translation="MNQAVIEQDGMSRNTPANPTPDSLTGLLLPLSDRTLLLPNVAVAE
FT                   LIAYRNPQVAAGLPQWYLGQVAWRDLRLPLLSFEAASSGEQQPVLGSSARVVVINALGG
FT                   RPHVKFLALLVQGIPRSVRLDANLAGTAAPLVALELAAVDIGGETARIPDLAGLEEKLA
FT                   DAGLI"
FT   gene            463079..463873
FT                   /gene="chpD"
FT                   /locus_tag="PA0416"
FT   CDS_pept        463079..463873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpD"
FT                   /locus_tag="PA0416"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03805"
FT                   /db_xref="GOA:G3XCU1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:G3XCU1"
FT                   /protein_id="AAG03805.1"
FT                   /translation="MAGLQHARIGASLEVASASLAGHRFEKHSHDEFVISANLCGLEDV
FT                   WLDGRTFQADSGDLTLYNPGQIQGGGVRDGQPWRFASLYLPAAELASSLDLSSVEFDRP
FT                   LLRSPALGRELAASIEALLASDRFARERGEERLLEFLGRLLAASGTRLPQRADPGRPAV
FT                   ARLQALLAERLAEPPDLDGMAEQVGLSKYHLLRAFKKATGLSPRQWSMQLRTRRALGLL
FT                   RRGLAVGEVAHALGFADQSHLTRYFTSAYGISPGRYQRAVRG"
FT   gene            463949..464560
FT                   /gene="chpE"
FT                   /locus_tag="PA0417"
FT   CDS_pept        463949..464560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpE"
FT                   /locus_tag="PA0417"
FT                   /product="probable chemotaxis protein"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03806"
FT                   /db_xref="GOA:O87005"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87005"
FT                   /protein_id="AAG03806.1"
FT                   /translation="MLAIFLAALLFGFAFNVSPGAVFSETLRRGLTGGFRPALLVQLGS
FT                   LIGDAVWALLGLTGLALLLGYEQVRIPLTLACAAYLAWLGVQGLRDAWSPPLAAEDAGE
FT                   QGRNAFGAGAAISLSNPKNVVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCF
FT                   CCAALVDWLRRNTSLFWHRVSYAGCGVLLLGLAGLALRGL"
FT   gene            complement(464568..465983)
FT                   /locus_tag="PA0418"
FT   CDS_pept        complement(464568..465983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0418"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03807"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I695"
FT                   /protein_id="AAG03807.1"
FT                   /translation="MNTVAQPTSQRIARMDTPVTFDWKIRLPDVLGVLRRDYAGRFPQL
FT                   ASAALETLLERLRDDLPEDFLPALGQELESLGLALVERLDEDDSLNLYVVGAPHSQRLL
FT                   DALAAQGHNARTLRQENAPEGARAALPAAAPAGLAPASAYICLEHAEHLAPGLAIARLP
FT                   GEDSRDLLDLRQWPRLQRLPDGAEETQGALLCRASSADGLHAWVRMTRSGSPYAWLHRS
FT                   RDLASLTPELPPLPLPPAQSLRQRRTPELAIGLAGDDLLLADRGLFFLYPGFAQGNDEP
FT                   RLLFEVPQARRSIENPPAVFTTPDQRVCLLSRGQFFEWREARIQPLPFPVGKDLPADPA
FT                   QPTSAAPGTIVWLERETLCEGRLDSGEIRSHSLDGLAEGPYLKLQALDGGWLLLAPWLE
FT                   PHRSRDLAQLWHLESGRALRIRYGELDLEGGLQHWAELPDGRIVVGDHARHVDLGTFES
FT                   LRQRLLRRRLAPA"
FT   gene            complement(466018..466740)
FT                   /locus_tag="PA0419"
FT   CDS_pept        complement(466018..466740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03808"
FT                   /db_xref="GOA:Q9I694"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I694"
FT                   /protein_id="AAG03808.1"
FT                   /translation="MRLSRFFVDQPLSLGQHDLPEAQAHYIGRVLRHATGDAVQLFDGS
FT                   GREYLGELVEVGKKNVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVA
FT                   EITPIVSERCEVRLKDERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRD
FT                   DDLRLVLHPVAAPLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGFHSARLGPRVLRTE
FT                   TAPVVALAVAQQLWGDFA"
FT   gene            complement(466833..468236)
FT                   /gene="bioA"
FT                   /locus_tag="PA0420"
FT   CDS_pept        complement(466833..468236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="PA0420"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03809"
FT                   /db_xref="GOA:Q9I693"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I693"
FT                   /protein_id="AAG03809.1"
FT                   /translation="MGLNADWMQRDLNVLWHPCTQMKDHERLPVIPIRRGEGVWLEDFE
FT                   GKRYIDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVIELSERLVKITP
FT                   PGLDRVFYADSGSAGIEVALKMSYHFWLNSGRPRKKRFVTLTNSYHGETIAAMSVGDVA
FT                   LFTETYKSLLLDTIKVPSPDCFLRPDGMCWEEHSRNMFAHMERTLAEGHDEIAAVIVEP
FT                   LIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIAPDFLC
FT                   LSKALTGGYLPMSAVLTSETIYRGFYDDYQTLRAFLHSHTYTGNPLACAAALATLDIFE
FT                   EDKVIEANRALSTHMARATAHLADHPHVAEVRQTGMVLAIEMVQDKASRTPYPWQERRG
FT                   LKVFQHGLERGALLRPLGSVVYFLPPYVITPEQIDFLAEVASEGIDIATRDAVSVAVSD
FT                   FHPDHRDPG"
FT   gene            468410..469900
FT                   /locus_tag="PA0421"
FT   CDS_pept        468410..469900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0421"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03810"
FT                   /db_xref="GOA:Q9I692"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I692"
FT                   /protein_id="AAG03810.1"
FT                   /translation="MSLRWLRAAAFLMLGVFSAVALGKDKQPTAIVVGAGLAGLSAAYE
FT                   LQKDGWQVTVLEARPQVGGRSGLATSEWVGNQKVQPTLNAYLDTFKLKPVPAPDFVRTP
FT                   SYLIDGLYYSSSDLALKQPNVAADLKRFESTLDDLSASISDPLNPASSNTLFALDQMNA
FT                   ARWLDKLNLSPTARLLVNQRIRSRYDEPSRLSLLYLAQQGRAYRGVDDRDLRAARLPGG
FT                   SQVLAEAFVKQIKTIKTKSKVSSIVQAKDGVAVKAGSETYKADYVVLAVPLKALGQIQM
FT                   TPSLSGTQMSALKGTNYGWRDQILLKFKRPVWDDKSRLSGEIFSDQGLGMIWVEPALKG
FT                   GANVLINLSGDNARVLQAFGDRQMVDQVLIRMNKFYPKMRGAFAGYEIRRYSADPGTGG
FT                   SYLAYGPGQVTRFWRIWEQPLSRVAFAGEHTDALYPGTIEGALRSGKRAASQVRDLYAG
FT                   KTPVIEGAPMVAKAEKVAAPTTGGEKKNPFAWFTRLFD"
FT   gene            470081..470650
FT                   /locus_tag="PA0422"
FT   CDS_pept        470081..470650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03811"
FT                   /db_xref="GOA:Q9I691"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I691"
FT                   /protein_id="AAG03811.1"
FT                   /translation="MQWRNTSSRYGVFSLFLHWGSALVVFGLFGLGLWMRELSYYDPWY
FT                   HPAPALHKSIGILLAIALLVRIVWRFVSPPPPAPANHGPLTRVASKLGHLALYGLLLAV
FT                   IVAGYLISTADGEPISVFGWFSVPATLSGLPDQADVAGEIHLYLAWALVVFAVLHALAA
FT                   LKHHFVDRDPTLKRMLGRSSNDQQPR"
FT   gene            470662..471237
FT                   /gene="pasP"
FT                   /locus_tag="PA0423"
FT   CDS_pept        470662..471237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pasP"
FT                   /locus_tag="PA0423"
FT                   /product="PasP"
FT                   /note="Class 1: Function experimentally demonstrated in P.
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PA0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03812"
FT                   /db_xref="GOA:Q9I690"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I690"
FT                   /protein_id="AAG03812.1"
FT                   /translation="MLKKTLAALALGSALFTAGQAMAADYKIDKEGQHAFIEFRIKHLG
FT                   YSWLYGRFNDFDGSFTFDEKNPSADKVKVTINTNSVDTNHAERDKHLRSGDFLNVSKNP
FT                   TATFESTEVKANGDSADITGNLTLNGVTKPVTIKAKLIGQGDDPWGGYRAGFEGSATLK
FT                   LKDFGIKMDLGPASQEVELLLSVEGIRQ"
FT   gene            complement(471306..471749)
FT                   /gene="mexR"
FT                   /locus_tag="PA0424"
FT   CDS_pept        complement(471306..471749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexR"
FT                   /locus_tag="PA0424"
FT                   /product="multidrug resistance operon repressor MexR"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03813"
FT                   /db_xref="GOA:P52003"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:1LNW"
FT                   /db_xref="PDB:3ECH"
FT                   /db_xref="PDB:3MEX"
FT                   /db_xref="PDB:4ZZL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52003"
FT                   /protein_id="AAG03813.1"
FT                   /translation="MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKL
FT                   IDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAI
FT                   HQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQPLEDI"
FT   gene            472024..473175
FT                   /gene="mexA"
FT                   /locus_tag="PA0425"
FT   CDS_pept        472024..473175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexA"
FT                   /locus_tag="PA0425"
FT                   /product="Resistance-Nodulation-Cell Division (RND)
FT                   multidrug efflux membrane fusion protein MexA precursor"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03814"
FT                   /db_xref="GOA:P52477"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="PDB:1T5E"
FT                   /db_xref="PDB:1VF7"
FT                   /db_xref="PDB:2V4D"
FT                   /db_xref="PDB:4DK1"
FT                   /db_xref="PDB:6IOK"
FT                   /db_xref="PDB:6IOL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52477"
FT                   /protein_id="AAG03814.1"
FT                   /translation="MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLEA
FT                   QTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQ
FT                   SAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSP
FT                   ISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERA
FT                   GDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQ
FT                   LQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNA
FT                   GDKIITEGLQFVQPGVEVKTVPAKNVASAQKADAAPAKTDSKG"
FT   gene            473191..476331
FT                   /gene="mexB"
FT                   /locus_tag="PA0426"
FT   CDS_pept        473191..476331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexB"
FT                   /locus_tag="PA0426"
FT                   /product="Resistance-Nodulation-Cell Division (RND)
FT                   multidrug efflux transporter MexB"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03815"
FT                   /db_xref="GOA:P52002"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="PDB:2V50"
FT                   /db_xref="PDB:3W9I"
FT                   /db_xref="PDB:3W9J"
FT                   /db_xref="PDB:6IIA"
FT                   /db_xref="PDB:6IOK"
FT                   /db_xref="PDB:6IOL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52002"
FT                   /protein_id="AAG03815.1"
FT                   /translation="MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIAV
FT                   QVSYPGASAETVQDTVVQVIEQQMNGIDNLRYISSESNSDGSMTITVTFEQGTDPDIAQ
FT                   VQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVSNIQ
FT                   DPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGL
FT                   PAVKGQQLNATIIGKTRLQTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINAQF
FT                   NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEV
FT                   VKTLGEAILLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAF
FT                   FGGSTGVIYRQFSITIVSAMALSVIVALILTPALCATMLKPIEKGDHGEHKGGFFGWFN
FT                   RMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPDEDQGVLFAQV
FT                   QTPPGSSAERTQVVVDSMREYLLEKESSSVSSVFTVTGFNFAGRGQSSGMAFIMLKPWE
FT                   ERPGGENSVFELAKRAQMHFFSFKDAMVFAFAPPSVLELGNATGFDLFLQDQAGVGHEV
FT                   LLQARNKFLMLAAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAW
FT                   GSSYVNDFIDRGRVKRVYLQGRPDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGS
FT                   PKLERYNGVPAMEILGEPAPGLSSGDAMAAVEEIVKQLPKGVGYSWTGLSYEERLSGSQ
FT                   APALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLATSMRGLSNDVFFQVGL
FT                   LTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVVPLAI
FT                   STGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVSTLFKDEASKQQASVEKGQ"
FT   gene            476333..477790
FT                   /gene="oprM"
FT                   /locus_tag="PA0427"
FT   CDS_pept        476333..477790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="PA0427"
FT                   /product="Major intrinsic multiple antibiotic resistance
FT                   efflux outer membrane protein OprM precursor"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03816"
FT                   /db_xref="GOA:Q51487"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="PDB:1WP1"
FT                   /db_xref="PDB:3D5K"
FT                   /db_xref="PDB:4Y1K"
FT                   /db_xref="PDB:6IOK"
FT                   /db_xref="PDB:6IOL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51487"
FT                   /protein_id="AAG03816.1"
FT                   /translation="MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNT
FT                   GAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPR
FT                   IGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLAT
FT                   EQAQRSAQTTLVASVATAYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALD
FT                   LRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLDQTLLTEVPAGL
FT                   PSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGS
FT                   WLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQ
FT                   LQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVN
FT                   LYKALGGGWNQQTVTQQQTAKKEDPQA"
FT   gene            complement(477886..479805)
FT                   /locus_tag="PA0428"
FT   CDS_pept        complement(477886..479805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0428"
FT                   /product="probable ATP-dependent RNA helicase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03817"
FT                   /db_xref="GOA:Q9I689"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I689"
FT                   /protein_id="AAG03817.1"
FT                   /translation="MSFSSLGLSEALARAVEAAGYSQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPVLERLFPAGHPDREHRHGPRQARVLVLTPTRELAAQVHDSFKVYAR
FT                   DLPLNSTCIFGGVGMNPQIQALAKGVDVLVACPGRLLDLAGQNKVDLSHVEILVLDEAD
FT                   RMLDMGFIHDVKKVLAKLPPKRQNLLFSATFSKDIVDLANKLLHNPERIEVTPPNTTVE
FT                   RIEQRVFRLPAPQKRALLAHLVTVGAWEQVLVFTRTKHGANRLAEYLTKHGLPAAAIHG
FT                   NKSQNARTKALADFKANDVRILVATDIAARGLDIDQLPHVVNYELPNVEEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKAIEKMTRQRIPDGDAQGFDPEAVLPEVAQPEPREAPQ
FT                   KQPRRDKERRSSRERKPKDAQASNPDSNVAAAQDGTEKPAGKRRRRGGKNKENREAGQA
FT                   QQPRQSREARPAKPNRPPEVDGNRDPEEFLDDDFDNFGNRADYVSPYQGQENKGRGRRG
FT                   GQQKPQGGTGQQGRGQGQGQARGKSQGAAQGGARGQGAGQGKAKKPRAGKPRGQGRENA
FT                   SRMSDAPLREPSEYGTGKQPSRQPVVINKRDLVRMDRFPTAEQLDELEPRRKGERPALL
FT                   TRNR"
FT   gene            complement(480056..481126)
FT                   /locus_tag="PA0429"
FT   CDS_pept        complement(480056..481126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0429"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03818"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I688"
FT                   /protein_id="AAG03818.1"
FT                   /translation="MANSRKHLIYLVYGRQTYHQEALFSIASAFAHLRDGAAHGLTVRV
FT                   YTDDPSPYAGLPVQVREVTAEELVAWCQPHGYHFRAKHVALRDALEEADQALLIDTDTF
FT                   FHSSPLRLFDRIQPGSLLCNAIGARYGEHRNFPLYRDLSPYLFERGWADDEMHQLNSGV
FT                   IGLPREEAKILDRSLELMDELYPIANGAYTLEEFVLAVAAHKRLELVGCTDLIHHYWSR
FT                   KQLFRAKIQAWLCKHGSSLLSAAALDDTLKVTDRLPRPPRAKRLLYKLGTLPLPAPMRQ
FT                   FSIELLYGCHEYSNEFDRACGPVWWEKAATNAIERYPQEPIAEQIEDWLNHSLLRNLLG
FT                   SRANEIRQHLRQRDLL"
FT   gene            complement(481196..482068)
FT                   /gene="metF"
FT                   /locus_tag="PA0430"
FT   CDS_pept        complement(481196..482068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="PA0430"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03819"
FT                   /db_xref="GOA:Q9I687"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I687"
FT                   /protein_id="AAG03819.1"
FT                   /translation="MVASKEPIMSQSERRFSFEFFPAKTEAGHEKLLATARNLAGYKPD
FT                   FFSCTYGAGGSTRDRTLSTVLQLDGEVKVPTAPHLSCVGDSKAELRELLGRYREAGIRR
FT                   IVALRGDLPSGMGMASGELRYANELVDFIRTETGDHFHIEVAAYPEVHPQARSFEDDLA
FT                   NFVRKVKAGASSAITQYFFNADAYFYFVERVAKLGVDIPVVPGIMPITNYSKLARFSDA
FT                   CGAELPRWIRKQLEAYGDDSRSIQAFGEQVISEMCERLLEGGAPGLHFYTLNQADPSLA
FT                   IWKNLQLPR"
FT   gene            complement(482111..482665)
FT                   /locus_tag="PA0431"
FT   CDS_pept        complement(482111..482665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0431"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03820"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I686"
FT                   /protein_id="AAG03820.1"
FT                   /translation="MSAPTMSTHLADHYNQAWLFAARAHRNQTLSGSPLPYLVHLGMVA
FT                   NELLAADRDGAIERLGETLQIAVLHDTLEDTATSPEELRQQFGEFVCAGVQALSKRVGD
FT                   GPKRSLDDYLQALAEGPAQYALVKLCDRITNLQPPPQTWNQDKIANYHQESQLILARLG
FT                   HAHAATARRLREKIEHYRQYY"
FT   gene            complement(482706..484115)
FT                   /gene="sahH"
FT                   /locus_tag="PA0432"
FT   CDS_pept        complement(482706..484115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sahH"
FT                   /locus_tag="PA0432"
FT                   /product="S-adenosyl-L-homocysteine hydrolase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03821"
FT                   /db_xref="GOA:Q9I685"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="PDB:6F3N"
FT                   /db_xref="PDB:6F3O"
FT                   /db_xref="PDB:6F3P"
FT                   /db_xref="PDB:6F3Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I685"
FT                   /protein_id="AAG03821.1"
FT                   /translation="MSAVMTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRKY
FT                   AGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIP
FT                   VFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHKKYPQMLERIHGITE
FT                   ETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGK
FT                   QALVIGYGDVGKGSSQSLRQEGMIVKVAEVDPICAMQACMDGFEVVSPYKNGINDGTEA
FT                   SIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWE
FT                   EVKPQVHKIHRTGKDGFDAHNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQI
FT                   HLFEQKYADLPAAEKAKRLSVEVLPKKLDEEVALEMVKGFGGVVTQLTPKQAEYIGVSV
FT                   EGPFKPDTYRY"
FT   gene            484404..484838
FT                   /locus_tag="PA0433"
FT   CDS_pept        484404..484838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0433"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03822"
FT                   /db_xref="GOA:Q9I684"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I684"
FT                   /protein_id="AAG03822.1"
FT                   /translation="MLECAVMRIAPISRSPLLQWLSFALCACVLVNALACGVLHLQALG
FT                   VGSDKGQKASVGLFCVAGASQWLSLDPDDGAAGDPAPINPQLPMSCPMCSALVLFVALG
FT                   VIWSWRLQRRRHARFRPPATREPVPPRYVWPPANPRASPA"
FT   gene            484964..487156
FT                   /locus_tag="PA0434"
FT   CDS_pept        484964..487156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0434"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03823"
FT                   /db_xref="GOA:Q9I683"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I683"
FT                   /protein_id="AAG03823.1"
FT                   /translation="MKKHSTARRVLALGLNLTLAGVPALLWADEEPTELPALTVSAGAA
FT                   GETPPALDLDDSAGGGSRLGLSLRETPGSVSVANRASFERRGLRSTQDIANSLPGVNAS
FT                   APPGFGGFVTYRGFSSNQVNQLFNGIPVQYSSAMRPLDDWIVDRVELVGGPSSFLNGAG
FT                   AVGGSLDYISKLADRYGDFMEGRVRYGSYDDSEVAFGFNQALGIGPEPKHFVRLDVSRS
FT                   GGNGYVDRNSRESWNVAFSLLSDLTPDLSHTLALEYQDEQEDSPYWGTPVLNPYAGELK
FT                   IDKSRRRENYNVADGRYEQRVRWLRSILEYRVSDSTRWRNTFYHYDAERDYRNLETYRY
FT                   NADNSGVVRSNAFLQRHDQQLNGNRFELQHSQPLFGLASDWALGFDYSINKQTRFPSTA
FT                   SGPFGTVDPASFEPGHFYDLPGMRPGHRKDRSNEVRTSALFAENRLGLTDELSLVTGLR
FT                   YDHLDLDVRNHRVPDKDNPAHFERRWDVVTGRAGLVYQFTPHANVYLQYSTAADPPGGV
FT                   LTSASFGQVRDYDLSTGDQWELGSKFDFLDGRGSATLAAYRIVRRDFSVADPNNPNLSV
FT                   PVGQQTSRGIEAAASLRITPKLLAEGNFAWVDAQYDEFTENVGGVAVSRKGKTPPNVPE
FT                   RVGNLWLTYDFDPAWQGGVDARYVSSVYANNANTWHVPSYTVYGTFLSYRLDERTRITG
FT                   RVRNLTDEVYARFVQSTPLYYVGDPRTFELSVQTRF"
FT   gene            487167..488645
FT                   /locus_tag="PA0435"
FT   CDS_pept        487167..488645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0435"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03824"
FT                   /db_xref="GOA:Q9I682"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I682"
FT                   /protein_id="AAG03824.1"
FT                   /translation="MKRYLYLWHRWLGIGCCLLMVLWFVSGMVMLYVGYPKLTPLERLA
FT                   HLPELDGCEACVPLRTALAGSDGKTPRSIRLASVGGLPTYLLDDADGRTRALAARDGRP
FT                   LAVDADRVLASARAFSGEVPMQLQGRFEEDAWTHTRNLDPHRPLWRVQTADEQGRLLYL
FT                   SSQTGEVVRDASRRERAWNWLGAWLHWLYPLRGGWFDGQWANLVIGLSLLATLVTVLGI
FT                   LVGLLRWRFRKPYRSGSRSPYAGGFQRWHHLAGLLFGALVLSWIFSGLMSMNPWNLFGR
FT                   GTPLDLAAYQGGSWDRALPAGLEADAVLRRLRAAGLRVRELEWRALDGEPYALGRSASG
FT                   NSLLLTADGEILRELPADRLLAAARALLPGVPMQAERLERYDFYYYPREEHSMMGYLER
FT                   RLPVWRLRFDDSRHTWVHLDPYSGAVVGVLDDGRRGSRWLFSLLHSWDWLPLLTRRPLW
FT                   DLWMLGFSLGGLVVCASGCWIGWRRLRGRRPKRR"
FT   gene            488730..489350
FT                   /locus_tag="PA0436"
FT   CDS_pept        488730..489350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0436"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03825"
FT                   /db_xref="GOA:Q9I681"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I681"
FT                   /protein_id="AAG03825.1"
FT                   /translation="MGTHKIEIRRRNVEKILLAAEKVFAEKGYAGTSMGNIAEEAELPR
FT                   SNLHYYFSTKDELYRDVLLGLLEVWKQDALCFEMFDDPRVVLTSYIRAKMNHSRTRPHG
FT                   SKVWANEIMHGAPLLGATLDDSLYEWAKMKEAKIRQWVEEKRILSIEPSSLLYMIWAST
FT                   QHYADFGYQVEVLNGHQPLSDMQFERAVQTVTSVVLRGIGLEP"
FT   gene            complement(489387..490658)
FT                   /gene="codA"
FT                   /locus_tag="PA0437"
FT   CDS_pept        complement(489387..490658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="PA0437"
FT                   /product="cytosine deaminase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03826"
FT                   /db_xref="GOA:Q9I680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I680"
FT                   /protein_id="AAG03826.1"
FT                   /translation="MLIDNLRLRGREGLWQLRVADGRIAALVPMEQAADDAGERLDGAG
FT                   GLAVPPFIEPHIHLDTTQTAGQPEWNRSGTLFEGIERWAQRKALLSHEDVKQRAWQTLK
FT                   WQIANGVQHVRSHVDVSDPTLTALKAMLEVRGEVAPWVDLQIVAFPQEGILSYPNGLEL
FT                   LEESLRLGADVVGAIPHFEFTRELGVESLHKAIDLAKRYDLPVDVHCDEIDDEQSRFLE
FT                   TLAMLAHRDGLGARVTASHTTAMHSYNGAYTSRLFRLLKLSGINFVANPLVNIHLQGRF
FT                   DDYPKRRGITRVKELLGAGINTCFGHDDVFDPWYPLGTANMLQVLHMGLHVTQMMGYDE
FT                   IDGGLDLITRNSARTLGLREYGIEVGHPANLLVLPARDGFDAVRRQVPVRYSIRGGRLL
FT                   AETVPAQTTVFLEQAEAVDFTRAS"
FT   gene            complement(490648..491898)
FT                   /gene="codB"
FT                   /locus_tag="PA0438"
FT   CDS_pept        complement(490648..491898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="PA0438"
FT                   /product="cytosine permease"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03827"
FT                   /db_xref="GOA:Q9I679"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I679"
FT                   /protein_id="AAG03827.1"
FT                   /translation="MSADSNYSQQPVPLAARKSALALSVVMLGLTFFSASMWTGGTLGT
FT                   GLSYDDFFLAVLLGNLMLGLYTAILGFIGARTGLSTHLLAHYSFGSKGSWLPSALLGGT
FT                   QVGWFGVGVAMFAIPVAKATGLDVNLLILVSGALMTLTVFFGIAGLTLLSAIAVPAIVV
FT                   LGSYSVWLAVRDAGGLAALQQVTPSAPLSLSTAIALVVGSFVSAGTLTADFVRFGRSAR
FT                   TAVVVCLVAFFLGNSLMFIFGAAGAAAVGKSDISDVMIAQGLLIPAILVLGLNIWTTND
FT                   NALYASGLGFANITGLSSRFLAMLNGALGTLAALWLYNHFVGWLTFLSAAIPPIGGVII
FT                   ADYLSRRRRYRQHPCADIQAINWAAILAVACGTAAGHWLPGIVPVNAVLGAAIAYLLLN
FT                   PLLSRSPNKPEEVLHAD"
FT   gene            complement(492080..493357)
FT                   /locus_tag="PA0439"
FT   CDS_pept        complement(492080..493357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0439"
FT                   /product="probable oxidoreductase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03828"
FT                   /db_xref="GOA:Q9I678"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I678"
FT                   /protein_id="AAG03828.1"
FT                   /translation="MMADLSIEFAGIKSPNPFWLASAPPTDKAYNVVRAYQAGWGGVVW
FT                   KTLGEDPAAVNVSSRYSAHFGPNRQVQGINNIELITDRSLEINLREIAQVKKDWPDRAL
FT                   IVSLMVPCVEESWKYILPLVEATGADGIELNFGCPHGMPERGMGAAVGQVPEYVEMVTR
FT                   WCKAHCSLPVIVKLTPNITDIRQSARAAHRGGADAVSLINTINSITSVDLERMVALPVV
FT                   GTQSTHGGYCGSAVKPIALNMVAEIARDPQTRGLPICGIGGIGSWRDAAEFVALGCGAV
FT                   QVCTAAMLHGFRIVEDMQDGLARWMDSHGYQRLSDFSGGAVGNTTDWKYLDINYQVIAR
FT                   IDQDACIGCGRCHIACEDTSHQAIASLPRADGTHRYEVIDAECVGCNLCQITCPVENCI
FT                   EMVPQDTGKPYLNWTQDPRNPYREAS"
FT   gene            complement(493354..494721)
FT                   /locus_tag="PA0440"
FT   CDS_pept        complement(493354..494721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0440"
FT                   /product="probable oxidoreductase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03829"
FT                   /db_xref="GOA:Q9I677"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I677"
FT                   /protein_id="AAG03829.1"
FT                   /translation="MIDSLNHLPRPDAGADTLAERFADLAPPLNARQAALESARCLYCY
FT                   DAPCVNACPTEIDIPGFIRSIAQENVQGAAQKILSANILGGSCARVCPTEILCQRACVR
FT                   NNAQECAPVLIGQLQRYALDHAGFDEHPFKRSPATGKRIAVVGAGPAGLSCAHRLAMHG
FT                   HDVVLFEARTKAGGLNEYGIARYKLVDDFARREVEFLLQIGGIELRHGQRLGDNLALGA
FT                   LHDEYDAVFLGIGLAASKRLGLEDEDAPGLLAATDYIRELRQSDDLLDLPVADRCIVIG
FT                   AGNTAIDMAVQMSRLGARDVNLVYRRGFEEMGATGHEQEIAKASQVRLLTWARPERVLL
FT                   DEHGRVRGMRFARTRLENGRLGDTGEHFELAADAIFKAIGQAFEGASLGDPLAAQLRRD
FT                   GERIQVDGQMRTSIPGIYAGGDCVALGEDLTVQAVQHGKLAAEAIHAQLMLNVEAA"
FT   gene            complement(494816..496255)
FT                   /gene="dht"
FT                   /locus_tag="PA0441"
FT   CDS_pept        complement(494816..496255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dht"
FT                   /locus_tag="PA0441"
FT                   /product="dihydropyrimidinase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03830"
FT                   /db_xref="GOA:Q9I676"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PDB:5E5C"
FT                   /db_xref="PDB:5YKD"
FT                   /db_xref="PDB:6AJD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I676"
FT                   /protein_id="AAG03830.1"
FT                   /translation="MSLLIRGATVVTHEESYRADVLCANGLIQAIGENLETPSGCDVLD
FT                   GGGQYLMPGGIDPHTHMQLPFMGTVASEDFFSGTAAGLAGGTTSIIDFVIPNPRQSLLE
FT                   AFHTWRGWAQKSAADYGFHVAITWWSDEVAREMGELVAQHGVNSFKHFMAYKNAIMAAD
FT                   DTLVASFERCLELGAVPTVHAENGELVFHLQQKLLAQGLTGPEAHPLSRPPQVEGEAAS
FT                   RAIRIAETLGTPLYLVHISSREALDEIAYARAKGQPVYGEVLAGHLLLDDSVYRHPDWA
FT                   TAAGYVMSPPFRPVEHQEALWRGLQSGNLHTTATDHCCFCAEQKAMGRDDFSKIPNGTA
FT                   GIEDRMALLWDAGVNSGRLSMHEFVALTSTNTAKIFNLFPRKGAIRVGADADLVLWDPQ
FT                   GSRTLSAATHHQRVDFNIFEGRTVRGIPSHTISQGKLLWAAGDLRAEPGAGRYVERPAY
FT                   PSVYEVLGRRAERQRPVAVER"
FT   gene            complement(496362..496478)
FT                   /locus_tag="PA0442"
FT   CDS_pept        complement(496362..496478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0442"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03831"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I675"
FT                   /protein_id="AAG03831.1"
FT                   /translation="MVRTLTILVIFIFNYLKSISYKLKQPFENNLAQSMISI"
FT   gene            496871..498361
FT                   /locus_tag="PA0443"
FT   CDS_pept        496871..498361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0443"
FT                   /product="probable transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03832"
FT                   /db_xref="GOA:Q9I674"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I674"
FT                   /protein_id="AAG03832.1"
FT                   /translation="MQQSRSEVTERDGLVELSAGSDVLDSPRYNHDIAPTRVEQRTWNR
FT                   WHITALWIGMSICVPTYTLGGVLTAYFGLSVGEALLAILLANLVVLIPLTLNAFAGTRY
FT                   GIPFPVLLRASFGIIGSNVPCLIRAVVACGWFGIQTLFGGLAIHLFLGSIFPAWKALGG
FT                   TGEVIGFLLFWGLNLWVVLRGAESIKWLETLSAPLLVLVGLGLLVWALPHISVSELLAQ
FT                   PPKRPEGASVTGYFMAGLTAMVGFWATLSLNIPDFSRYARSQKDQILGQIFGLPLTMFL
FT                   FAALGVVMTAASASLVGETVSDPVSLIGHIPSPGWVAVAMALIIVATLSTNTAANIVSP
FT                   TNDFQNIAPKLIGRTRAVWLTGFIGLALMAHELLKKLGWIVSDLSLESVYSNWLLGYSS
FT                   LLGPIAGIMVVDYFLVRRQRLDLAGLYRDDVYPAWNWPGFAAFAVPVALTVMALGNRQF
FT                   HWFYDYGWFTGSLLGGALYYGLCGRRARSPAALAKPLP"
FT   gene            498420..499703
FT                   /locus_tag="PA0444"
FT   CDS_pept        498420..499703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0444"
FT                   /product="N-carbamoyl-beta-alanine amidohydrolase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03833"
FT                   /db_xref="GOA:Q9I673"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I673"
FT                   /protein_id="AAG03833.1"
FT                   /translation="MSTARNVLQSTQRHIDGQRLWQSLMDLARLGATAKGGVCRLALSD
FT                   LDRQARDLFVQWCEAAGCTVSVDRVGNIFARRPGRNPDLPPVMTGSHIDTQPTGGKFDG
FT                   CFGVMAGLEVIRTLNDLGVETEAPLEVVVWTNEEGSRFAPCMMGSGVFAGKFTLEETLA
FT                   KRDADGVSVGEALDAIGYAGARDCLGHPVGAYFEAHIEQGPILEDEEKTIGVVLGALGQ
FT                   KWFDLSLRGVEAHAGPTPMHLRKDALVGAAAVVEAVNRAALGHQPHACGTVGCLHAYPG
FT                   SRNVIPGEVKMTLDFRHLQPERLDSMIAEVRQVIAATCEKHGLQYELVPTADFPPLYFD
FT                   QGCVGAVREAAQALGMPQMDIVSGAGHDAIFLAELGPAGMIFVPCENGISHNEIENASP
FT                   DDLAAGCAVLLRAMLKASEAIAGGRLAA"
FT   gene            complement(500104..501120)
FT                   /locus_tag="PA0445"
FT   CDS_pept        complement(500104..501120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0445"
FT                   /product="probable transposase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03834"
FT                   /db_xref="GOA:Q9HI37"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HI37"
FT                   /protein_id="AAG03834.1"
FT                   /translation="MNLSRIGLDLAKQVFQVHGVDRHEHVVCRRQLKRAQVRDFFRQLP
FT                   PCLVAMEACGSAHYWARELRELGHTVRLIAPQFVKPYVKGDKHDAHDAEAICEAASRPS
FT                   MRYVPVKSAEQQAVQSMHRVRSRLVRARTALCNEVRGLLGEFGLIATRRGRAATMALLE
FT                   TVMATEPAPLPAPMGELLRELKDELQTLEARIARLERQIQAHVRGDARIQRLLAVEGIG
FT                   PISASAVAASAGDARQFRTGRQFAAWLGLVPRQHSTGGQQRLGNISKRGDTYLRTLLIH
FT                   GARAVVRCCANKTDARSRWLQGLLQRRPANVVAVALANKNARILWALLSRETCYRPG"
FT   gene            complement(501376..502599)
FT                   /locus_tag="PA0446"
FT   CDS_pept        complement(501376..502599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03835"
FT                   /db_xref="GOA:Q9I672"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I672"
FT                   /protein_id="AAG03835.1"
FT                   /translation="MPGALSHIRVLDLSRVLAGPWAGQILADLGAEVIKIERPGSGDDT
FT                   RAWGPPFLKDAEGNDTSEAAYYLSANRNKKSVTVDFTQPEGQRIVRELAAKADILLENF
FT                   KVGGLKAYGLDYESLKQVNPKLIYCSITGFGQSGPYAKRAGYDFMIQGLGGLMSLTGRA
FT                   DNEEGAGPVKVGVALTDILTGLYSSTAVLAALAHRDVSGIGQHIDMALLDVQVACLANQ
FT                   TLNYLTTGVPPRRLGNAHPNIVPYQDFPTADGDMILTVGNDSQFRKFAELADHPEWADD
FT                   PRFATNKARVANREVLIPLIRQATVLHTTAEWILSLERAGVPCGPINDLAQVFADPQVQ
FT                   ARGLRVELPHPLAGTVPQVASPIRLSETPVEYRNPPPTLGQHTDEVLETLLGLDAAALE
FT                   RLRDGKVI"
FT   gene            complement(502719..503900)
FT                   /gene="gcdH"
FT                   /locus_tag="PA0447"
FT   CDS_pept        complement(502719..503900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="PA0447"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03836"
FT                   /db_xref="GOA:Q9I671"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I671"
FT                   /protein_id="AAG03836.1"
FT                   /translation="MATKASFNWEDPLLLDQQLTEEERMVRDSAQQFAQDKLAPRVLEA
FT                   FRHEQTDPKIFREMGETGLLGATIPEAYGGSGLNYVCYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPIHEFGNEATRQKYLPKLASGEYIGCFGLTEPNHGSDPGSMVTRAKKVDGGYR
FT                   LSGSKMWITNSPIADVFVVWAKDDEGQIRGFVLEKGWEGLSAPAIHGKVGLRASITGEI
FT                   VMDNVFVPEENAFPEVRGLRGPFTCLNSARYGISWGALGAAEFCWHTARQYVLDRQQFG
FT                   RPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIA
FT                   RLARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFF"
FT   gene            504121..505029
FT                   /locus_tag="PA0448"
FT   CDS_pept        504121..505029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0448"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03837"
FT                   /db_xref="GOA:Q9I670"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I670"
FT                   /protein_id="AAG03837.1"
FT                   /translation="MRRKIPSTAALVSFESAARHESFTKAAEELSLTQSAICRQIATLE
FT                   EFLGVELFRRSRRGVKLTEAGLSYSRRVAVRLDAVERDTLAVMGHQGGGAIELAVVPTF
FT                   GTQWLLPRLKRFQRLHPEVTINLTNRTRPFLFADTEFDAALYFGDADWSGTVSHFLMRE
FT                   NPVPVCSPELLGGRRTLSAEQVAGLPLMQQSTRPYAWRQWFHSQGLNVAHDMSGPRYEL
FT                   FSMLAQAAMHGMGVALIPPFLIQDELADGRLIVPMQHAYLSENAYYLIIPERRVESAML
FT                   NAFRDWLVEEARQYREANGLG"
FT   gene            505047..505586
FT                   /locus_tag="PA0449"
FT   CDS_pept        505047..505586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0449"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03838"
FT                   /db_xref="GOA:Q9I669"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I669"
FT                   /protein_id="AAG03838.1"
FT                   /translation="MAQAGRAAPGTGPIRRVPRSRGGDTAGHPPRRPGWRPWGTTPGVH
FT                   MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIIQLGNQRVVTKYISEINFVSS
FT                   ARQGDIIELGITATDFGRTSLTMTCHVRNKITRKSILTIDKMVFVNLGPDGLPAPHGKT
FT                   EITYIKDQFKEDEVLP"
FT   gene            complement(505629..507251)
FT                   /locus_tag="PA0450"
FT   CDS_pept        complement(505629..507251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0450"
FT                   /product="probable phosphate transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03839"
FT                   /db_xref="GOA:Q9I668"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I668"
FT                   /protein_id="AAG03839.1"
FT                   /translation="MTSDVLPADAVASAAGNARKPHLEQRPGRLTALVFFAVLATGLLF
FT                   SAYSLMQDVDDVGSTITTWTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYSHSLPP
FT                   HFAVVWSGCFNFLGVLLSSGAVAFGIIALLPVELILQVGSSAGFAMVFALLIAAILWNL
FT                   GTWWLGLPASSSHTLIGSIIGVGVANALMHGRDGTSGVDWGQATKVGYSLLLSPLIGFA
FT                   CAALLLLALRLLVKNRALYKAPKGKAPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLI
FT                   MLILVGTLPMAYALNRTMPADQAVQFAAVADVTQQALVKSAPQPAPADPRQVLSDYVRS
FT                   KQASPELIPALAALTGSIGQEVKGYGAFSRVPAEAMGNVRNDMYLTSEAIRLMDKDGVG
FT                   RFDADTRGKLQAFKQKIDDATKFIPLWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTH
FT                   LTYAQGASAETVAMLTIGAADLYGLPVSTTHVLSSGVAGTMAANGSGLQWKTIRNLLMA
FT                   WVLTLPAAILLSASLYWLLTRLF"
FT   gene            507631..508962
FT                   /locus_tag="PA0451"
FT   CDS_pept        507631..508962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03840"
FT                   /db_xref="GOA:Q9I667"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I667"
FT                   /protein_id="AAG03840.1"
FT                   /translation="MRMPCRLALALLLCFAGPACLAASGPVRVLSVDGAIGPASADYLV
FT                   RGIERAAEDGAQLVVLELDTPGGLDASMRRIVKAILASQVPVAGFVAPSGARAASAGTY
FT                   ILYACHIAAMAPGTNLGAATPVRLGTPDKPAEKPPARDADPMARKQVNDAAAYIRGLAQ
FT                   LRGRNAEWAERAVREAVSLAAHEAAAQKVIDLQARDLPDLLRQLDSRSLRVGERALTLA
FT                   TAGATVERQAPDWRARLLAVLTDPSVALILMMIGIYGLIFELANPGMALPGVLGGICLL
FT                   LGLYALQMLPVNYAGLALIALGLAFMVGEAFVASFGVLGIGGIVSFVVGALILIDTEVP
FT                   GYGIPPGLVVALALLSAALIVGLLGMALRTRRQAVVSGTAGLVGSLATVAAVDSEQPCA
FT                   GWVLLQGERWRVLAARPLAVGQPVWVLARKGLLLEVALADEGGG"
FT   gene            508959..509753
FT                   /locus_tag="PA0452"
FT   CDS_pept        508959..509753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0452"
FT                   /product="probable stomatin-like protein"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03841"
FT                   /db_xref="GOA:Q9I666"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I666"
FT                   /protein_id="AAG03841.1"
FT                   /translation="MMGISYGLAMLLVFLALLLFSALRILREYERGVVFQLGRFWKVKG
FT                   PGLVLVIPAIQQMVRIDLRTIVLDVPPQDVISRDNVSVKVNAVVYFRVLDPQKAIIQVE
FT                   NYLAATSQLAQTTLRAVLGKHELDEMLAERERLNLDIQQVLDAQTDAWGIKVANVEIKH
FT                   VDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGRQSGAMQLRYMQT
FT                   LGAIAGDKSSTIVFPMPIELFGGKYAGAAPRNEKAAGEDEER"
FT   gene            complement(509825..510499)
FT                   /locus_tag="PA0453"
FT   CDS_pept        complement(509825..510499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0453"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03842"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I665"
FT                   /protein_id="AAG03842.1"
FT                   /translation="MPGIPQAHQQVQAVLAKRGGQYLQLVAQIGQFALEGDPQRQLVLH
FT                   RQVDPPRLEHPRGVGEAGHVDLLQTAVTVEFGRVGIVAHDRDAVGTQVAQAGKLDTPPL
FT                   ALQQANAVAQVGAGKLPVEAAGGLVPGAQGDVVVAAAHAVQGTRPGYLLETRVEAGALE
FT                   RGGHQFHRQAVARQARIDERRPGVADQAQVGGRQRAREEQCQQQECASQHEGASREWIA
FT                   TA"
FT   gene            complement(510589..512790)
FT                   /locus_tag="PA0454"
FT   CDS_pept        complement(510589..512790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03843"
FT                   /db_xref="GOA:Q9I664"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I664"
FT                   /protein_id="AAG03843.1"
FT                   /translation="MPPSSLTHTLRRLWALDKFAYSLRVFIALAGALLLCWWQDRIELL
FT                   IPLFLGIIASALAETDDNWLGRLQALLVTLLCFSVAAFAVELLFPYPWLFVSGMALSAF
FT                   GMILLGALGERYAAIASATLILSIYTMIGVDQRGGEVADVWHEPLLLVAGAAWYGLLSV
FT                   LWNALFSNQPVQQSLSRLYFELGEYLRIKSSLFEPLRQLDVEGQRLALARQNGKVVVAL
FT                   NQAKETILNRLGHGRPGPKVSRYLKLYFIAQDVHERASSSHYPYNRLAEAFFHSDVLFR
FT                   CQRLLNQQGKACQALARAIRLRQPFDYADRELALEDLQASLEHLRQQSNPAWKGLLRSL
FT                   GALAANLTTLDRKLAGASNPDAIADEQDSALLDRSPRSLKDAFERLRQQLTPTSLLFRH
FT                   GLRMALALTAGYGVLHWIHPTQGYWILLTTVFVCQPNYGATRLRLVQRILGTVVGLVGG
FT                   WALIDLFPSPLVQSLFAVAAGVAFFATRSSRYTLATAAITLLVLFCFNQVGDGYGLILP
FT                   RLFDTLLGSLIAGLAVFLVLPDWQGRRLNRMLANTLACNSRYLRQIMQQYATGKRDDLD
FT                   YRTARRNAHNADAALSTTLSNMLLEPGHFRKDAEIGFRFLVLSHTLLSYLSGLGAHRES
FT                   LPEDASDGLLERAAERLSASLEEIAASLEQKRPVAIYSEEEEALAKELEQMPEDMDDSH
FT                   RLVQTQLAHICRQLAPLRTLAAHLLKKELAGAQPLPGQP"
FT   gene            complement(513051..514427)
FT                   /gene="dbpA"
FT                   /locus_tag="PA0455"
FT   CDS_pept        complement(513051..514427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="PA0455"
FT                   /product="RNA helicase DbpA"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03844"
FT                   /db_xref="GOA:Q9I663"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I663"
FT                   /protein_id="AAG03844.1"
FT                   /translation="MTSTAFSSLPLSADLLANLDSLGYREMTPIQAQSLPLILQGHDLI
FT                   AQAKTGSGKTAAFGLALLSPLNPRYFGCQALVLCPTRELADQVAKEIRRLARAADNIKV
FT                   LTLCGGVPYGPQVASLEHGAHVVVGTPGRIQEHLRKGTLVLDGLNTLVLDEADRMLDMG
FT                   FYDSIAEIIGQLPERRQTLLFSATYPDGIEKLAKTFMRDPRQVRVESLHADSQIEQRFF
FT                   EIDPKQRMDAVVRLLQHFRPQSCVAFCQTRQQCQELADALKAQRISALALHGDLEQRER
FT                   DQVLTVFANRSCNVLVATDVAARGLDIAALETVINVELARDPEVHIHRIGRSGRAGEKG
FT                   LALSLVAPAEASRAQAIEDLQKQPLAWYALGQLKASPEPLLPPMSTLCIAGGRKDKVRP
FT                   GDLLGALTGDAGLPGSAVGKIAIFDFQAFVAIERGLAHQALKRLSEGKIKGRSFKVRLL
FT                   "
FT   gene            514775..514984
FT                   /locus_tag="PA0456"
FT   CDS_pept        514775..514984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0456"
FT                   /product="probable cold-shock protein"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03845"
FT                   /db_xref="GOA:Q9I662"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I662"
FT                   /protein_id="AAG03845.1"
FT                   /translation="MSRQNGTVKWFNETKGYGFITPESGPDVFVHFRAIEGNGFKTLAE
FT                   GQKVSFEVVQGQKGMQAERVQVIN"
FT   gene            515135..515659
FT                   /locus_tag="PA0457"
FT   CDS_pept        515135..515659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0457"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03846"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I661"
FT                   /protein_id="AAG03846.1"
FT                   /translation="MKPVQSRRLAFAALLSLSFSSASCHAATEHWGWIEQSWLMPERMQ
FT                   AKAKLDTGALTSSLDARNIHRYKKDGERWVRFDVVLPTADSKAPVSVTFERKVLRLIKV
FT                   RGAGGSDSRPVVAMDICLGAKLLREQFSLRDRGNMNYPVLLGRRTLEHLGAVDVSRTFT
FT                   RKPTCSALAAQ"
FT   gene            complement(515653..516027)
FT                   /locus_tag="PA0457.1"
FT   CDS_pept        complement(515653..516027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0457.1"
FT                   /product="hypothetical membrane protein"
FT                   /note="Product name confidence: Class 4:Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences."
FT                   /db_xref="EnsemblGenomes-Gn:PA0457.1"
FT                   /db_xref="EnsemblGenomes-Tr:ACI25436"
FT                   /db_xref="GOA:B5WWL1"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:B5WWL1"
FT                   /protein_id="ACI25436.1"
FT                   /translation="MAWIATLKRWARELKTEVIALWLCSRHPHMPWLARLVALLVVAYA
FT                   LSPIDLIPDFIPLLGYLDDLLLVPLGIWLAIRLTPPTLLAECRARAREVETHPRNLWMA
FT                   ALIVLFWVALGAGLLRWFFY"
FT   gene            complement(516029..517462)
FT                   /locus_tag="PA0458"
FT   CDS_pept        complement(516029..517462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0458"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03847"
FT                   /db_xref="GOA:Q9I660"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I660"
FT                   /protein_id="AAG03847.1"
FT                   /translation="MSEPFQLTPRIARQLPWLVAVAFFMQALDGTILNTALPSMASSLN
FT                   ENPLRMQAVVIAYLLTVALLIPASGWIADRFGTRRVFLGAVLLFSLGSLLCALSPSLEL
FT                   LVGARIVQGVGGALMMPVGRLVILRVYPRQDLVRVLSFVTIPGLLGPLAGPTLGGWLVE
FT                   YASWHWIFLINLPVGLLGCLVAMKLMPDLRSPVPSRFDSIGFLLFGGSMVLISIALEGL
FT                   GELHLSHLRVVLLLIGGLVLLTAYWLRALRIDKPLFPPSLFKARTFAVGILGNLFARLG
FT                   SGALPFLTPLLLQVGLGYPPSTAGMTMIPLALFAMVAKPMAKPLLDFFGYRKLLVGNTL
FT                   ILGCLIAGFGLVDQDTPYVWLLLHLSLLGAVNSLQFTAMNTLTLIDLQDSNASSGNSLM
FT                   SVVVQLSISLGVACAAALLGGFQTDLDTGQDTVLGAFHATYVSVGLMSMLAAAIFFQLG
FT                   SEDGRTSPRRVDPEKDPDL"
FT   gene            518083..520635
FT                   /locus_tag="PA0459"
FT   CDS_pept        518083..520635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0459"
FT                   /product="probable ClpA/B protease ATP binding subunit"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03848"
FT                   /db_xref="GOA:Q9I659"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I659"
FT                   /protein_id="AAG03848.1"
FT                   /translation="MDIAEYFSKQTTEYLQRAAQVAAEFGKREVDTEHLLYALADADVV
FT                   QAVLKQFGLSPADLKQYIEANAVRGASKGEASEDMTISPRVKSALQHAFALSRELGHSY
FT                   VGPEHLLLGLAAVPDSFAGTLLKKYGLTEQALRQKAVKVVGKGAEDGRVDGPSNTPQLD
FT                   KFSRDLTRLAREGKLDPVIGRSKEVETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQ
FT                   RMVQGEVPEVLRDKRLVELNINAMVAGAKYRGEFEERLKQVMDELQAAQSEIILFIDEV
FT                   HTIVGAGQGGGEGGLDVANVLKPAMARGEMNLIGATTLNEYQKYIEKDAALERRFQPVF
FT                   VPEPTVEQTISILRGLRDKLEGHHKVTIRDEAFVAAAELSDRYIGNRFLPDKAIDLIDQ
FT                   AAARVRIASTSRPAEIQELEAELAQLKREQDYAASRKWYDEAKVFEKRIQERKEHLEQI
FT                   TERWQQTQGSKTEEVRVEDIAEIISKLTGIPVTELTAEEREKLLQMEERLHQRVIGQQE
FT                   AITAVSDAVRLARAGLRQGSRPIATFLFLGPTGVGKTELAKALAEVVFGDEDAMIRIDM
FT                   SEYMERHAVSRLIGAPPGYVGYDEGGQLTERVRRRPYSVILLDEIEKAHADVNNILLQV
FT                   FDDGRLTDGKGRVVDFTNTIIIATSNLGSELIMKNAQAGEFAQPPEKLKRELMTTLRGH
FT                   FRPEFLNRLDEVIVFESLSKAQIEDIVRLQLERVKRAAHAQDIYLHIDDSLVGHLAEEA
FT                   YQPEFGARELKRQIRQQLETRLATAMLKGEVKEGETVTFFYDAKDGVGYRKGAAPNPAA
FT                   RKKSGAGETPRGRATAARKPAAKKGAAAKGKADKPKAK"
FT   gene            520737..521315
FT                   /locus_tag="PA0460"
FT   CDS_pept        520737..521315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0460"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03849"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I658"
FT                   /protein_id="AAG03849.1"
FT                   /translation="MRVTTHATLAAALLLSAASAFAFNLGDAAKAVAGASQGDSAQVAT
FT                   TPQTSGLLGALTGQLGVSQEQAVGGTGALLGLAKNQLAGNDYSQLVKTIPGLDKLAGNN
FT                   ALAGLGGLGNVLGKSGGDSKGLGSLLGNADSMGDVNKAFGTLGMDSGMTEKFAQVLVDY
FT                   FGKQGANSELLGSLSNLWGVSKAGGSSLL"
FT   gene            complement(521630..522517)
FT                   /locus_tag="PA0461"
FT   CDS_pept        complement(521630..522517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03850"
FT                   /db_xref="GOA:Q9I657"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I657"
FT                   /protein_id="AAG03850.1"
FT                   /translation="MRELLTGLTSSLLLLLNTLILIGPMMLIALLKLVLPGQRLKDLCS
FT                   RGVMWIAETWAEIDKWIFATCTPTVWDVRGASDLRQDTSYLVVSNHQSWVDIPALIQVF
FT                   NRRTPYFKFFLKKELIWVPFLGLAWWALEYPFMKRYSKAFLEKHPELKGKDLEITKAAC
FT                   EKFKRIPVTVVNYLEGTRFSEQKKARQQSPYRHLLKPKAGGVAFVLAALGEQLDALLDV
FT                   TVVYPSDKVPGFWDLLCGRVPKVIVDIQTRPIDPALWQGDYENDPVFRQYVQEWVSRMW
FT                   EEKDERIARLRQLR"
FT   gene            522465..523169
FT                   /locus_tag="PA0462"
FT   CDS_pept        522465..523169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0462"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03851"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I656"
FT                   /protein_id="AAG03851.1"
FT                   /translation="MLRSSRRLLVRPVNSSRMVGFPVLGVGRRGPSYASAPRRPSRRRG
FT                   ERNRAVLVLCGPRITSGDARVKRALALLSLFALPVLAAEPNLYGRYEWVSLPELDRTLQ
FT                   AKMDTGAYTSSLSAKDIELFQRDGEEWVRFRLATKEADGSVFEHKLARIGKIKNRADNR
FT                   SGEDEDEDRLSERPVIDLQVCLGGAMKTIEVNLTDRSAFNYPFLMGTKGLRKFHVAVDP
FT                   SERFVADKPTCK"
FT   gene            523254..523943
FT                   /gene="creB"
FT                   /locus_tag="PA0463"
FT   CDS_pept        523254..523943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creB"
FT                   /locus_tag="PA0463"
FT                   /product="two-component response regulator CreB"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03852"
FT                   /db_xref="GOA:Q9I655"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I655"
FT                   /protein_id="AAG03852.1"
FT                   /translation="MPHILIVEDEAAIADTLLYALQAEGFATTWVTLAGEALALQERQP
FT                   ADLLILDVGLPDISGFEACKRLRRFSEVPVIFLTARDAEIDRVVGLEIGADDYVVKPFS
FT                   PREVAARVKAILKRMAPRPAALEEAAPSGPFQVDEERVRIHYRDTPLNLTRHEFRLLQT
FT                   LLGQPERVFSREQLLDALGVASEAGYERNIDSHIKSLRAKLRQVNERGEAIQTHRGLGY
FT                   SYSPDHA"
FT   gene            523943..525367
FT                   /gene="creC"
FT                   /locus_tag="PA0464"
FT   CDS_pept        523943..525367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creC"
FT                   /locus_tag="PA0464"
FT                   /product="two-component sensor CreC"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03853"
FT                   /db_xref="GOA:Q9I654"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I654"
FT                   /protein_id="AAG03853.1"
FT                   /translation="MPLGVRIFLVYFLFVGLTGYFVLSTVMDEVRPGVRQSTEETLVDT
FT                   ANLLAEILRQDVKNGTLAQSDLPEMLEDYGKRVPQADIWGLRKEAVNHRIYVTDASGKV
FT                   LLDSAGVAVGQDYSRWNDVYLTLRGQYGARSSREDPDDPDSSVMYVAAPIKDGGKIIGV
FT                   VSVAKPNSSLQPYIDRSQRRLAWLGAGLIALGLLVGGLLSWWLSGALRRLTQYAQAVSE
FT                   GRRAELPRYRGGEMAQLADAVERMRTQLEGKDYVERYVHTLTHELKSPLAAIRGAAELL
FT                   DGEMPAEQRARFVGNIAGESERLQQLIERLLSLAQVEQRQGLEEVGKVDLREIAASLLE
FT                   GQAARIQRQRLRVENRLEGPCEVRGEQFLLRQALANLLDNALDFTPPGGILRLLAEADG
FT                   EGIALRLFNQGPAIPDYALARLTERFYSLPRPASGRKSTGLGLNFVAEVAQLHGGRLQV
FT                   GNRDDGVEALLWLPRG"
FT   gene            525469..526827
FT                   /gene="creD"
FT                   /locus_tag="PA0465"
FT   CDS_pept        525469..526827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creD"
FT                   /locus_tag="PA0465"
FT                   /product="inner membrane protein CreD"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03854"
FT                   /db_xref="GOA:Q9I653"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I653"
FT                   /protein_id="AAG03854.1"
FT                   /translation="MNRTLAYKLGAIALLILLLLIPLLMIDGLIRDRQEVRDGVLQDIA
FT                   RSSSYSQRLTGPLLVVPYRRTVREWVTEEKTEKRVLQEREQRGELYFLPDRFALDGQMR
FT                   TELRYRGIYQARLYHVDNKVAGYFQVPAHYGIEEDLEDYQFETPFLAMGISDIRGIENA
FT                   LRLSLNGASVDFEPGSRVGLLGSGVHAPLQGVDGRQAQRLEYAFDLSLLGSERLDIVPV
FT                   GRDSQVILKADWPHPSFGGEFLPSEREITAQGFTARWQTSFFATNMEEALRSCVEEQRC
FT                   DGFQARAFGVGLVDPVDQYLKADRAIKYALLFITLTFAGFFLFEVLKRLAVHPVQYALV
FT                   GLALAFFYLLLLSLAEHVGFELAYLVSAGACVGLIGFYLCFVLRSVARGLGFSVGLAGL
FT                   YGLLYGLLSAEDYALLMGSLLLFAVLAAVMVLTRRLDWYGVGRKDFPAVPARA"
FT   gene            526877..527179
FT                   /locus_tag="PA0466"
FT   CDS_pept        526877..527179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0466"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03855"
FT                   /db_xref="GOA:Q9I652"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I652"
FT                   /protein_id="AAG03855.1"
FT                   /translation="MRLFFEFTLCAALGLLVSGVILIFLLFFGKFGLIEYWIASGKPLA
FT                   HAMLVLMPDGFWEGLSGIEGAAGNPHVRSFLELCMGLGQSALLLGLLLFRLVCWK"
FT   gene            complement(527324..527944)
FT                   /locus_tag="PA0467"
FT   CDS_pept        complement(527324..527944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03856"
FT                   /db_xref="GOA:Q9I651"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I651"
FT                   /protein_id="AAG03856.1"
FT                   /translation="MSATHTLFYAAASPFVRKVLVLLHETGQRERVALEEVTPTPVAPI
FT                   RQLNASNPAGKIPALRLPDGQVLHDSRVICDYFDQQHVGEPLIPREGSARWRRLTIASL
FT                   ADAVLDAAVLSRYETFVRPEEKRWDTWLEAQREKIGRSLAWLEGDCIAELQARFDIAAI
FT                   GVACALGYLDLRQPEWDWRGRYPRLAAWFAEVSQRPSMQATRA"
FT   gene            complement(527963..528913)
FT                   /locus_tag="PA0468"
FT   CDS_pept        complement(527963..528913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0468"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03857"
FT                   /db_xref="GOA:Q9I650"
FT                   /db_xref="InterPro:IPR011217"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I650"
FT                   /protein_id="AAG03857.1"
FT                   /translation="MRHLPYPLLGLFLALSSTGAALAGEQYYPLDKGSAPYAVAPSAQG
FT                   AVWYGADGGHSLGRLDPTSGESVQVPLGEGARPRAIVSDESGNAWVLDSGLNAILRIGG
FT                   ERLGSERFPLPAKAAPAGLESAVFDDDGRLWFTGSRGFHGRLDPARRLVEVWPSPQGKA
FT                   ANGICVTPDGEVWYAQDDALVHVDPLDGSAERLPAPEGTKALRGIGADSIGRLWASDSG
FT                   GARLYRYDPSDASWQSWPLPDSQARPDSLRVDAMDRVWLHDAASGALLRFDSEQATFRV
FT                   LPSDRPAPGNALLGGRPGETWSAEPAADRLRVVRD"
FT   gene            528999..529856
FT                   /locus_tag="PA0469"
FT   CDS_pept        528999..529856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0469"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03858"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I649"
FT                   /protein_id="AAG03858.1"
FT                   /translation="MATVEILGAECRAGGAVNDDALGCTAQAAWVIDGATSIGRSVLGV
FT                   ESDARWLAQAVDRHLRLLLEVEPEQSSETLLRRLLNDIQGDFRAQSGRDWHDLEDMPAA
FT                   CLSLLRIRGGEIELLNIGDSRILVEGADGQVRSFGDSALHELDRQSLAHFCRMREEHPQ
FT                   WDHAELFKASRPRVRQNRLLMNKPEGYWALDISDRWLGQVQRETLPLAALRSFVLMTDG
FT                   FDRLVEPFRRYTDEQLLRRLEDVGVSAMLDELREIEQGDDQALAFPRFKIHDDASALWG
FT                   RIAG"
FT   gene            complement(530029..532437)
FT                   /gene="fiuA"
FT                   /locus_tag="PA0470"
FT   CDS_pept        complement(530029..532437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fiuA"
FT                   /locus_tag="PA0470"
FT                   /product="Ferrichrome receptor FiuA"
FT                   /note="Class 1: Function experimentally demonstrated in P.
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PA0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03859"
FT                   /db_xref="GOA:Q9I648"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I648"
FT                   /protein_id="AAG03859.1"
FT                   /translation="MPRPTFRPGLLALAIALAVPAPFLHAAPAEQASVRDYRIAAGPLA
FT                   GTLNRIAAQAGLVLTLDPALAEGRSAHAVQGRFDAPGALREALKGSGLELVENAGGTYS
FT                   LRKVPEDTLSLQAMTVSGAEEDPLGPTSGYVAKRSMTGTKTDTPILETPRSISVATRQQ
FT                   MTDRAVHNLDDAVRYMPGVVASSFGSDSRSDWLKVRGFKPTQFLDGLPMAVGVYNNPKL
FT                   ETWNLERVALLRGPASSVYGQTPPGGMLDMVSLRPQNVASHEVKAEVGNYNHKQVSFDS
FT                   TGPLDDEGRFLYRVSGVVRDSNTQVDHIDDKRYNIAPSLTWNIDDDTRLTFLGQFNRDD
FT                   TGITSQFLPLRGTKYDAPFGKVSHHKNLGDPDWEYYDRTYYWLGYAFERRINDVWQFRQ
FT                   NLRYLRNDLSFQALTPASYYAAASDDGTLQRTSTSVDEDVSQFVVDNNFQADFDTGALR
FT                   HTLLLGLDHNRTTNEYTSIFGFNVPPTNINNPIYGQPIPKPPRSDAYYDYKQKTYQTGL
FT                   YVQDQIALDNWRLTLGGREDWVHTGATFYNKGDATNTSRDKKFSGNAALSYIFDNGVAP
FT                   YISYAESFQPTTGADMNSTSSLKPTEGKQWEIGVKYQPVGSDSLFTAAVYDLRQENVSV
FT                   SQNIGGTPVTSQTGEVKVSGIELEATSNVTDNLKMIGAYSYADTEVKKGQYAGNRLQQA
FT                   PRNQASLWADYTWHEGTLNGFSVGAGARYVGSTYGDQANTYDGYAGSYTLYDAAVRYDL
FT                   GQLNGSLKGVSVAVNANNLFNKDYLASCDGYYCYYGDQRSVVGSVSYKW"
FT   gene            complement(532541..533512)
FT                   /locus_tag="PA0471"
FT   CDS_pept        complement(532541..533512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0471"
FT                   /product="probable transmembrane sensor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03860"
FT                   /db_xref="GOA:Q9I647"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I647"
FT                   /protein_id="AAG03860.1"
FT                   /translation="MSADDRHSPVRARVLDEAIAWQLLLDSGEAHPDDHRAFHRWYAAH
FT                   PEHERAWEQLGGLDRHLARAANGPARNALLSGNARFKRRLRRLGGSALGLVLALGVGLG
FT                   VANRYVPVRYLLADAYSATGEQRELTLPDATHVRLNSRSAIDVRFDGERRQVVLLAGEI
FT                   LVETAHGDPRPFVVSSADGDMRALGTRFLVRREEPGTRLTVLQSAVAARAETLSEERVI
FT                   KEGQQVLILPQGLQASEAAPALAGAWAQGMLVVENARLADLVAELGRYSPALLQVDPSI
FT                   ADLRVTGSFPLKDTRLALQALEPSLPVRSVRHNAWWFEVVPR"
FT   gene            complement(533509..534027)
FT                   /locus_tag="PA0472"
FT   CDS_pept        complement(533509..534027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0472"
FT                   /product="probable sigma-70 factor, ECF subfamily"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03861"
FT                   /db_xref="GOA:Q9I646"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I646"
FT                   /protein_id="AAG03861.1"
FT                   /translation="MSAGDVSNSEFVGSLYRDHRGWLLAWLNRNLGCRQRAEDLSQDTF
FT                   VRLLGRPELPGLREPRAFLAKVARGLMIDHFRRAALEQAYLAELALVPEAEQPSAEEQY
FT                   LILEDLREIDRLLGTLSLKARSAFLYSRLDGMPHAEIAERLGVSVPRVRQYLAQGLRQC
FT                   YIALYGEPR"
FT   gene            534196..534945
FT                   /locus_tag="PA0473"
FT   CDS_pept        534196..534945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0473"
FT                   /product="probable glutathione S-transferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03862"
FT                   /db_xref="GOA:Q9I645"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I645"
FT                   /protein_id="AAG03862.1"
FT                   /translation="MAEPLLIIGSYLSPYVRKVLVLLELKGIAYRIDPIVPFFGDEAFE
FT                   RLSPLRQIPVLVDGDFVLNDSSVICQYLEERYPQPSLYPVDIGQRAQARWLEEYADSRL
FT                   GQVIIWQLFHQLVINRGIWQREPDQAILQRTYDEDLPSICNYLEGRIPPSGWLCGELSI
FT                   ADVAVACLFRNAQLARYQVDGERWPRLARLLADAFALPAFQHLARFEKATAQTPVAEQR
FT                   QALREAGAPLSATSHARERPVRGPMSR"
FT   gene            535085..535489
FT                   /locus_tag="PA0474"
FT   CDS_pept        535085..535489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0474"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03863"
FT                   /db_xref="GOA:Q9I644"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I644"
FT                   /protein_id="AAG03863.1"
FT                   /translation="MMNVPEGFQPLFRSSPLLDLLGPFFCRQDAQRQLVVALRIDEKHC
FT                   NHGGTAHGGLLSTLADVGLGYAMAFSREPPQPMVTVGLRLDFCGVARVGDWLEVHTRVD
FT                   KLGQRMAFASARLHSGERLVASASGVFHLP"
FT   gene            535539..536108
FT                   /locus_tag="PA0475"
FT   CDS_pept        535539..536108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0475"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03864"
FT                   /db_xref="GOA:Q9I643"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I643"
FT                   /protein_id="AAG03864.1"
FT                   /translation="MPKKSNAAERIVHATASLLASRGYFGTGLSDIIARAEAPKGSLYH
FT                   YFPEGKPQIASAAIGFVADEVASFLDRAGTQAPHARNVLRQFTATLRGWLEHSRFEEAC
FT                   PVLSTSLSIDAELAPVHAECRRALRAWHASIERALRADGLAEKLAASRAWLILAALEGA
FT                   VAVARVERSFQALDAIEEELQALLPA"
FT   gene            complement(536142..537869)
FT                   /locus_tag="PA0476"
FT   CDS_pept        complement(536142..537869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0476"
FT                   /product="probable permease"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03865"
FT                   /db_xref="GOA:Q9I642"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I642"
FT                   /protein_id="AAG03865.1"
FT                   /translation="MSSTPKPPASPREFSPSLLDLGTLESLDSLPRAGQRSAEFSASLL
FT                   DLGTPASLDCLPRAGLRAAEFSAARLDLGTPASLDCLPRASHHAGPELPPLSPRLYSAD
FT                   LAPTKAEGRRWGRYSLFALWTNDVHNIANYSFAIGLFALGMSGAQILAALALGALMVYG
FT                   LMNLSGYMGQKTGLPYPVMCRIAFGIHGAQLPALIRAVIAIAWFGIQTYLASIVLRVLL
FT                   TAIWPGLAAYDQDAILGLSSLGWATFVAIWCVQLLIFAYGMEMVRRYESFAGPVILLTV
FT                   AALAAWMYLRAGASIAWSSGEPMSGSQMWLKIFGGAAFWVTLYGTMILNFCDFARGCPD
FT                   RRTISVGNFWGLPVNILLFGLFAVVLAGAQFRIDGQLIQSPTDIVAAIPDTLFLVLASL
FT                   ALLIVTVAVNIMANFVAPAYVLTNLAPNLLNFRRAGLISATIAVLILPWHLYNSPGVIL
FT                   YFLGGLGALLGPLYGIIMVDYYLVRKGRVNLPELYTESRAGAYHYARGVNPRAIAAFVP
FT                   AAIISTLLALLPAFAELSPFSWFFGAGLAGLIHYALAKRRTAYREVSGEAIAVDSVQH"
FT   gene            complement(538217..539143)
FT                   /locus_tag="PA0477"
FT   CDS_pept        complement(538217..539143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0477"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03866"
FT                   /db_xref="GOA:Q9I641"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:2ESN"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I641"
FT                   /protein_id="AAG03866.1"
FT                   /translation="MHPLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGR
FT                   LRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFA
FT                   ATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLP
FT                   EGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSG
FT                   LRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLY
FT                   SHVQHVGRDAHAWMIGQLKGLDISRTG"
FT   gene            539231..539707
FT                   /locus_tag="PA0478"
FT   CDS_pept        539231..539707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0478"
FT                   /product="probable N-acetyltransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03867"
FT                   /db_xref="GOA:Q9I640"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:2FE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I640"
FT                   /protein_id="AAG03867.1"
FT                   /translation="MTLEIRPAVPADAEQILAFIIELADYERARHEVVTDVEGIRRSLF
FT                   AEGSPTRALMCLSEGRPIGYAVYFYSYSTWLGRNGIYLEDLYVTPEYRGVGAGRRLLRE
FT                   LAREAVANDCGRLEWSVLDWNQPAIDFYRSIGALPQDEWVRYRLDGEALRKMAE"
FT   gene            complement(539785..540735)
FT                   /locus_tag="PA0479"
FT   CDS_pept        complement(539785..540735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0479"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03868"
FT                   /db_xref="GOA:Q9I639"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I639"
FT                   /protein_id="AAG03868.1"
FT                   /translation="MHDFTLHDLQCFDAVVDAGGFQAAAQRLHRSHPAVFAAVARLERQ
FT                   LGLALLERGGYRVGLTAAGRSFHQRAQALLYELEGLRGHAAHLAQGEESELRVVLGDLC
FT                   PPRPALALLAGFFGSQPQTRLQLLFETVSGPLERLLDGEADLILHRVDKSDPRLEWLDL
FT                   CRVGLVPVIAPGLLGDPPPRPVRPEQLRPFAQCVMRDSARHSPPTDYFMLAGARQCSVP
FT                   DQRTKKEVILQGLGWGHLPDFLIDEELADGRLLALAGPHLPGRSEEVVAARRRDRAQGP
FT                   VAERLWAFLRDNATALRESGMDTGGDDSAGARRPR"
FT   gene            540839..541636
FT                   /locus_tag="PA0480"
FT   CDS_pept        540839..541636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0480"
FT                   /product="probable hydrolase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03869"
FT                   /db_xref="GOA:Q9I638"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:3OM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I638"
FT                   /protein_id="AAG03869.1"
FT                   /translation="MGNLSFLATSDGASLAYRLDGAAEKPLLALSNSIGTTLHMWDAQL
FT                   PALTRHFRVLRYDARGHGASSVPPGPYTLARLGEDVLELLDALEVRRAHFLGLSLGGIV
FT                   GQWLALHAPQRIERLVLANTSAWLGPAAQWDERIAAVLQAEDMSETAAGFLGNWFPPAL
FT                   LERAEPVVERFRAMLMATNRHGLAGSFAAVRDTDLRAQLARIERPTLVIAGAYDTVTAA
FT                   SHGELIAASIAGARLVTLPAVHLSNVEFPQAFEGAVLSFLGAA"
FT   gene            541679..542122
FT                   /locus_tag="PA0481"
FT   CDS_pept        541679..542122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0481"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03870"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I637"
FT                   /protein_id="AAG03870.1"
FT                   /translation="MNEPGSFIWTWYGQDEHRWVLLSAEAFLALDFLALDGAMQRETIG
FT                   SCPGCSTWSEKVVPLHEWLEGCPGHQAGSFRDALRRVWALCNELPEEALGCFDFDIYAH
FT                   PGWQAVRREAREALRQNGWDSIRSHAEELRDDCWERVHGYPKK"
FT   gene            complement(542170..544347)
FT                   /gene="glcB"
FT                   /locus_tag="PA0482"
FT   CDS_pept        complement(542170..544347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="PA0482"
FT                   /product="malate synthase G"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03871"
FT                   /db_xref="GOA:Q9I636"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="PDB:5OAS"
FT                   /db_xref="PDB:5VFB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I636"
FT                   /protein_id="AAG03871.1"
FT                   /translation="MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFWTGAEAVIND
FT                   LAPKNKALLAKRDELQAKIDGWHQARAGQAHDAVAYKAFLEEIGYLLPEAEDFQAGTQN
FT                   VDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKV
FT                   RGDKVIAFARAFLDEAAPLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQ
FT                   GDAAKPQAVLLKHNGLHFEIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCEDSVAAVD
FT                   ADDKVVIYRNWLGLMKGDLAEEVSKGGSTFTRTMNPDRVYTRADGSELTLHGRSLLFVR
FT                   NVGHLMTNDAILDKDGNEVPEGIQDGLFTSLIAIHDLNGNTSRKNSRTGSVYIVKPKMH
FT                   GPEEAAFTNELFGRVEDVLGLPRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGF
FT                   LDRTGDEIHTSMEAGAVVRKGAMKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMP
FT                   DLMAAMLEQKIGHPLAGANTAWVPSPTAATLHALHYHKVDVFARQAELAKRTPASVDDI
FT                   LTIPLAPNTNWTAEEIKNEVDNNAQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATL
FT                   RISSQLLANWLRHGVISQEQVVESLKRMAVVVDRQNASDPSYRPMAPNFDDNVAFQAAL
FT                   ELVVEGTRQPNGYTEPVLHRRRREFKAKNGL"
FT   gene            544654..545097
FT                   /locus_tag="PA0483"
FT   CDS_pept        544654..545097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0483"
FT                   /product="probable acetyltransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03872"
FT                   /db_xref="GOA:Q9I635"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I635"
FT                   /protein_id="AAG03872.1"
FT                   /translation="MPVHAASLADLADLVPLFSAYLDFYEVPAPEEQVRAFLAERLRQG
FT                   DSTLFLARDAEARALGFVQLYPLFASLALRPSWLLSDLYVRPEARRRGVGEALMNQARG
FT                   FAESMGACGLQLETAKTNHAGQSLYERLGYVRDEQFYTYWLQL"
FT   gene            545129..545644
FT                   /locus_tag="PA0484"
FT   CDS_pept        545129..545644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03873"
FT                   /db_xref="GOA:Q9I634"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I634"
FT                   /protein_id="AAG03873.1"
FT                   /translation="MDHLVLTVIATDHPGLVERIAQCIASHGGNWLESRMSRMAGQFAG
FT                   ILRVAVPAEGYDELVEGLQGLSSHGIRVLLAESGIEPVCNWKPIHLDLVGNDRPGIVRD
FT                   ITRLLAEHGVNLESLSTEVRPAPMSSEPLFHADALLAVPLTLSLDTLRERLEDLADDLM
FT                   VELVLDAS"
FT   gene            complement(546334..547230)
FT                   /locus_tag="PA0485"
FT   CDS_pept        complement(546334..547230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03874"
FT                   /db_xref="GOA:Q9I633"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I633"
FT                   /protein_id="AAG03874.1"
FT                   /translation="MATANLRRGYVLGLTAYVIWGLFPLYFKLLERIPAVEIIVQRAVW
FT                   SALFGAVLLLFWKHPGWWRELRQNPQRFVVLAASGLLIASNWMTYVWAVNNGHMLEASL
FT                   GYYINPLINVMLGMLLLKERLRPLQWLAVALASLGVAQQVWQLGSLPWVSLVLALTFGF
FT                   YGLIRKKAPVAALPGLVVETWLLLPLALVWLLFFADGPTSETAFWSTPEALWVVAAGPV
FT                   TLVPLVCFNAAARHLPYATLGFLQYLAPTLVLLQAILLFGEHLDSSRLTAFAFIWLALA
FT                   VYSFDAWRSLRRLPQPG"
FT   gene            complement(547432..548406)
FT                   /locus_tag="PA0486"
FT   CDS_pept        complement(547432..548406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03875"
FT                   /db_xref="GOA:Q9I632"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I632"
FT                   /protein_id="AAG03875.1"
FT                   /translation="MSHPFDQLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIED
FT                   GEPLIAKFYRPDRWSDAAIREEHAFSAELAECEVPVVAPLSRDGESLFAFSGFRFALFP
FT                   RRGGRAPEPGNLDQLYRLGQLLGRLHAVGATRPFEHREALAVDNFGHASLATLLEGNFI
FT                   PRSLLPAYESVARDLLKRLDALFAEVPYQPIRLHGDCHPGNLLCRDDVYHMVDLDDCRM
FT                   GPALQDLWMMLAGERHERLAQIAELVDGYNEFHDFDPRQLPLLEGLRSLRLMHYSAWLA
FT                   RRWDDPAFPPSFPWFGSERYWGEQVLVLREQLAALDEEPLRLF"
FT   gene            complement(548468..549226)
FT                   /locus_tag="PA0487"
FT   CDS_pept        complement(548468..549226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0487"
FT                   /product="probable molybdenum transport regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03876"
FT                   /db_xref="GOA:Q9I631"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I631"
FT                   /protein_id="AAG03876.1"
FT                   /translation="MSALSTLAQHVTRRPQRIALLAQIAELGSITRAAKAVGISYKGAW
FT                   DAIDELNNLAERPLVERSVGGKGGGGARLTAEGERLLALYRRLEALQAQVLQAAEDAED
FT                   LNLIGRLMLRTSARNQLHGRVLSIHGEGFHDRIAIELPGQQRIEALITRASTEQLELGR
FT                   GRPVLALIKAGWLDVGLEPREDQPNQLHGTLEEILAAKAGPSEVRIALGSGLTLCALLS
FT                   GERLASLGLKKGQKVIASFDPAQVLLGTPL"
FT   gene            complement(549294..549614)
FT                   /locus_tag="PA0488"
FT   CDS_pept        complement(549294..549614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03877"
FT                   /db_xref="InterPro:IPR017028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I630"
FT                   /protein_id="AAG03877.1"
FT                   /translation="MRALLVAACLLLGGCSHFAEDDWLGEDKALHFASSAALAAAGMQM
FT                   AHDRGLRGARQARFGLSFSLAFGVGKEFYDSRSAGSGWSWKDLAWDLAGAAAGYGLYQA
FT                   AE"
FT   gene            complement(549656..550381)
FT                   /locus_tag="PA0489"
FT   CDS_pept        complement(549656..550381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0489"
FT                   /product="probable phosphoribosyl transferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03878"
FT                   /db_xref="GOA:Q9I629"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I629"
FT                   /protein_id="AAG03878.1"
FT                   /translation="MSFPLRPLTRWLLPPPACLLCAARSDQPPRPLCRACAADLPWSRQ
FT                   QCRRCALPLPLDGQVCGECLRRPPAYEQAIAPWRYAFPLDSLINRFKHQAAWPLGRLLG
FT                   ELLAEHLRQRYAEGLPRPARLLPVPLAPRRERRRGFNQAQQLAERLAGELDLRCDPHSL
FT                   RRVLDTPAQQGLDATVRRRNLRHAFALAPASDVRGLHLALVDDVLTTGATAERLSRLLR
FT                   RAGAARVDVYCLARTPKPG"
FT   gene            complement(550520..550813)
FT                   /locus_tag="PA0490"
FT   CDS_pept        complement(550520..550813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0490"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03879"
FT                   /db_xref="GOA:Q9I628"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I628"
FT                   /protein_id="AAG03879.1"
FT                   /translation="MGTEGFFDGLGEMLGRAIRFVVDLLSGLLGGIWDAMDDFLHGLAR
FT                   AIGMDASLFSFVFLVLGLLLLYSGIRAFMRRSIVGGVIWTVLGLIVMSWLIH"
FT   gene            complement(550867..551793)
FT                   /locus_tag="PA0491"
FT   CDS_pept        complement(550867..551793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0491"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03880"
FT                   /db_xref="GOA:Q9I627"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I627"
FT                   /protein_id="AAG03880.1"
FT                   /translation="MLPMALTLRQVRYFIATAEFGQISQAAIHLNISQSAVTSAIQELE
FT                   GMLGVALFTRTAQGMNLTDSGRHFLNHAYSIQRSVDDALNSPQPDTRVEGTLKVAASYT
FT                   VMGYFLPHHLQRLAQWYPELELQLFEDERASIERGLLDGRYDIAVLLTGNLTEPGIAAE
FT                   TLFNSERRLWLPSRHPLGEKADLGLADVAGEPYIMLTVDEAGQSALRYWQQSGHRPQVI
FT                   LHTSSVEAVRSMVANGSGVAILSDLVYRPWSLEGKRIETLSLVDPVPSMSVGLAWRRDT
FT                   EASAGMRAFREYFRQSFLAPQQSSSRR"
FT   gene            551911..552669
FT                   /locus_tag="PA0492"
FT   CDS_pept        551911..552669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03881"
FT                   /db_xref="GOA:Q9I626"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I626"
FT                   /protein_id="AAG03881.1"
FT                   /translation="MTEVDLNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGDP
FT                   SSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIAAPAIELVNDMLYQLGALREFARLQ
FT                   GLSLQHVKPHGALYMHLARDEVAARLFVETLQRLEPELLLYCMPGSATWRIGRELGQPL
FT                   VREFYADRDYDRSGSIVFTRRVAALDPQQVADKVLRACREGKVRTVEGEDLDIAFDSVC
FT                   IHSDTPGALELVASTRARLEGAGIRIKAPR"
FT   gene            552746..552994
FT                   /locus_tag="PA0493"
FT   CDS_pept        552746..552994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0493"
FT                   /product="probable biotin-requiring enzyme"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03882"
FT                   /db_xref="GOA:Q9I625"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I625"
FT                   /protein_id="AAG03882.1"
FT                   /translation="MAEHNVQSPLPGTFYRKASPDAPPYAEVGQAVEAGSVIGLIEVMK
FT                   QFSEVQAGQAGILQAFHVEDGEAIEPGQVLAVIASAT"
FT   gene            553005..554381
FT                   /locus_tag="PA0494"
FT   CDS_pept        553005..554381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0494"
FT                   /product="probable acyl-CoA carboxylase subunit"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03883"
FT                   /db_xref="GOA:Q9I624"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I624"
FT                   /protein_id="AAG03883.1"
FT                   /translation="MHKRLNKLLVANRGEIAVRIIRAAQALGIPTVAVCSEADRDSLAA
FT                   RLADEVRLIGPARADRSYLDIEAILMAARETGADSIHPGYGFLSENPAFAEAVQAAGLV
FT                   FVGPEAQTIRRMGDKAEARRTAMAAGVPVVPGSPGELGDLDAALACAEEVGYPLLVKAS
FT                   AGGGGRGIRIAHDADELRREFPIAQREAQAAFGSPAVYLERFIRQARHIEVQILGDGER
FT                   AVHLFERECSLQRRRQKVFEEAPSAALDGAQRQALCESAVRLAQSLGYRGAGTLEYLFD
FT                   AHSGEFFFIEMNTRIQVEHPVSEMVTGIDLVQAMLRIAAGEALPWRQEDIRLNGAALEM
FT                   RINAEDPARNFFPSPGTVERLEWPQGEGVRVDSHLYPGYRVPPYYDSLLAKLIVHGRDR
FT                   DEAFARARQALERTVLAGMATTLPLHRWLLADARVQAAQFDTATLETWLAERTAAAQEV
FT                   "
FT   gene            554383..555261
FT                   /locus_tag="PA0495"
FT   CDS_pept        554383..555261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0495"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03884"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I623"
FT                   /protein_id="AAG03884.1"
FT                   /translation="MHANIRYSFGGDEHLFAEVAEAMSLEAFFRGMAITRAIEALQLPG
FT                   VLDVCLANASFQVRFDPDRLAPQALLETVRGLEAEAVAARSIETRIVEVPVLYNDPWTH
FT                   ETLMRFRDRHQDPDSTDLEYAARINGYADVQAFIQAHSGTPWFVSMVGFVAGLPFMYQM
FT                   VERERQLQVPKYLRPRIDTPKLTLGHGGCFGCIYSVRGAGGYQMFGVTPAPIFDPRQGL
FT                   PYLEESMVFFRAGDIVQFRPIERTEYEHMAAEVESGTFDLRIRPVSFDLDAFLADPRGC
FT                   TQHLQEVLHVD"
FT   gene            555251..556228
FT                   /locus_tag="PA0496"
FT   CDS_pept        555251..556228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03885"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I622"
FT                   /protein_id="AAG03885.1"
FT                   /translation="MSIKVLKPGLATSVQDAGREGHYHLGIPPSGALDQYALRAANLLV
FT                   GNAPTAAVLECALLGPQLEFQRDALVAVCGARMTPRLEGAEMPLDTSFRVRAGQVLGFD
FT                   FIRAGARGYLAIDGGIAVPEVLGSRSTYGLGAIGGLQGRRLAEGDLLPLGPASPSAVEG
FT                   LALPRSLQVEVGGEVSLRVVPGLYVHRLTPDAVERFFAETWTVGSEADRTGYRFKGGTA
FT                   LRFEPREQPFGAGSDPSNIVDACYPIGSIQVPGGLEPIVLHRDAVSGGGYATLGTVISP
FT                   DLNRLAQMQPNQKGRFVAVSLEEGLEARRRYNWQVQRLQHFFLR"
FT   gene            complement(556275..557276)
FT                   /locus_tag="PA0497"
FT   CDS_pept        complement(556275..557276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0497"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03886"
FT                   /db_xref="GOA:Q9I621"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I621"
FT                   /protein_id="AAG03886.1"
FT                   /translation="MNAFIRYMLVAMLLVLSQKSFALMCWKSDNKQTEDYVYIDTSIAV
FT                   PSVLPKDTVLWRSPNYSISITCFQDRDWGPEQVYFYLSPTGQGALGSDLEVGINLNGED
FT                   LRCSTLDKCRKEIGMHFDGCWTGRGCEGRAKKMTVNFNFFLSKRAGPSTGKEGPITGVN
FT                   AYPIFQFDGESAINNIGGYNFRMTLHGLNNLRYVACASTISLSPKTVDFQSLQAYFASR
FT                   DQILKELPFSVTANKNCSSAYGLNAMFLPSGSTSLWGSDTLLDNNNKSVGIRLLKQEDR
FT                   SIIDIGKEFVLVPNSQNQLVVIRNFLAQVRWMTGTPTPGPFNATAAIEVYYK"
FT   gene            complement(557354..558361)
FT                   /locus_tag="PA0498"
FT   CDS_pept        complement(557354..558361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0498"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03887"
FT                   /db_xref="GOA:Q9I620"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I620"
FT                   /protein_id="AAG03887.1"
FT                   /translation="MNAITRTLLVGMLVALAQKGYALTCERADNKATIDYVNIDTSIAV
FT                   PSALPKDTVLWRSPTYDFSVRCYQERENTGPEDVYFYLSPDGQGALGSDLEVGINLNGE
FT                   DLRCSSLPGCRQKIGMHFDGCWTGGRGGCEGMAQTKQVRFQIFLSKLAAPTPGKEGPIT
FT                   GVNSYALFQFDGVGGINNLGGRNLRMYALGMNNLRYVACTSTLSISPKTLNFQILQSQF
FT                   AAQNLVIKELPFSITANKSCNSAYGLNAMFIPASNTTLSSTDTLLAKDNPTVGIRLLNE
FT                   DRSVISIGKEFEFIPYTPTQTTVTKNFLAQLRWMTSRPILGPFNATAAIEVYYK"
FT   gene            complement(558377..559078)
FT                   /locus_tag="PA0499"
FT   CDS_pept        complement(558377..559078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0499"
FT                   /product="probable pili assembly chaperone"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03888"
FT                   /db_xref="GOA:Q9I619"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I619"
FT                   /protein_id="AAG03888.1"
FT                   /translation="MVLASIFAWLCMSAHADLSFDGQNRFVMKGKRLPITLVNEGKEPA
FT                   LAEISLDWGTDGKGQALPFAVSRPLLRLGAGQRAKVEVLYQGQGLPTDRETYLLLSVLD
FT                   VPHAPSTPETLQIALRHRFKLFYRPPLEATVEQAIEGVTWTLGTSGNPKAHNPSPYHIT
FT                   FSQLEFLDASERSCGEAIEHLMLAPFSNHQFDIAACHPDKVRYAIVSDGGNLHPYHGAL
FT                   KSGVETNAKHP"
FT   gene            559644..560702
FT                   /gene="bioB"
FT                   /locus_tag="PA0500"
FT   CDS_pept        559644..560702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="PA0500"
FT                   /product="biotin synthase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03889"
FT                   /db_xref="GOA:Q9I618"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I618"
FT                   /protein_id="AAG03889.1"
FT                   /translation="MSATASVATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAHFDPNR
FT                   VQVSTLLSIKTGACPEDCKYCPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCM
FT                   GAAWKHPSAKDMPYVLEMVKGVKKLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTS
FT                   PEFYGNIITTRTYSERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHP
FT                   ESVPINMLVKVKGTPLAEEKDVDPFDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQAL
FT                   AFMAGANSIFYGEKLLTTKNPQAEKDMQLFARLGIKPEEREEHADEVHQAAIEQALVEQ
FT                   RESKLFYNAASA"
FT   gene            560808..562013
FT                   /gene="bioF"
FT                   /locus_tag="PA0501"
FT   CDS_pept        560808..562013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="PA0501"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03890"
FT                   /db_xref="GOA:Q9I617"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I617"
FT                   /protein_id="AAG03890.1"
FT                   /translation="MSFDLASRLASRRAEDLYRQRPLLESAQGPDVVVDGQPLLAFCSN
FT                   DYLGLANHPEVIAALRAGAERWGVGGGASHLVVGHSGPHHELELALAEFTGRPRALLFS
FT                   TGYMANLGAVAALVGKGDTVLEDRLNHASLLDAGLLSGARFSRYLHNDPASLAARLDKA
FT                   EGNTLVVTDGVFSMDGNLADLPALAAVAQARGAWLMVDDAHGFGPLGASGGGIVEHFGL
FT                   GQEQVPVLIGTLGKGFGTAGAFVAGSEELIETLIQYARPYIYTTSQPPAVACATLKSLE
FT                   LLRRESWRRQHLAALIARFRHGAEALGLTLMDSFTPIQPILVGGSRQAVALAGMLRARG
FT                   IMVGAIRPPTVPANSARLRVTLSAAHSEAQVDRLLEALGESWRQLSSSLLAEIEAEEGD
FT                   DA"
FT   gene            562006..562728
FT                   /locus_tag="PA0502"
FT   CDS_pept        562006..562728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0502"
FT                   /product="probable biotin biosynthesis protein bioH"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03891"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I616"
FT                   /protein_id="AAG03891.1"
FT                   /translation="MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLDDA
FT                   ADWLDELDDNLPRDSWLAGWSLGGMLAGELAARRGDDCRGLLTLASNPCFRVREDWPNA
FT                   MPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVALPQLEREALVAGLQ
FT                   LLGQLDTRAALENFRGPQLHLFAEADALVPLAAAEALLEWLPDVEVSTLAASHGLPLEC
FT                   PDEVAGAILRFLREGDDA"
FT   gene            562721..563545
FT                   /locus_tag="PA0503"
FT   CDS_pept        562721..563545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0503"
FT                   /product="probable biotin synthesis protein BioC"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03892"
FT                   /db_xref="GOA:Q9I615"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I615"
FT                   /protein_id="AAG03892.1"
FT                   /translation="MPDDSSPLLAPHGVAALPDKRQVAASFSRAAASYDAVAELQRGVG
FT                   ESLLSALPEGFSPRRWVDLGCGTGYFSRALERRFGAAEGLAVDIAEGMLRHARARGGAS
FT                   HFIGGDAERLPLRDGSCDLLFSSLAIQWCADLPAVLAEARRVLRPGGVLAFSSLCVGTL
FT                   GELRDSWRVVDGFVHVNRFRAFADYLQHAAGSGLLPLTLRHEDRLLHFPDLRSLTHELK
FT                   ALGAHNLNPGRPDGLTGRQRIRALVAAYERFRQPEGLPATYRVVFGVLRKDS"
FT   gene            563549..564235
FT                   /gene="bioD"
FT                   /locus_tag="PA0504"
FT   CDS_pept        563549..564235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="PA0504"
FT                   /product="dethiobiotin synthase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03893"
FT                   /db_xref="GOA:Q9I614"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I614"
FT                   /protein_id="AAG03893.1"
FT                   /translation="MPAFFVTGTDTEIGKTTIAAGLLHAARSAGLSTAAAKPVASGCEP
FT                   TAQGLRNGDALVLLGQCSLALAYEQVNPLAFAPAIAPHLAAREAGVELSAARLHEAVRE
FT                   VLALQADFTLVEGAGGWRVPLLGRENLSDLARLLALPVVLVVGVRLGCINHALLSAEAI
FT                   LGDGLALAGWVANVVDPATSRLEENLATLAERLPAPCLGRVPRLEEATPAAVAAHLDLR
FT                   PLGIGL"
FT   gene            564344..564574
FT                   /locus_tag="PA0505"
FT   CDS_pept        564344..564574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0505"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03894"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I613"
FT                   /protein_id="AAG03894.1"
FT                   /translation="MEISGNAFVSGLNAVQSGSARVAQAGSEIARNTVEARSAQAEQMV
FT                   ELTRGKLEAQSGARVIEVADETLGTLIDTHA"
FT   gene            564914..566719
FT                   /locus_tag="PA0506"
FT   CDS_pept        564914..566719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0506"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03895"
FT                   /db_xref="GOA:Q9I612"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I612"
FT                   /protein_id="AAG03895.1"
FT                   /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGAEDATPDMVNAILEE
FT                   GAKFCEQVIAPLNRVGDLEGCTWSADGVKTPTGFKEAYQQFVEGGWPSLAHDVEHGGQG
FT                   LPESLGLAISEMVGQANWSWGMYPGLSHGAMNTLHAHGTAEQQATYLTKLVSGEWTGTM
FT                   CLTEPHCGTDLGMLRTKAEPQADGSYKVTGTKIFISAGEHDMADNIVHIVLARLPDAPQ
FT                   GTKGISLFIVPKFLPNAEGNAGERNAVSCGSIEHKMGIHGNATCVMNFDAATGFLIGPP
FT                   NKGLNCMFTFMNTARLGTALQGLAHAEVGFQGGIAYARERLQMRSLTGPKAPEKPADPI
FT                   IVHPDVRRMLLTMKAFAEGNRAMLYFAAKQVDIVQRSQDEEQKKAADSMLAFLTPIAKA
FT                   FMTEVGFESANHGVQIFGGHGFIAEHGMEQNVRDSRISMLYEGTTGVQALDLLGRKVLM
FT                   TQGEALKGFTKIVHKFCQANEANEAVKEFVAPLAQLNKEWGDLTMKVGMAAMKDREEVG
FT                   AASVDYLMYSGYACLAYFWADMARLAAEKLAAGTGEEAFYKAKLQTARFYFQRILPRTR
FT                   AHVAAMLSGANNLMEMAEEDFALGY"
FT   gene            566932..568728
FT                   /locus_tag="PA0507"
FT   CDS_pept        566932..568728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0507"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03896"
FT                   /db_xref="GOA:Q9I611"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I611"
FT                   /protein_id="AAG03896.1"
FT                   /translation="MPEYKAPLRDMRFLIDEVFDFHGRYQALGASDATPDMVAAILDEG
FT                   SKFCEQVLAPLNRSGDEEGCHFDNGVVTTPKGFKEAYAQYVEGGWNGVASDPAYGGQGL
FT                   PHSLGLLLSEMIGASNVSWGMYPGLTRGAMSAIHAHGSQAQKDLYLARMTAGTWTGTMC
FT                   LTEPHCGTDLGIIKTRAVPNADGSHAISGTKIFISAGEHDLSENIVHLVLAKLPDAPAG
FT                   TKGISLFIVPKFLPDAEGNVGARNAVSCGSIEHKMGIKASATCVMNFDGATGYLIGEPN
FT                   KGLHCMFTMMNHARLGTGMQGLCLGETSYQGAVRYARERLQMRSLTGPKAPDKPADPII
FT                   VHPDVRRMLLTMKAFNEGNRALAYFTAQLLDTEHLSQDAAERERAADLLAFLTPICKAF
FT                   MTETGQEVTNLGMQVYGGHGYIREWGMEQLVRDCRIAQIYEGTNGIQALDLLGRKVLGS
FT                   QGKLLRGFTKLVHQLCQAQAEHPQLKGQVAQLAALNAQWGELTQQVGLAAMKNADEVGA
FT                   ASVDYLMFSGYVTLAYFWLRIALVAREKLDAGSGEAAFYEAKLATADFYFSRLLPRTAA
FT                   HAAAIQAGAAGLMSLSAEQFSL"
FT   gene            569002..570780
FT                   /locus_tag="PA0508"
FT   CDS_pept        569002..570780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0508"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03897"
FT                   /db_xref="GOA:Q9I610"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I610"
FT                   /protein_id="AAG03897.1"
FT                   /translation="MADYKAPLRDMRFVLNEVFEVSRLWAQLPALAEVVDAETAAAILE
FT                   EAGKVTAGTIAPLNRPGDEEGCQWNAGAVSTPAGFPEAYRTYAEGGWVGVGGDPAYGGM
FT                   GMPKVISAQVEELVNSANLSFGLYPMLTAGACLALNAHASDELKDKYLPNMYAGIWAGS
FT                   MCLTEPHAGTDLGIIRTRAEPQADGSYKISGTKIFITGGEHDLTENIIHLVLAKLPDAP
FT                   AGPKGISLFLVPKVLVNADGSLGEKNSLGCGSIEHKMGIKASATCVMNFDGATGWLVGE
FT                   VNKGLAAMFTMMNYERLGVGIQGLATGERSYQSAIEYARERIQSRAPTGPVAKDKAADP
FT                   IIVHPDVRRMLLTMKALNEGGRAFSSYVAMQLDTAKYSEDAVTRKRAEELVALLTPVAK
FT                   AFLTDMGLETTIHGQQIFGGHGFIREWGQEQLVRDCRITQIYEGTNGIQALDLVGRKVI
FT                   GSGGAFSRHFTDEIKAFVASADEALGEFSKPLAAAVENLEELTAWLLDRAKGNPNEIGA
FT                   ASVEYLHVFGYTAYAYMWALMARTALAKQGEDDFYASKLGTARFYFARLLPRIHSLSAS
FT                   VRAGSESLYLLDAEQF"
FT   gene            complement(571111..572592)
FT                   /gene="nirN"
FT                   /locus_tag="PA0509"
FT   CDS_pept        complement(571111..572592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirN"
FT                   /locus_tag="PA0509"
FT                   /product="probable c-type cytochrome"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03898"
FT                   /db_xref="GOA:Q9I609"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I609"
FT                   /protein_id="AAG03898.1"
FT                   /translation="MRLIGLALGLLLGALAQAGEAPGEALYRQHCQACHGAGRLGGSGP
FT                   TLLPESLSRLKPAQAREVILHGRPATQMAGFAGQLDDAAADALVAYLYQAPPREPQWSA
FT                   EDIRASQVQPHPLATLPSRPRFEADPLNLFVVVESGDHHVTILDGDRFEPIARFPSRYA
FT                   LHGGPKFSPDGRLVYFASRDGWVTLYDLYNLKVVAEVRAGLNTRNLAVSDDGRWVLVGN
FT                   YLPGNLVLLDARDLSLVQVIPAADAQGQASRVSAVYTAPPRHSFVVALKDVHELWELPY
FT                   ANGKPVAPKRLAVADYLDDFSFSPDYRYLLGSSRQARGGEVIELDSGARVASIPLSGMP
FT                   HLGSGIYWKRDGRWVFATPNISRGVISVIDLQNWKPLKEIVTDGPGFFMRSHADSPYAW
FT                   TDTFLGKKHDEILLIDKQTLEIAHRLRPSPGKVAGHVEFTRDGRYALLSVWDRDGALVV
FT                   YDAHSLEEVKRLPMNKPSGKYNVGNKIGYAEGTSH"
FT   gene            complement(572583..573422)
FT                   /locus_tag="PA0510"
FT   CDS_pept        complement(572583..573422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0510"
FT                   /product="probable uroporphyrin-III c-methyltransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03899"
FT                   /db_xref="GOA:G3XD80"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:G3XD80"
FT                   /protein_id="AAG03899.1"
FT                   /translation="MNTTVIPPSLLDVDFPAGSVALVGAGPGDPGLLTLRAWALLQQAE
FT                   VVVYDRLVARELIALLPESCQRIYVGKRCGHHSLPQEEINELLVRLARQQRRVVRLKGG
FT                   DPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQ
FT                   NDGRLDLDWAGLARGKQTLVFYMGLGNLAEIAARLVEHGLASDTPAALVSQGTQAGQQV
FT                   TRGALAELPALARRYQLKPPTLIVVGQVVALFAERAMAHPSYLGAGSPVSREAVACA"
FT   gene            complement(573433..574596)
FT                   /gene="nirJ"
FT                   /locus_tag="PA0511"
FT   CDS_pept        complement(573433..574596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirJ"
FT                   /locus_tag="PA0511"
FT                   /product="heme d1 biosynthesis protein NirJ"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03900"
FT                   /db_xref="GOA:G3XD10"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023992"
FT                   /db_xref="UniProtKB/TrEMBL:G3XD10"
FT                   /protein_id="AAG03900.1"
FT                   /translation="MLRISHYLRSLTEDAPTPRRAGGRRAPVVIWNLLRRCNLTCKHCY
FT                   STSADSDFRGELETAEILRGIDDLRAAGVRVLILSGGEPLMHPDLFEIAAHARQAGMFV
FT                   ALSSNGTLIDEGNIQRVAEARFDYVGISLDGLRETHDRFRQKQGSFDAALAAMRLCREA
FT                   DIRVGMRTTLTEENAAQLPALLDLMRELDVQKFYLSHLNYSGRGRRSRALDAHHRRTRE
FT                   ALALLFERADQDIRQGRDSDFVTGNNDADAILLLDWLKRRRPQQLARLCELLLDWGGNA
FT                   SGEGIANIDNTGEVHPDSYWWHHSVGNIRHQRFADFWFERPDPLLLQLRQRPRPVVGRC
FT                   SQCRWLDICNGNTRTRAWAGGELWGEDPGCYLSDQEIGLERIALHAV"
FT   gene            complement(574590..575105)
FT                   /locus_tag="PA0512"
FT   CDS_pept        complement(574590..575105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03901"
FT                   /db_xref="GOA:P95415"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95415"
FT                   /protein_id="AAG03901.1"
FT                   /translation="MSACISPSDALLARRLIELTQAGLPLVADPWAWIAAQLRLSEAET
FT                   LALLKRLRDAGVIRRIAAVPNHYRLGYRHNGMTVWDVADERIERLGRLVGGLSFVSHCY
FT                   RRPRHLPQWRYNLFAMVHGRSEAEIEGYRQQIRLLLGEDCRADEMLVSSRILKKTGLRL
FT                   AQKEERPC"
FT   gene            complement(575080..575523)
FT                   /locus_tag="PA0513"
FT   CDS_pept        complement(575080..575523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0513"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03902"
FT                   /db_xref="GOA:P95414"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95414"
FT                   /protein_id="AAG03902.1"
FT                   /translation="MDEFDRRLLNRLQHGLPLEPHPYALLAAELDCREEDILRRLDDLL
FT                   DDGTLTRFGPLFDIEPLGGAFTLAAMSVPEARFEEIAALLAGWPQVAHNYRREHALNMW
FT                   LVVACDSPAEVAETLARLERESGLAVLDLPKEATYHVGLHFPL"
FT   gene            complement(575516..576040)
FT                   /gene="nirL"
FT                   /locus_tag="PA0514"
FT   CDS_pept        complement(575516..576040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirL"
FT                   /locus_tag="PA0514"
FT                   /product="heme d1 biosynthesis protein NirL"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03903"
FT                   /db_xref="GOA:P95413"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95413"
FT                   /protein_id="AAG03903.1"
FT                   /translation="MNPVEPLAAPQRQHLRYLLEQGLPLASRPYRVLAERIGAGEDEVL
FT                   EQVRRWDEDGLFRRFGVILHHRALGYTANAMLVLDVADAEVDAVGRALAHETIVSLCYR
FT                   RPRRLPMWPYNLFCMIHGRERGEVERQIEALLERHALRQTPHRWLFSLRAYKQCGGRYT
FT                   APPADLERRHG"
FT   gene            complement(576037..576489)
FT                   /locus_tag="PA0515"
FT   CDS_pept        complement(576037..576489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0515"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03904"
FT                   /db_xref="GOA:P95412"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95412"
FT                   /protein_id="AAG03904.1"
FT                   /translation="MDDLSRRLLARYQKGLPICAEPYRRMAETLGCSEAEVLERLRRLE
FT                   ADGALSRVGPVLRHQRAGASTLAALAVPEERLQRVAERISQYAEVNHNYQREHRYNLWF
FT                   VLTAGDRAQLDRVLAEIAADTGLQPLDLPMQEAYCIDLAFPLEASR"
FT   gene            complement(576498..577676)
FT                   /gene="nirF"
FT                   /locus_tag="PA0516"
FT   CDS_pept        complement(576498..577676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirF"
FT                   /locus_tag="PA0516"
FT                   /product="heme d1 biosynthesis protein NirF"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03905"
FT                   /db_xref="GOA:Q51480"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51480"
FT                   /protein_id="AAG03905.1"
FT                   /translation="MNLRPLAPLLLTLLAGCSQQPPLRGSGDLGVLIERADGSVQILDG
FT                   TAKTSLARVEGLGDLSHASLVFSRDQRYAYVFGRDGGLTKLDLLAQRIDKRLIQGGNSI
FT                   GGAISQDGRLVAVSNYEPGGVKVFDSRTLELVAEIPATRLPGQDRNSRVVGLVDAPGQR
FT                   FVFSLFDSGEIWIADFSQGDTPHLTRFRDIGKQPYDALISPDGRYYMAGLFGEDGMAQL
FT                   DLWHPERGVRRVLGDYGRGQRKLPVYKMPHLEGWTIASDQAFVPAVGHHQVLVLDARDW
FT                   KQTDAIDVAGQPVFVMTRPDDRQIWVNFAYPDNDKVQVIDSETHEVIETLRPGPGVLHM
FT                   EFSGRGDQVWISVRDADQLQVWDPYRLKRIGSLPARSPSGIFFSHRAQHIGL"
FT   gene            complement(577673..578032)
FT                   /gene="nirC"
FT                   /locus_tag="PA0517"
FT   CDS_pept        complement(577673..578032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="PA0517"
FT                   /product="probable c-type cytochrome precursor"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03906"
FT                   /db_xref="GOA:Q51479"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51479"
FT                   /protein_id="AAG03906.1"
FT                   /translation="MNAPPDFRRAASHALWLALALTFACPLPGLADEHPDARRQAQLRH
FT                   LLLQDCGSCHGLRLTGGLGPALTPEALRGKPRESLVATVLMGRPQTPMPPWAGLLSEDD
FT                   AGWLVDRLIEGEIAP"
FT   gene            complement(578029..578343)
FT                   /gene="nirM"
FT                   /locus_tag="PA0518"
FT   CDS_pept        complement(578029..578343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirM"
FT                   /locus_tag="PA0518"
FT                   /product="cytochrome c-551 precursor"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03907"
FT                   /db_xref="GOA:P00099"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:1DVV"
FT                   /db_xref="PDB:2EXV"
FT                   /db_xref="PDB:2PAC"
FT                   /db_xref="PDB:351C"
FT                   /db_xref="PDB:3X39"
FT                   /db_xref="PDB:451C"
FT                   /db_xref="PDB:5XEC"
FT                   /db_xref="PDB:5XED"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00099"
FT                   /protein_id="AAG03907.1"
FT                   /translation="MKPYALLSLLATGTLLAQGAWAEDPEVLFKNKGCVACHAIDTKMV
FT                   GPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK
FT                   "
FT   gene            complement(578394..580100)
FT                   /gene="nirS"
FT                   /locus_tag="PA0519"
FT   CDS_pept        complement(578394..580100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirS"
FT                   /locus_tag="PA0519"
FT                   /product="nitrite reductase precursor"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03908"
FT                   /db_xref="GOA:P24474"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:1BL9"
FT                   /db_xref="PDB:1GJQ"
FT                   /db_xref="PDB:1HZU"
FT                   /db_xref="PDB:1HZV"
FT                   /db_xref="PDB:1N15"
FT                   /db_xref="PDB:1N50"
FT                   /db_xref="PDB:1N90"
FT                   /db_xref="PDB:1NIR"
FT                   /db_xref="PDB:1NNO"
FT                   /db_xref="PDB:5GUW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24474"
FT                   /protein_id="AAG03908.1"
FT                   /translation="MPFGKPLVGTLLASLTLLGLATAHAKDDMKAAEQYQGAASAVDPA
FT                   HVVRTNGAPDMSESEFNEAKQIYFQRCAGCHGVLRKGATGKPLTPDITQQRGQQYLEAL
FT                   ITYGTPLGMPNWGSSGELSKEQITLMAKYIQHTPPQPPEWGMPEMRESWKVLVKPEDRP
FT                   KKQLNDLDLPNLFSVTLRDAGQIALVDGDSKKIVKVIDTGYAVHISRMSASGRYLLVIG
FT                   RDARIDMIDLWAKEPTKVAEIKIGIEARSVESSKFKGYEDRYTIAGAYWPPQFAIMDGE
FT                   TLEPKQIVSTRGMTVDTQTYHPEPRVAAIIASHEHPEFIVNVKETGKVLLVNYKDIDNL
FT                   TVTSIGAAPFLHDGGWDSSHRYFMTAANNSNKVAVIDSKDRRLSALVDVGKTPHPGRGA
FT                   NFVHPKYGPVWSTSHLGDGSISLIGTDPKNHPQYAWKKVAELQGQGGGSLFIKTHPKSS
FT                   HLYVDTTFNPDARISQSVAVFDLKNLDAKYQVLPIAEWADLGEGAKRVVQPEYNKRGDE
FT                   VWFSVWNGKNDSSALVVVDDKTLKLKAVVKDPRLITPTGKFNVYNTQHDVY"
FT   gene            580316..581098
FT                   /gene="nirQ"
FT                   /locus_tag="PA0520"
FT   CDS_pept        580316..581098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirQ"
FT                   /locus_tag="PA0520"
FT                   /product="regulatory protein NirQ"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03909"
FT                   /db_xref="GOA:Q51481"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51481"
FT                   /protein_id="AAG03909.1"
FT                   /translation="MRDATPFYEATGHEIEVFERAWRHGLPVLLKGPTGCGKTRFVQYM
FT                   ARRLELPLYSVACHDDLGAADLLGRHLIGADGTWWQDGPLTRAVREGGICYLDEVVEAR
FT                   QDTTVAIHPLADDRRELYLERTGETLQAPPSFMLVVSYNPGYQNLLKGLKPSTRQRFVA
FT                   LRFDYPAAQQEARILVGESGCAETLAQRLVQLGQALRRLEQHDLEEVASTRLLIFAARL
FT                   IGDGMDPREACRVALAEPLSDDPATVAALMDIVDLHVA"
FT   gene            581133..581660
FT                   /locus_tag="PA0521"
FT   CDS_pept        581133..581660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0521"
FT                   /product="probable cytochrome c oxidase subunit"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03910"
FT                   /db_xref="GOA:G3XD44"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:G3XD44"
FT                   /protein_id="AAG03910.1"
FT                   /translation="MWFFILAELSVFSLLLLAFAGAQAWQPELFRAGREQLDSRWGLLL
FT                   TVALLSSGWLAALAVHAVRRGRPRQASGWLLAALLLALVYVGLKLHEYGRLADLGLDIE
FT                   HDTFFTLYWCLTGFHFLHVLLGLLILGWLAQACWRRCYTPQACSGLESGVLYWHMVDLV
FT                   WVLLFPLVYVLQ"
FT   gene            581668..581925
FT                   /locus_tag="PA0522"
FT   CDS_pept        581668..581925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0522"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03911"
FT                   /db_xref="GOA:Q51483"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51483"
FT                   /protein_id="AAG03911.1"
FT                   /translation="MRTLTLCWLALLALAVTGVLLGGAGDSPWLLAAVLACAVAKGWLI
FT                   GERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN"
FT   gene            582015..582455
FT                   /gene="norC"
FT                   /locus_tag="PA0523"
FT   CDS_pept        582015..582455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="PA0523"
FT                   /product="nitric-oxide reductase subunit C"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03912"
FT                   /db_xref="GOA:Q59646"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:3O0R"
FT                   /db_xref="PDB:3WFB"
FT                   /db_xref="PDB:3WFC"
FT                   /db_xref="PDB:3WFD"
FT                   /db_xref="PDB:3WFE"
FT                   /db_xref="PDB:5GUW"
FT                   /db_xref="PDB:5GUX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59646"
FT                   /protein_id="AAG03912.1"
FT                   /translation="MSETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAM
FT                   SAAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMNIQPL
FT                   NVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG"
FT   gene            582455..583855
FT                   /gene="norB"
FT                   /locus_tag="PA0524"
FT   CDS_pept        582455..583855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="PA0524"
FT                   /product="nitric-oxide reductase subunit B"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03913"
FT                   /db_xref="GOA:Q59647"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="PDB:3O0R"
FT                   /db_xref="PDB:3WFB"
FT                   /db_xref="PDB:3WFC"
FT                   /db_xref="PDB:3WFD"
FT                   /db_xref="PDB:3WFE"
FT                   /db_xref="PDB:5GUW"
FT                   /db_xref="PDB:5GUX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59647"
FT                   /protein_id="AAG03913.1"
FT                   /translation="MMSPNGSLKFASQAVAKPYFVFALILFVGQILFGLIMGLQYVVGD
FT                   FLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPKLAWILFWVFAAA
FT                   GVLTILGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGMTVL
FT                   RGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIMGAIL
FT                   AFVLVKITGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVFSALEP
FT                   LPFFAMVLFAFNTINRRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPVNYYTH
FT                   GTQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWLMTVAMV
FT                   FITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIGLVAYLLS
FT                   FRRGKAAA"
FT   gene            583857..585695
FT                   /locus_tag="PA0525"
FT   CDS_pept        583857..585695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0525"
FT                   /product="probable dinitrification protein NorD"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03914"
FT                   /db_xref="GOA:Q51484"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51484"
FT                   /protein_id="AAG03914.1"
FT                   /translation="MAFAVELEEWVGAHWHRFITRHASGEFEAARVTLESMRRPLGMLF
FT                   RALGGAPGVALEATPARRLLLRRTWLQRVAGTCEQAPVSWFNGDSLRLPESLAVYPQAE
FT                   LNRELYRWLALLAASAGPLRHWAQDNQRWARQLLDAYPALRPRYARLVAAHLRQRPSLD
FT                   DCPAADAELEIALRRALAEPGSVERFPRVERAPWPVPLWLYPGERWTPSASAEDGEEAA
FT                   AGAGKRQVARSGARKRAERIEERNSERNLLLFRLESLLSWSEHLALDRCSDDEDDPDGA
FT                   RVAEDLDYLSLSRQRTQKGGGLRLDLDLPAADYDDLPLGPGLKLPEWDYRQQRLLSDHV
FT                   LLQPMRPRGATSASLPAHLEKTALHLRRQFACLRDGRQRLRQQPQGDEIDLDAWLDFQV
FT                   ERRRGGSTQPGLFLEQRPRRRDLACLLLADLSMSTEAYLDDQRRVIDSIVDSLLLFGEA
FT                   LQALGDPFALYGFSSVRRQQVRWQVLKDFDEGYGGEVRGRVLALSPGYYTRMGAAIRRA
FT                   SQVLGGQPQKRRLLLLLSDGKPNDLDRYEGRYGIEDTRQAVIEARSQGLVPFCITIDKE
FT                   AADYLPYLFGADGFALVERAGQLPERLLQLYRRLRR"
FT   gene            complement(585702..585896)
FT                   /locus_tag="PA0526"
FT   CDS_pept        complement(585702..585896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0526"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03915"
FT                   /db_xref="GOA:G3XDA0"
FT                   /db_xref="UniProtKB/TrEMBL:G3XDA0"
FT                   /protein_id="AAG03915.1"
FT                   /translation="MRQCLYCLHETEGAESACEQCGMPLPSASQHQLQGRRQRRFAWFC
FT                   VGLALFCLGMMLWLPRDAP"
FT   gene            complement(585980..586663)
FT                   /gene="dnr"
FT                   /locus_tag="PA0527"
FT   CDS_pept        complement(585980..586663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnr"
FT                   /locus_tag="PA0527"
FT                   /product="transcriptional regulator Dnr"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03916"
FT                   /db_xref="GOA:G3XCW6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:G3XCW6"
FT                   /protein_id="AAG03916.1"
FT                   /translation="MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFR
FT                   QGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVV
FT                   PSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLT
FT                   LAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRER
FT                   LECFE"
FT   gene            586867..586990
FT                   /gene="rsmY"
FT                   /locus_tag="PA0527.1"
FT   ncRNA           586867..586990
FT                   /gene="rsmY"
FT                   /locus_tag="PA0527.1"
FT                   /product="regulatory RNA RsmY"
FT                   /ncRNA_class="other"
FT   gene            complement(587017..587895)
FT                   /locus_tag="PA0528"
FT   CDS_pept        complement(587017..587895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0528"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03917"
FT                   /db_xref="GOA:Q9I608"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I608"
FT                   /protein_id="AAG03917.1"
FT                   /translation="MDFRQLRYFVALYEEGHVGRAAERLALSQPALSQQIRQLEQNLDV
FT                   SLFQRSGKRLLPTVAAHTLYNHAVPLLEGLERAREAMRVFRGQTPRSLAIGVLQTVNAS
FT                   LVPYMVERLHAAQPHLRVQIYELSGIDIERRLLTGNLDIGIGFLPPRQPGLHSVELYED
FT                   ELQLVIPEEHPLKEFRKVSLAQAAELPMLLLGEEFRARQIWQEQLAAIGRRPRVQAELN
FT                   HMSGILDSLPQTRFATVLPGKARQMHSNQRLLWKPLSEPRIPLKVGLVYRDAQRQHASV
FT                   ELLRSLLEGVV"
FT   gene            587997..588698
FT                   /locus_tag="PA0529"
FT   CDS_pept        587997..588698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03918"
FT                   /db_xref="GOA:Q9I607"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I607"
FT                   /protein_id="AAG03918.1"
FT                   /translation="MEQIVVNGVFIGKVEETWGGLVSAIDKLPVEQEFWLGHDGLPGDE
FT                   QADIRHHGGLERALHHYPAEHYRYWRKRHPLNRWQLPAFGENISTYGITEAEVCIGDQF
FT                   HWGDALLEVSQPRSPCYRQGQRWNLPELPDELQSGGRCGWFYRVLRSGMVTPGDELKLV
FT                   QRHYPELTVARLLQWYFGDPLEPLGLRQMMACDALSQRWRKTAAKRLSSGVVEDWGPRL
FT                   RGPSDYREHAS"
FT   gene            588924..590105
FT                   /locus_tag="PA0530"
FT   CDS_pept        588924..590105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0530"
FT                   /product="probable class III pyridoxal phosphate-dependent
FT                   aminotransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03919"
FT                   /db_xref="GOA:Q9I606"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I606"
FT                   /protein_id="AAG03919.1"
FT                   /translation="MADALDSLRLMRTQERPAQVFVRGQGSWLWDSDGRAFLDFTQGLA
FT                   VNCLGHSPSVLVQALARQARELVSAGPGLLNRPVLALAQRLCLATGSDQAYFLTSGAEA
FT                   NEAAIALARKWGRLHRGGAQRIVSTVNSIHGRTPGTLTACGKPAQHGLEGFARVPFNDL
FT                   DAMAAAIDEETVAVMLEPVQGDAGVIPATLDYLRGIERLCRQRGVLLILDEVQTGIGRC
FT                   GALLAEELYGVRADIVTLGKGLGAGVPLSALLARGNACCFEPGDQLGTHHGNALMTAAG
FT                   LAVLNTVLEPGFLEQVREQGTHLRDGLARVARRYGHGPLRGQGLFWGLPLIGQRAPAVV
FT                   RAAFGEGLLINAPQPHCLRFSPALTVSRANVDEMLRRLERALARVANRHEEVA"
FT   gene            590105..590821
FT                   /locus_tag="PA0531"
FT   CDS_pept        590105..590821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0531"
FT                   /product="probable glutamine amidotransferase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03920"
FT                   /db_xref="GOA:Q9I605"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I605"
FT                   /protein_id="AAG03920.1"
FT                   /translation="MRALVLQHVPFEGSARIGDWIGRHCEHEHVCYLYADAHLPALDSF
FT                   DLLVVMGGPMSVHDEAQYPWLVAEKRLIRAALDAGKKVLGICLGAQLLAQALGAAVRPG
FT                   RQAEIGWWPLHRYSQALGSPLGERLPERLMAFHWHGETFDLPAGSVPLYGSAACANQGF
FT                   IWNEQAIGLQCHLESTAESIEALLDACPQDLQREGAVQSAGRIRQGVAHCREVAPVLFL
FT                   LLDYLAHRPAEIARRA"
FT   gene            complement(590896..591402)
FT                   /locus_tag="PA0532"
FT   CDS_pept        complement(590896..591402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0532"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03921"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I604"
FT                   /protein_id="AAG03921.1"
FT                   /translation="MPARPDRARVTIALAVLVHLHRETIAEAPLPWRYRKQCPGGKPRR
FT                   RAGREATPPLGPEVVDASTRLALHEKKAPSPCMSDAMSKNKHPDLGEIQRSLNQALEGY
FT                   DCQCRMHYDGTVSINVAAREHDETFTFVGIQPGELDNPTRLHLFAESLRRDLALLEPWL
FT                   GKHAA"
FT   gene            591445..592935
FT                   /locus_tag="PA0533"
FT   CDS_pept        591445..592935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0533"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03922"
FT                   /db_xref="GOA:Q9I603"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I603"
FT                   /protein_id="AAG03922.1"
FT                   /translation="MNDQVLRTQTDRRQLQQIIAGLTEGVILIEPDQRILWANEAALAM
FT                   HGVDSLEGLGADTGEYRERFRLRYRNNHPLQEGQYPAERLVAGECFSDVVVEVFPAADE
FT                   DTRWVHRVRGLVLTTPEDKPDCLVLILHDATEWASAEQRFEKTFNANPAPAVICRLSDY
FT                   RYVKVNVGFLEMTGYARDQVIGRSVYELDVLDQAERRELAVERLGAGETIPQMEASLRV
FT                   AEGGRKCVVVAGQPIEVGEEACMLFTFTDLEPRKKAEEALRKSEERFAKAFRMAPVPSL
FT                   VLYGDDLQALDINQAFSETFGYQAEELLGESTVACGLWQDGGAERLGELLAQSGSVRNV
FT                   QLRLQHKDRNGLDCLVSAEAVSLNEQDCVLVALLDISDRRRTEMELVHAIETVMQDASW
FT                   FSRTLIEKLANVRRANAPGTGAELADLTAREREVFDLICQGLADKEIAKELGLAPNTVR
FT                   NHVATIYAKLDVHSRGEAIVWARERGFAPEPRNGNGRK"
FT   gene            593273..594562
FT                   /locus_tag="PA0534"
FT   CDS_pept        593273..594562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03923"
FT                   /db_xref="GOA:Q9I602"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I602"
FT                   /protein_id="AAG03923.1"
FT                   /translation="MFLQSNEHVGTYYAAVNPELIQPRQALEGDLDCEVLVVGAGFSGL
FT                   HTALRLVEGGRQVCVIEASRIAWAASGRNGGQALPGWSSDLPPLEADLGYEGARRLWDG
FT                   MLWAAGEMRELPQRHGFDCDYRVGHLWTAILPRRVGLLYDWQAEANRRWGYEGLRFVAK
FT                   DELPEWIASERYLAGLYDPHAAHLNPLKLAFGLAAAIERAGGRIHERTRALNYREEGDG
FT                   YRVRTEHGEIRCAALVLACNAYIDGLDSELSQRMLPVGTYQVATEPLGEERAKSLLPRN
FT                   CCVTDNQFVLDYFRLTPDHRLLFGGGCTYLGGMPSDIRAATRPYLERVFPQLRGVALEY
FT                   AWGGHIDCSMRRTPDIGRQGNRYWLQGYSGHGVLPSLAAARAVSDALLGDDETLALYQR
FT                   LRNPKFPGGQRFAAPLEALGKAYYRLRDLF"
FT   gene            594580..595134
FT                   /locus_tag="PA0535"
FT   CDS_pept        594580..595134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0535"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03924"
FT                   /db_xref="GOA:Q9I601"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I601"
FT                   /protein_id="AAG03924.1"
FT                   /translation="MSEVADDLAEIASLVRELRKRKGITLQALADGIRRSVGFVSQVER
FT                   GLSRPAVDDLVAISQVLGVPATYFFCSPKIQASPWVTRPGERRTLAYARGASDNLVSPR
FT                   LGGAFFMLETCLEAGADSGERDLLDSSEQGGYVLEGELTLWLEDEELRLQAGDGFQIPS
FT                   HMRSRYANRSQAPVRVLWVYA"
FT   gene            complement(595245..596270)
FT                   /locus_tag="PA0536"
FT   CDS_pept        complement(595245..596270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0536"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03925"
FT                   /db_xref="GOA:Q9I600"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I600"
FT                   /protein_id="AAG03925.1"
FT                   /translation="MRRLLLGAGLLLASLVAWADVPPIPALTARVTDLTATLSGDQRQH
FT                   LEQQLAALEAKSGAQLAVLLVPTTGDDSIEEYAVRTFEKWKLGQKKVDDGVLLLVAKND
FT                   RTLRIEVGYGLEGAITDVQAGRIISEQITPQFRQGNFYGGIQAGVDSLVQLIDAEKNPD
FT                   SATASAPVDALPAVPEATPPRALPAPVDEGEVYDSAPPEPKKKSGLSGQLWGNPVYLGV
FT                   YVAVLLAVALLGRLLPLQWMRRRSIGRFLLCSAAVAGLAWLLSMGLWQNVDRAADDSLG
FT                   VLAPTLFIYALFLLPGEVLMAILSAILNSRGGGGGGGSGGGGIFRGGGGSSGGGGASGR
FT                   W"
FT   gene            complement(596274..596882)
FT                   /locus_tag="PA0537"
FT   CDS_pept        complement(596274..596882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03926"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Z9"
FT                   /protein_id="AAG03926.1"
FT                   /translation="MPRFLRNALLPVLALLLSGCGYNAMQAGDEQVKAAWSEVLNQYQR
FT                   RADLVPNLVSTVKGYASHEASVLTQVTEARAKVGSVQLNADQLDDEQAVQRFQKAQGEL
FT                   SSALSRLLVVTENYPQLKADGLFKDLLTQLEGTENRIAVARGRYVKSVQEYNVLLRQFP
FT                   GVITAKLFGYKPKANFSVENEAAISTAPKVDFGNPQPAQ"
FT   gene            complement(596970..597479)
FT                   /gene="dsbB"
FT                   /locus_tag="PA0538"
FT   CDS_pept        complement(596970..597479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="PA0538"
FT                   /product="disulfide bond formation protein"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03927"
FT                   /db_xref="GOA:P57701"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57701"
FT                   /protein_id="AAG03927.1"
FT                   /translation="MSALLKPLDNRLFWPAVAIGGLLILAFVLYLQHVRGFAPCSLCIF
FT                   IRLDVLGLVLAGIVGSLAPRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGS
FT                   CKMFMGFPEWIPLDTWLPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLA
FT                   FGRRTA"
FT   gene            597708..598538
FT                   /locus_tag="PA0539"
FT   CDS_pept        597708..598538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0539"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03928"
FT                   /db_xref="GOA:Q9I5Z7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Z7"
FT                   /protein_id="AAG03928.1"
FT                   /translation="MLATSLVLCAAVLHATWNTLVKFSSDRLLVVACMDVVGVLCAILL
FT                   LPFVSLPPAEVWPWLLGATVLQLLYRVLLIEAYKVGDLGLVYPLMRGLSPLVVLGLTLA
FT                   FGGEQLSGRQILGILLIPFGMLCLLWGGGGSRLPWRTLPVVLLIGLCIGGYTWSDGNAL
FT                   KRWPLALDYLVWLTLLSGLPFPLIAVGARTRAFARFWALEWKLGLAVGVCVLASYGLVL
FT                   WAMQLGSIAEAAALRETSVLLAVLFGMRFLNEPFGLPRLLACGLVLAGMLLMKL"
FT   gene            598608..598994
FT                   /locus_tag="PA0540"
FT   CDS_pept        598608..598994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0540"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03929"
FT                   /db_xref="GOA:Q9I5Z6"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Z6"
FT                   /protein_id="AAG03929.1"
FT                   /translation="MTIAFWCVLIAIFLPYVCTSIAKFGGEGYGGRANADPRAFLGSLE
FT                   GFRRRANNAQLNAFEVTPAFAAAVIIAHLVGNASQATLDSLAIAWITSRLLYVICYLAD
FT                   WGPLRSLVWFVGMLLIAAFFVVSA"
FT   gene            599107..599565
FT                   /locus_tag="PA0541"
FT   CDS_pept        599107..599565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0541"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03930"
FT                   /db_xref="GOA:Q9I5Z5"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Z5"
FT                   /protein_id="AAG03930.1"
FT                   /translation="MKLKSLLVVLLAGVALSGCHRMDPNSPEAKRQAIFKEMLRTSEDM
FT                   GGMLRGRLPFDAEKFRAGSAKLHQLADQPWQYFPSPKAGEEGEDTRAKDEVWQRQQEFK
FT                   AATQVFIDAMNRLQDNTRQATPTPDGVRKDFAAVEDACEACHKKFRAL"
FT   gene            complement(599757..600176)
FT                   /locus_tag="PA0542"
FT   CDS_pept        complement(599757..600176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03931"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Z4"
FT                   /protein_id="AAG03931.1"
FT                   /translation="MSIRPSLPLAGLLLAVALPLSAAQPGAAKGAPLSGCAAKQAAIEA
FT                   KLETARSFANEGQVAGLEKALSEVKEHCTEAGLLRENKQKVIDSEREVSEREKDLRKAM
FT                   GKGDPEKIEKRKAKLAEARAELEEAKKGLEQAQAQ"
FT   gene            600426..601394
FT                   /locus_tag="PA0543"
FT   CDS_pept        600426..601394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0543"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03932"
FT                   /db_xref="GOA:Q9I5Z3"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Z3"
FT                   /protein_id="AAG03932.1"
FT                   /translation="MRTLIRLVRTLILLLVLALLAGAWWWLQDEALRPPALAGHSEDSS
FT                   LKVAGLRRHYLLYVPPGVSEGAPLLVVLHGSRGDGAQMRRISGYGFDRLAAQEGFLVAY
FT                   PDGFEGHWNDCRKAASYSARLRDVDDVAFLRALVARLAQEYRVDSQRVYVAGYSNGGQM
FT                   AFRLAAEAPGLPAAIAAVAASLPTTGNDACRPVERPTAALLINGTRDPINPYLGGKVSL
FT                   FGFGDRGAVRSTLDSARWWAGLNGIAAPPDVAPLTRPGPVWTERQRWQEDGHPPVELLS
FT                   VHGGGHVLAQPDYRFPRILGKSDPELDAPVEIWRFFSQLPR"
FT   gene            complement(601398..602141)
FT                   /locus_tag="PA0544"
FT   CDS_pept        complement(601398..602141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0544"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03933"
FT                   /db_xref="GOA:Q9I5Z2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Z2"
FT                   /protein_id="AAG03933.1"
FT                   /translation="MKIRLLSDLHHEHFDGRRQLPEVEADVVVLAGDIHSHLEGLHWAR
FT                   ETFADSEIVYVAGNHEFYSSEMTDLTQAMRNIARALEIHFLENDEARIGPARFLGATLW
FT                   TDFQLYGADGYAPAHELALQSMPDFSCIDWFGGDFTPEQSIALHQASRDWLAEQLARPH
FT                   DGPTLVVSHHAPSALSIPPQFVGNPLSPAFASNLDELVAQADYWLHGHVHDALDYRIGR
FT                   ARVLANPGGYPHERGGFRPEFVFEV"
FT   gene            602346..603650
FT                   /locus_tag="PA0545"
FT   CDS_pept        602346..603650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0545"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03934"
FT                   /db_xref="GOA:Q9I5Z1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Z1"
FT                   /protein_id="AAG03934.1"
FT                   /translation="MKLLWGVLAAALAAWGLTLAVDPPASLDIWVVRKQAILLTGVASF
FT                   ALMSLIMLLAVRPVWLEKPLDGLDRMYRLHKWAGILAIVLGLLHYLLELAGPWLAGIVG
FT                   KPVKGPRVETFLDVFRGSAKELGEWSAWILGGMLLVTLWQRFPYHLWRYVHKALALVYL
FT                   VLAFHSVVLAPASYWSQPAGWLVAACALLGSACALLSLSGRIGRTRRHAGVVTAVERHG
FT                   ESLLEVTCRLQGDWSHRAGQFAFLTCDRLEGAHPFTIASADRGCGEVRFSIKALGDYTR
FT                   RLQDNLEVGARVEVEGPYGCFDFRRGLAGRQVWVAAGIGVTPFIAWLESLQAAPESAPS
FT                   VELHYCVRNSQEALFAGRLRELCEHLPSVTLHIRYSDEQGKPQAAQLGVLKSAEGRWPS
FT                   VWFCGPQGLADSLRRDLRRQGMPLRLFHQEAFRMR"
FT   gene            complement(603706..604896)
FT                   /gene="metK"
FT                   /locus_tag="PA0546"
FT   CDS_pept        complement(603706..604896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="PA0546"
FT                   /product="methionine adenosyltransferase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03935"
FT                   /db_xref="GOA:Q9I5Z0"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I5Z0"
FT                   /protein_id="AAG03935.1"
FT                   /translation="MSEYSVFTSESVSEGHPDKIADQISDAVLDAIIAKDKYARVACET
FT                   LVKTGVAIIAGEVTTSAWVDLEELVRKVIIDIGYDSSDVGFDGATCGVLNIIGKQSVDI
FT                   NQGVDRAKPEDQGAGDQGLMFGYASNETDVLMPAPICFSHRLVERQAEARKSGLLPWLR
FT                   PDAKSQVTCRYEGGKVVGIDAVVLSTQHNPEVSYNDLRDGVMELIIKQVLPAELLHKDT
FT                   QFHINPTGNFVIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSAAYAGR
FT                   YVAKNIVAAGLAERCEIQVSYAIGVAQPTSISINTFGTGKVSDEKIVQLVREHFDLRPY
FT                   AITKMLDLLHPMYQPTAAYGHFGRHPFELTVDGDTFTAFTWEKTDKAALLRDAAGL"
FT   gene            complement(604912..605913)
FT                   /locus_tag="PA0547"
FT   CDS_pept        complement(604912..605913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0547"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03936"
FT                   /db_xref="GOA:Q9I5Y9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Y9"
FT                   /protein_id="AAG03936.1"
FT                   /translation="MSLRVPSIRPDDYDPLAALCKAAGDSLRLNVLRALANDSFGVLEL
FT                   AQIFAIGQSGMSHHLKVLAQAGLVATRREGNAIFYRRSLPLAERTGGALHAALLEEVDE
FT                   RALPDDVRARIDAVHAQRAAVSQDFFARAADKFQAQQDLIAGLPQYRESVLALLDALAF
FT                   APGATALEVGPGDGGFLPELARRFRQVTALDNSAAMLELARQRCKEEGLGNVRLELADA
FT                   LQDAAEPADCVVLNMVLHHFAAPAEALKQLARLVHPGGSLLVTDLCRHNQGWAREACGD
FT                   LWLGFEQEDLAQWADAAGLTPGESLYIGLRNGFQIQVRHFARDASESRLTHR"
FT   gene            606160..608157
FT                   /gene="tktA"
FT                   /locus_tag="PA0548"
FT   CDS_pept        606160..608157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="PA0548"
FT                   /product="transketolase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03937"
FT                   /db_xref="GOA:Q9I5Y8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="PDB:4XEU"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Y8"
FT                   /protein_id="AAG03937.1"
FT                   /translation="MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYM
FT                   QHNPSNPQWANRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKNFRQLNSRTPGHPEYG
FT                   YTAGVETTTGPLGQGIANAVGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGIS
FT                   HEVASLAGTLRLNKLIAFYDDNGISIDGEVHGWFTDDTPKRFEAYGWQVIRNVDGHDAD
FT                   EIKTAIDTARKSDQPTLICCKTVIGFGSPNKQGKEECHGAPLGADEIAATRAALGWEHA
FT                   PFEIPAQIYAEWDAKETGAAQEAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKA
FT                   AAYVADVANKGETIASRKASQNALNAFGPLLPELLGGSADLAGSNLTLWKGCKGVSADD
FT                   AAGNYVFYGVREFGMSAIMNGVALHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYV
FT                   FTHDSIGLGEDGPTHQPIEQLASLRLTPNLDTWRPADAVESAVAWKHAIERADGPSALI
FT                   FSRQNLPHQARDVAQVADIARGGYVLKDCEGEPELILIATGSEVGLAVQAYDKLSEQGR
FT                   KVRVVSMPCTSVYEQQDESYKQSVLPVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSF
FT                   GESAPAPALFEHFGFTLDNVLAVAEELLED"
FT   gene            608157..609221
FT                   /locus_tag="PA0549"
FT   CDS_pept        608157..609221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0549"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03938"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Y7"
FT                   /protein_id="AAG03938.1"
FT                   /translation="MHTLYWRDLESPANGEWLGLAVQVEGAHRAPSFLHLQSGGQARIR
FT                   LMRGDQPLLWATQLPYHDGIWLVKSLVAASPAQASVPPIDSPTLEALRGLRGEARYKAW
FT                   SRYFVETLRTSPGSCLEAGRWLLRLSLAEQVPAWQPPQSHDPRERVLERWRYRSVGRDA
FT                   LLPDWRFYSLEKVLDDDWVQWLDWWGRDNDALIALRRVEDDEGRVKWWRKKAREGELPP
FT                   VLALRLNCLDACVILDGHCRLRAGLLENVAPEILVLCAYDEQPMPVDTAQRERVLQSLA
FT                   QRVDAPVRRGRRPLDSEQLNQVLLRLFDDRPWPRVLTRARAVLKEEQWCAEVRDWLAAR
FT                   ERLDALEPIIRRVE"
FT   gene            complement(609202..609999)
FT                   /locus_tag="PA0550"
FT   CDS_pept        complement(609202..609999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03939"
FT                   /db_xref="GOA:Q9I5Y6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Y6"
FT                   /protein_id="AAG03939.1"
FT                   /translation="MPRFAANLSMLYPRHDFLERFAAAAADGFEGVEYLFPYAYPAAEL
FT                   KARLDDHGLRQVLFNAAPGDWDKGERGLASLPGREAEFRRAIAQAIDYAQVLGNRHIHV
FT                   MAGLLPAGADRIRHRETYLDNLAHAAREAAGAGLTVLIEPINNRDMPGFFLTRQDDAQA
FT                   ICREVGADNLQVQFDCYHCQIVEGDLATTLRRDIGNIGHVQIAGVPDRHEPDDDNEVNY
FT                   PYLFELLDRLGYQGWIGCEYRPRGDTSAGLEWLRRWRATRRDG"
FT   gene            610214..611275
FT                   /gene="epd"
FT                   /locus_tag="PA0551"
FT   CDS_pept        610214..611275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epd"
FT                   /locus_tag="PA0551"
FT                   /product="D-erythrose 4-phosphate dehydrogenase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03940"
FT                   /db_xref="GOA:Q9I5Y5"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Y5"
FT                   /protein_id="AAG03940.1"
FT                   /translation="MSTPPFRVALNGYGRIGRCVLRALHERPEQLGFEIVALNDLADQA
FT                   SVEYLTRFDSTHGRFPGEVKVDGDCLHINGDCVKVLRSPTPEAIDWQALRVDLVLECSG
FT                   QYTNRAQAERFLRAGAPRVLFSQPMASEADIDATIVYGVNQQDLSGRETLVSNASCTTN
FT                   CGVPLLKLLNEAIGLEYVSITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPVSTGLA
FT                   RGIERLLPELAGRIQAKAIRVPTVNVSALDITLQTSRDTSAAEINRVLREAAESGPLRG
FT                   LLAYTELPHASCDFNHDPHSAIVDGSQTRVSGPRLVNLLAWFDNEWGFANRMLDVAGHY
FT                   LRAAVPDQQVPKD"
FT   gene            611281..612444
FT                   /gene="pgk"
FT                   /locus_tag="PA0552"
FT   CDS_pept        611281..612444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="PA0552"
FT                   /product="phosphoglycerate kinase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03941"
FT                   /db_xref="GOA:Q9I5Y4"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I5Y4"
FT                   /protein_id="AAG03941.1"
FT                   /translation="MTVLKMTDLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTLK
FT                   LALEKGAAVMVCSHLGRPTEGEFSAENSLKPVAEYLSKALGREVPLLADYLDGVEVKAG
FT                   DLVLFENVRFNKGEKKNADELAQKYAALCDVFVMDAFGTAHRAEGSTHGVARFAKVAAA
FT                   GPLLAAELDALGKALGNPARPMAAIVAGSKVSTKLDVLNSLAGICDQLIVGGGIANTFL
FT                   AAAGHKVGKSLYEADLVETAKAIAAKVKVPLPVDVVVAKEFAESAVATVKAIAEVADDD
FT                   MILDIGPQTAAQFAELLKTSKTILWNGPVGVFEFDQFGEGTRTLANAIADSAAFSIAGG
FT                   GDTLAAIDKYGIAERISYISTGGGAFLEFVEGKVLPAVEILEQRAKG"
FT   gene            612517..612717
FT                   /locus_tag="PA0553"
FT   CDS_pept        612517..612717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0553"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03942"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Y3"
FT                   /protein_id="AAG03942.1"
FT                   /translation="MRSVTLPLLMFCLGLAACSGDGGRRPSTCEVISPPDVMVPTEQNR
FT                   QRVEQQSSGDPTAGQKPVECP"
FT   gene            612877..613218
FT                   /locus_tag="PA0554"
FT   CDS_pept        612877..613218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0554"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03943"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Y2"
FT                   /protein_id="AAG03943.1"
FT                   /translation="MNYSRIALFGGFAAAALLAGCSASSGKPGGKDWTRWTCDSKAVIE
FT                   WRYIDGSKNIVDLRLKDEDDVVHHLEQEPAAVGAFYSDGRLGFHLENDEGLVYWVETDD
FT                   LIGRGCKAR"
FT   gene            613338..614402
FT                   /gene="fda"
FT                   /locus_tag="PA0555"
FT   CDS_pept        613338..614402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fda"
FT                   /locus_tag="PA0555"
FT                   /product="fructose-1,6-bisphosphate aldolase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03944"
FT                   /db_xref="GOA:Q9I5Y1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I5Y1"
FT                   /protein_id="AAG03944.1"
FT                   /translation="MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPV
FT                   IVQASAGARKYAGAPFLRHLILAAIEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMM
FT                   DGSLREDGKTPADYDYNVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAE
FT                   GVLDHSQLLTDPEEAADFVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHA
FT                   RIPDTHLVMHGSSSVPQDWLAIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNIDTDLR
FT                   LASTGAIRRFLAQNPSEFDPRKYFSKTVEAMRDICIARYEAFGTAGNASKIKPISLEGM
FT                   FQRYARGELDPKVN"
FT   gene            614468..614950
FT                   /locus_tag="PA0556"
FT   CDS_pept        614468..614950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0556"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03945"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5Y0"
FT                   /protein_id="AAG03945.1"
FT                   /translation="MRRWLLTLPFLLLAGCAGLHAPSRDVEEAASPSVARDPADPQDCL
FT                   ARSDCTTKTSRTLLFVFDYAEAGGELVVRDGRQLETPPAPQRSTWPALRIQLAEPVNGR
FT                   FEFESPCLRKSGKGCRYSQAMLLKVYRSYLVGKPCSLLSPRAVKRCVDPAATAARR"
FT   gene            complement(614952..615608)
FT                   /locus_tag="PA0557"
FT   CDS_pept        complement(614952..615608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0557"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03946"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X9"
FT                   /protein_id="AAG03946.1"
FT                   /translation="MRDLLGGRESPRYSTAVFPRIPDERFKALRGVARSHWSGASWTSR
FT                   GRGYCRSEGPPDDQGKSIPAHAGVPRHNQESAMSSEVSAIRQLIEDWRAAVRASDVPRI
FT                   VSYYAEDIVAFDAILQLQFKGRDAYQKHWQACTEMCKGPMTFDIAELQIHADPQVAFAH
FT                   YLCHCGGTGPDGQPHSSWMRVSAGYRKHGDGWKVIHEHFSAPFDMDGKALFDLQP"
FT   gene            615607..616374
FT                   /locus_tag="PA0558"
FT   CDS_pept        615607..616374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03947"
FT                   /db_xref="GOA:Q9I5X8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X8"
FT                   /protein_id="AAG03947.1"
FT                   /translation="MSSVHSAAQQGFSAEAQRYAQGRPEYPEALSDWLRDALGLRPQTV
FT                   AVDLGAGTGKFTRLLARTGARVVAVEPVDAMRAQLAEALPQVQALAGSAQSIPLANGFA
FT                   DALVCAQAFHWFATVEALEEMRRVLTAEGRLGLVWNVRDESLDWVAEITRIITPYEGDA
FT                   PRFYKGDWRRPFERAPFGPLRLSTFAYEHVGPPEQVIVSRFLSVSFIAALPETEKNAVA
FT                   AQLRELVASHPALKGKEQVALPYRTEAYLAEAR"
FT   gene            complement(616371..617549)
FT                   /locus_tag="PA0559"
FT   CDS_pept        complement(616371..617549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03948"
FT                   /db_xref="GOA:Q9I5X7"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X7"
FT                   /protein_id="AAG03948.1"
FT                   /translation="MASTDVLIVGAGAAGLMCAMTAAGRGRRVRVLDHANKAGKKILMS
FT                   GGGRCNFTNLYTEPANFLSRNPHFCKSALARYTQWDFIGLVAKHQVPYHEKKLGQLFCD
FT                   NKSSDILEMLLRECAEAGAEILLDTSIEEIARDDAGYRLRTSAGEMRCESLVIASGGLS
FT                   IPTLGASGFGYQVARQFGHEVLPTRAGLVPFTITDQLKELCAELSGTSVDCRVSCNGQA
FT                   FRENLLFTHRGLSGPAMLQISSYWQPGDTLEIDLLPDHDASEWLAQQQRERPNSELKTL
FT                   LAELFTKKLAGLLADRWFVSKPMKQYTPTELAGIAGQLSAWRVTPSGTEGYRTAEVTLG
FT                   GVSTDEVSSKTMESQRSPGLYFVGEVLDVSGHLGGFNFQWAWASGYAAGQYA"
FT   gene            617662..618150
FT                   /locus_tag="PA0560"
FT   CDS_pept        617662..618150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03949"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X6"
FT                   /protein_id="AAG03949.1"
FT                   /translation="MIPLKYLQAYPASLQDQVRQLIAENRLGEYLERRYPGRHDVQSDK
FT                   ALYAYTMNLKQEHLRNAPGLDKVLYDNKLDVVQRALGLHTAISRVQGGKLKAKKEIRVA
FT                   SLFKDAAPEFLRMIVVHELAHLKESEHNKAFYQLCQYMLPDYHQLEFDLRVYLTWKSL"
FT   gene            618176..619330
FT                   /locus_tag="PA0561"
FT   CDS_pept        618176..619330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0561"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03950"
FT                   /db_xref="GOA:Q9I5X5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X5"
FT                   /protein_id="AAG03950.1"
FT                   /translation="MGSASQRSVQDLYEDVGDHYRIFIRAPFFQLLKHRDYWVPLLYFF
FT                   FVLITMFWDLYCHSGQYLYEARSLLPFYLFPFLIAALRIGDIVVDTRCRNVENLGGFER
FT                   SAESSRYVQLSLYERQWFRLRYRAYGGNLRCLAGDLVENWRLWKEVNSKAAKDIDGAVM
FT                   LRFFLPPRDLARLVTLLAALIAVIATLIITLGADRQGYFEFVDNLPAYLKLYWGVVFII
FT                   AFSGPYMIFLGMQARLVLRAMIDALSISQPSDKLFYQFIQRLIWADGVKPANPSANSRV
FT                   LRAVDSMVDFFYEEWRSAIGKLVLWLVALLALLLCTLLHCLLRVFCSARTLGEALMRIL
FT                   LAVLGSVCRIVAAIQRLNLAVPFHWTFFVLTGTGALFATLCGQP"
FT   gene            complement(619332..620006)
FT                   /locus_tag="PA0562"
FT   CDS_pept        complement(619332..620006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0562"
FT                   /product="probable hydrolase"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03951"
FT                   /db_xref="GOA:Q9I5X4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X4"
FT                   /protein_id="AAG03951.1"
FT                   /translation="MPHPIDALISDCDGVLVDSEVIAERVMYEALSAYAPLEELQRLLE
FT                   GTFGLTSRDILDRVEKHFGLRIPDSFNREVRQRSEEMVAQVQPIPGAREALLALDLPVA
FT                   VASNSRRHSLERSLARAGLSELIGERLASADMVALPKPAPDVYLHAASLLGVAPERCLV
FT                   VEDSSTGTRAALAAGMRVIGFVGAGHIPAGHAEVLRELGAIAIVEHMRELPETVARLRR
FT                   TV"
FT   gene            complement(620135..620488)
FT                   /locus_tag="PA0563"
FT   CDS_pept        complement(620135..620488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03952"
FT                   /db_xref="GOA:Q9I5X3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X3"
FT                   /protein_id="AAG03952.1"
FT                   /translation="MEWFLKCVKEHYFDFNGRARRKEYWMFTLVNIIISVALSVVLGLI
FT                   SEKLLPIANLYSLAVLLPALGVTARRLHDINKSGWWMLIALIPIVGLYLIYLLAKDSDA
FT                   GQNQYGQNPKGIA"
FT   gene            complement(620666..621577)
FT                   /locus_tag="PA0564"
FT   CDS_pept        complement(620666..621577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0564"
FT                   /product="probable transcriptional regulator"
FT                   /note="Product name confidence: Class 3 (Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited sequence similarity to an experimentally
FT                   studied gene)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03953"
FT                   /db_xref="GOA:Q9I5X2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X2"
FT                   /protein_id="AAG03953.1"
FT                   /translation="MDPLDRLIQLANLQGRLDQRCQLQGSWALEHPQAVPGEATFHIVM
FT                   AGTCYCEFLDGGRLDLHPGDLILLPRGTPHLLRSDSPAQPCEPTVEHRGSIPLYQLNGP
FT                   GEALDMLCGSYRYHAGASLFGALPERLLVHMDESTQQPLRALIGLMREEAESTRSGARS
FT                   IIDALATALFALALRAYLDRQPLGDGLFGLLGDARLGRALRAMLERPEHAWTLEQLAQQ
FT                   AAMSRASFVRAFSALGGTSPWNLLTRIRMEKARGLLRQTQKSLLDIAAETGYQSEAAFS
FT                   RNFRQAFGESPGRFRRQADSAR"
FT   gene            621695..622033
FT                   /locus_tag="PA0565"
FT   CDS_pept        621695..622033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03954"
FT                   /db_xref="GOA:Q9I5X1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X1"
FT                   /protein_id="AAG03954.1"
FT                   /translation="MLNNWTEFVPAVKKAFGALGKQHPKMLAAYGALEEASAEGALDAK
FT                   TRELISIAVAITTRCDGCIGVHTEAALKAGASEAEIAQTLATAISLNAGAAYVYSLRAL
FT                   EAYDQFKK"
FT   gene            complement(622023..622538)
FT                   /locus_tag="PA0566"
FT   CDS_pept        complement(622023..622538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0566"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03955"
FT                   /db_xref="GOA:Q9I5X0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5X0"
FT                   /protein_id="AAG03955.1"
FT                   /translation="MSDLPPRPAFWPYLPGYALLLLSVLLCASGSYRFVTPMALADGVD
FT                   LVYLSQGLALLPLGTGLVGLLAGFLLHVRGRWLGALLALLPAALICAWNLYNYAAHGDE
FT                   ALSPSFAQYTQALLGLLGLGGVLSLVDLLHGRPSTLLRKGLLGLGWLALVAWLGLLFYL
FT                   QRLYGLTF"
FT   gene            622726..622884
FT                   /locus_tag="PA0567"
FT   CDS_pept        622726..622884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03956"
FT                   /db_xref="GOA:Q9I5W9"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I5W9"
FT                   /protein_id="AAG03956.1"
FT                   /translation="MDLIRILIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHA
FT                   VYIIAKR"
FT   gene            complement(622894..623352)
FT                   /locus_tag="PA0568"
FT   CDS_pept        complement(622894..623352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0568"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03957"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5W8"
FT                   /protein_id="AAG03957.1"
FT                   /translation="MELIRNLDDANMGEVYWRLYRRYISLFIENEADDAYAWRCARALD
FT                   ELDDAVIERLCAASLRYRAARLERLGESAEEVAPARGVLERIEPGELIVPDPEQGDEAV
FT                   IHLSLNCEWDREHGMEWIVRGGEVLYVGPFHGEDPWRDFTVKEPWNYA"
FT   gene            complement(623368..623838)
FT                   /locus_tag="PA0569"
FT   CDS_pept        complement(623368..623838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0569"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03958"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5W7"
FT                   /protein_id="AAG03958.1"
FT                   /translation="MIPFGLSPEQFRERYRRDLQRAAPGVIQRLRELLRQPLEEGLRDG
FT                   EIQLFLGEDGRDAAEAWLYLNGASNRVDASDPRLFPGKALDLALGLGHAPDFDEAYFAD
FT                   GFGGVDLLADTLQAWFAECWWKAGGWAWPIPLWLHVHDGFGDGRGIALTERC"
FT   gene            complement(623852..624199)
FT                   /locus_tag="PA0570"
FT   CDS_pept        complement(623852..624199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0570"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03959"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5W6"
FT                   /protein_id="AAG03959.1"
FT                   /translation="MKPELDALEAWLGRPLPAAFVAALEQHGGRLVEPGLLLYAADELL
FT                   ERNRAFETSLYCPGYLAIGDDSGGRAVVMALDDHRQALFLVDHGAMTPDCFEPLAPSLE
FT                   AWLEAGPCLPE"
FT   gene            complement(624189..624803)
FT                   /locus_tag="PA0571"
FT   CDS_pept        complement(624189..624803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0571"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03960"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5W5"
FT                   /protein_id="AAG03960.1"
FT                   /translation="MTDRLPCRACGHLILPTTAARNDGLCMPCKGGYRQNIEDGKRFHA
FT                   ERRRYLASPQALYWSALVNRVYDGREGFAGLSPAERSYYAVSVLSGEVHNGGFDQYFGN
FT                   SSGDQYQAARAGLRELEAEDALALLERAAALLFGDGPVPVSQAERQLRMPTWADEPDRD
FT                   CEAALDALDTRFYALADALGERLLAHARHHALFALDEPDEA"
FT   gene            complement(624994..627765)
FT                   /locus_tag="PA0572"
FT   CDS_pept        complement(624994..627765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0572"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03961"
FT                   /db_xref="GOA:Q9I5W4"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR040711"
FT                   /db_xref="InterPro:IPR041549"
FT                   /db_xref="PDB:5KDV"
FT                   /db_xref="PDB:5KDW"
FT                   /db_xref="PDB:5KDX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I5W4"
FT                   /protein_id="AAG03961.1"
FT                   /translation="MSLSTTAFPSLQGENMSRSPIPRHRALLAGFCLAGALSAQAATQE
FT                   EILDAALVSGDSSQLTDSHLVALRLQQQVERIRQTRTQLLDGLYQNLSQAYDPGAASMW
FT                   VLPANPDNTLPFLIGDKGRVLASLSLEAGGRGLAYGTNVLTQLSGTNAAHAPLLKRAVQ
FT                   WLVNGDPGAATAKDFKVSVVGVDKTAALNGLKSAGLQPADAACNALTDASCASTSKLLV
FT                   LGNGASAASLSATVRARLQAGLPILFVHTNGWNQSSTGQQILAGLGLQEGPYGGNYWDK
FT                   DRVPSSRTRTRSVELGGAYGQDPALVQQIVDGSWRTDYDWSKCTSYVGRTTCDDVPGLS
FT                   DFSKRVDVLKGALDAYNQKAQNLFALPGTTSLRLWLLWADAVRQNIRYPMDKAADTARF
FT                   QETFVADAIVGYVREAGAAQKELGSYAGQRQQSMPVSGSEETLTLTLPSAQGFTAIGRM
FT                   AAPGKRLSIRIEDAGQASLAVGLNTQRIGSTRLWNTRQYDRPRFLKSPDIKLQANQSVA
FT                   LVSPYGGLLQLVYSGATPGQTVTVKVTGAASQPFLDIQPGEDSSQAIADFIQALDADKA
FT                   DWLEIRSGSVEVHAKVEKVRGSIDKDYGGDVQRFIRELNEVFIDDAYTLAGFAIPNQAK
FT                   TPAIQQECAARGWDCDSETLHKLPGTQHINVDQYAQCGGGCSGNPYDQTWGLNPRGWGE
FT                   SHELGHNLQVNRLKVYGGRSGEISNQIFPLHKDWRVLREFGQNLDDTRVNYRNAYNLIV
FT                   AGRAEADPLAGVYKRLWEDPGTYALNGERMAFYTQWVHYWADLKNDPLQGWDIWTLLYL
FT                   HQRQVDKSDWDANKAALGYGTYAQRPGNSGDASSTDGNDNLLLGLSWLTQRDQRPTFAL
FT                   WGIRTSAAAQAQVAAYGFAEQPAFFYANNRTNEYSTVKLLDMSQGSPAWPFP"
FT   gene            complement(628335..628670)
FT                   /locus_tag="PA0573"
FT   CDS_pept        complement(628335..628670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0573"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03962"
FT                   /db_xref="GOA:Q9I5W3"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5W3"
FT                   /protein_id="AAG03962.1"
FT                   /translation="MDYSPIVAQVWGMLTWFIPAALLIGLLKSPWAKGQIGELLVRLFA
FT                   HWQLDRHTYRRLHNVTLNTPDGTTQIDHVFLSPYGIFVLETAGFQHLPIGLYRCIGEPC
FT                   CRSQALA"
FT   gene            complement(628763..629884)
FT                   /locus_tag="PA0574"
FT   CDS_pept        complement(628763..629884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0574"
FT                   /product="hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03963"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5W2"
FT                   /protein_id="AAG03963.1"
FT                   /translation="MNDPLWIWQQPDWPQFNWQAEALAPLLRSCSQAQGRLLGMLGAVG
FT                   SDTEVQSSLDAMLQNIVTSSAIEGEQLNVGSVRSSLARRLGLHEEGRTTSRSEGLAELL
FT                   LDATHAHQEPLDEQRLFTWHRWLFPTDEQLLTRPLHIGALRGEEPMQVVSGRIDRPTVH
FT                   FEAPPRAGLEAQLADFLAWFESSRRDASLDPFLRAGIAHFWFVTLHPFDDGNGRLTRAI
FT                   TDLALAQGEQQAIRFYAMSASILDDRAGYYRILEASQKSTLDITNWLQWFLATLLNSLE
FT                   QALARIDRVLVKARFWQAHRSQTLSAEQVKVLNRLLDGGERGFEEGISAAQYQAVAKVS
FT                   KATATRHLSDLLEKGCIERLPGRGRSTRYQIAR"
FT   gene            complement(630434..630510)
FT                   /locus_tag="PA0574.1"
FT   tRNA            complement(630434..630510)
FT                   /locus_tag="PA0574.1"
FT                   /product="tRNA-Met"
FT   gene            complement(630527..634264)
FT                   /locus_tag="PA0575"
FT   CDS_pept        complement(630527..634264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03964"
FT                   /db_xref="GOA:Q9I5W1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="PDB:5M3C"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5W1"
FT                   /protein_id="AAG03964.1"
FT                   /translation="MQRLQAVLLLCLACCWPGLAGALTLTPEERAWLAEHPSIRLGMDT
FT                   SWPPFEYRDEQGRYQGLAAGYIGLLQERLSVSLTPVEPKTWTQVLEQAKDGRLDLLPGI
FT                   MATPERQEYLSFTRPYLDFPIIILARKNGPMPKRIDELYGLKVAVVDHYAPHELLIAQH
FT                   PDLTLLPLPSVAAALQALATGQADAFVGDFASSVWNLRQLKLNGLEISGETPYRYQLAM
FT                   AVPRGQPILAGIVDKVLADLSAGEIERLQAPWVGGLLDRRPAWREMATYGLPIVLLILV
FT                   SVAILLAMNRRLRREVSRRRQLERELRDSEQHYRGLVESLNAIAWEMRLEENRFTYVSP
FT                   HAERLLGYPLGEWLQPGFWQRTLHPMDAEYAIHYCMSESQAGRDHSFDYRMLAADGRVV
FT                   WIRDLVTPITQGRDLLLRGLMIDITEAKLTEQAMRLSEQKFASVFHHCPDMVVLANGAD
FT                   GRFLAVNSTFEQQIGIAADDAIGKTATELGIWALPGLGPQVLEKLGHGNLTNLEVPLRR
FT                   RNGSTFSALLSAQHVALDQTPALVVVIRDITHLVETQELLRISEEKFANAFHAYPDGLL
FT                   ISSLEDGTLIDVNEGFTRLTGYRRDEVISRSTLELGLWVDTEDRKRLISLVRHHTLTQG
FT                   FTAPVRDRNGGIRQCEMSAHRISIDGEDCVLTIARDITERQLMQEKLQQAATVFESTAE
FT                   GVMITDTRQRITAVNRAFSEITGYSEQEALGRSPSLLSSGQHDSSFYLAMWNQLERDGH
FT                   WQGEIWNRRKTGELYPEWLTISAVHNPQGEITHFVGVFADISTLKYAQARLDYQAHHDP
FT                   LTGLPNRLLFESRLNHALDEAREESRPGAVLFIDLDRFKHINDSLGHPIGDLLLKAIAE
FT                   RLRDQLRDVDTVARLGGDEFIILLPGLHQESDAEHVARKLLNAFTAPFQADGHEFFVSA
FT                   SVGIALFPKDGDDAPTLVKNADAAMYRAKSRGRSRIEYYTRELTYLATERMALETELRR
FT                   ALERDELQLYYQPKLSLESGLLVGAEALVRWYHPLFGEISPERFIPLAEDCGLILPLGD
FT                   WVLEHACQQMGEWQKLHAPFGPLSVNLAGAQLGQPQLIERLEQLLEQSGLEPSRLQLEI
FT                   TESFIMNQTEEALAVLHGLKRLGVQLAIDDFGTGYSSLSYLKRLPLDILKIDKSFIRGL
FT                   PDDPHDAAITRAIIALGRSMQLTVIAEGVETEGQQSFLTHEGCEQIQGFVLSPPLPAEL
FT                   FASKFLKPRQPIGAPREAPV"
FT   gene            complement(634371..636224)
FT                   /gene="rpoD"
FT                   /locus_tag="PA0576"
FT   CDS_pept        complement(634371..636224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="PA0576"
FT                   /product="sigma factor RpoD"
FT                   /note="Product name confidence: Class 1 (Function
FT                   experimentally demonstrated in P. aeruginosa)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03965"
FT                   /db_xref="GOA:P26480"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26480"
FT                   /protein_id="AAG03965.1"
FT                   /translation="MSGKAQQQSRLKELIARGREQGYLTYAEVNDHLPEDISDPEQVED
FT                   IIRMINDMGINVFETAPDADALLLAEADTDEAAAEEAAAALAAVESDIGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEEGIREVMSAIAQFPGTVDSILADYNRIVAEGGRLSDV
FT                   LSGYIDPDDGSLPAEEVEPVNLKDDSADSKEKDDEEEESDDSSDSDDEGDGGPDPEEAR
FT                   LRFTAVSEQLDKAKKALKKHGRGSKQATAELTGLAELFMPIKLVPKQFDALVARVRSAL
FT                   EGVRAQERAIMQLCVRDARMPRADFLRLFPNHETDEKWVDSVLKSKPKYAEAIERLRDD
FT                   ILRNQQKLAALESEVELTVAEIKEINRAMSIGEAKARRAKKEMVEANLRLVISIAKKYT
FT                   NRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPV
FT                   HMIETINKLNRISRQMLQEMGREPTPEELGERMDMPEDKIRKVLKIAKEPISMETPIGD
FT                   DEDSHLGDFIEDSTMQSPIEMATSESLKESTREVLAGLTAREAKVLRMRFGIDMNTDHT
FT                   LEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLDE"
FT   gene            complement(636304..638298)
FT                   /gene="dnaG"
FT                   /locus_tag="PA0577"
FT   CDS_pept        complement(636304..638298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="PA0577"
FT                   /product="DNA primase"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03966"
FT                   /db_xref="GOA:Q9I5W0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="PDB:5VAZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I5W0"
FT                   /protein_id="AAG03966.1"
FT                   /translation="MAGLIPQSFIDDLLNRTDIVEVVSSRIQLKKTGKNYSACCPFHKE
FT                   KTPSFTVSPDKQFYYCFGCGAGGNALGFVMDHDQLEFPQAVEELAKRAGMDVPREERGG
FT                   RGHTPRQPTDSPLYPLLSAAAEFYKQALKSHPARKAAVNYLKGRGLTGEIARDFGLGFA
FT                   PPGWDNLLKHLGGDNLQLKAMLDAGLLVENSDTGKRYDRFRDRVMFPIRDSRGRIIAFG
FT                   GRVLGDDKPKYLNSPETPVFHKGQELYGLYEARQKNRDLDEIMVVEGYMDVIALAQQGI
FT                   RNAVATLGTATSEEHIKRLFRLVPSILFCFDGDQAGRKAAWRALESVLPNLQDGKRVRF
FT                   LFLPEGEDPDSLVRAEGEDAFRARITQQAQPLAEYFFQQLMLEADPATLEGKAHLATLA
FT                   APLLEKIPGNNLRLLMRQRLSEITGLSGENIGQLAHHSPPPSSMDHGASGVLDGDDYFA
FT                   ASAYYENEPSHAPFDAAPGYVEAQPRKSWNKDKKPWDGKKWDGKKKWDKGGRGDFKAPQ
FT                   RTPVSVESTTLNALRTLLHHPQLALKVDDAGTLAREQDTYAQLLVSLLEALQKNPRQSS
FT                   MQLIARWHGTPQGRLLQALGEKEWLIVQENLEKQFFDTITKLSESQRFGEREERLRSVM
FT                   QKSYSELTDEEKALLREHYSVAASSPSQS"
FT   gene            complement(638381..638830)
FT                   /locus_tag="PA0578"
FT   CDS_pept        complement(638381..638830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="Product name confidence: Class 4 (Homologs of
FT                   previously reported genes of unknown function, or no
FT                   similarity to any previously reported sequences)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03967"
FT                   /db_xref="GOA:Q9I5V9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q9I5V9"
FT                   /protein_id="AAG03967.1"
FT                   /translation="MSEIKSRLLDAVKVAMRAQDKPRLTTLRLALADIKRVEVDERIEV
FT                   DDARALLILDRMIKQRRDAQRQFSDAGRQDLAEVEAAEILVLQDFMPKPLDDHEIDALI
FT                   ERSIVDSGAQGPQDMGKAMNLLRPQVQGRVDMAQVSQRLKARLSS"
FT   gene            complement(638900..639115)
FT                   /gene="rpsU"
FT                   /locus_tag="PA0579"
FT   CDS_pept        complement(638900..639115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="PA0579"
FT                   /product="30S ribosomal protein S21"
FT                   /note="Product name confidence: Class 2 (High similarity to
FT                   functionally studied protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PA0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAG03968"
FT                   /db_xref="GOA:Q9I5V8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9I5V8"
FT                   /protein_id="AAG03968.1"
FT                   /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAER
FT                   KRKAAAAVKRHAKKVQREQRRRERLY"
FT   gene            639316..640341
FT                   /gene="gcp"
FT                   /locus_tag="PA0580"
FT