(data stored in ACNUC17686 zone)

EMBL: AE004092

ID   AE004092; SV 2; circular; genomic DNA; STD; PRO; 1852433 BP.
XX
AC   AE004092; AE006472-AE006638;
XX
PR   Project:PRJNA269;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   02-APR-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Streptococcus pyogenes M1 GAS, complete genome.
XX
KW   .
XX
OS   Streptococcus pyogenes M1 GAS
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
OS   Streptococcus phage 370.1
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Streptococcus phage 370.2
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Streptococcus phage 370.3
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Streptococcus phage 370.4
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
RN   [1]
RP   1-1852433
RX   DOI; 10.1073/pnas.071559398.
RX   PUBMED; 11296296.
RA   Ferretti J.J., McShan W.M., Adjic D., Savic D., Savic G., Lyon K.,
RA   Primeaux C., Sezate S.S., Surorov A.N., Kenton S., Lai H., Lin S., Qian Y.,
RA   Jia H.G., Najar F.Z., Ren Q., Zhu H., Song L., White J., Yuan X.,
RA   Clifton S.W., Roe B.A., McLaughlin R.E.;
RT   "Complete genome sequence of an M1 strain of Streptococcus pyogenes";
RL   Proc. Natl. Acad. Sci. U.S.A. 98(8):4658-4663(2001).
XX
RN   [2]
RP   1-1852433
RX   DOI; 10.1073/pnas.1403138111.
RX   PUBMED; 24733896.
RA   Nasser W., Beres S.B., Olsen R.J., Dean M.A., Rice K.A., Long S.W.,
RA   Kristinsson K.G., Gottfredsson M., Vuopio J., Raisanen K., Cauget D.,
RA   Steinbakk M., Lowe D.E., McGeere A., Darenberg J., Henriques-Normark B.,
RA   van Benedeng C.A., Hoffmann S., Musser J.M.;
RT   "Evolutionary pathway to increased virulence and epidemic group A
RT   Streptococcus disease derived from 3,615 genome sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 111(17):E1768-E1776(2014).
XX
RN   [3]
RP   1-1852433
RA   Ferretti J.J., McShan W.M., Adjic D., Savic D., Savic G., Lyon K.,
RA   Primeaux C., Sezate S.S., Surorov A.N., Kenton S., Lai H., Lin S., Qian Y.,
RA   Jia H.G., Najar F.Z., Ren Q., Zhu H., Song L., White J., Yuan X.,
RA   Clifton S.W., Roe B.A., McLaughlin R.E.;
RT   ;
RL   Submitted (10-APR-2001) to the INSDC.
RL   Department of Microbiology and Immunology, University of Oklahoma Health
RL   Sciences Center, 940 SL Young Blvd, Oklahoma City, OK 73104, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-1852433
RA   Beres S.B., Musser J.M.;
RT   ;
RL   Submitted (01-APR-2014) to the INSDC.
RL   Center for Molecular and Translational Human Infectious Diseases Research,
RL   Department of Pathology and Genomic Medicine, Houston Methodist Research
RL   Institute, Houston, TX 77030, USA
XX
DR   MD5; 185d0044eeb2897085fe2bbaae6e5227.
DR   BioSample; SAMN02604089.
DR   EnsemblGenomes-Gn; SPy_r01.
DR   EnsemblGenomes-Gn; SPy_r02.
DR   EnsemblGenomes-Gn; SPy_r03.
DR   EnsemblGenomes-Gn; SPy_r04.
DR   EnsemblGenomes-Gn; SPy_r05.
DR   EnsemblGenomes-Gn; SPy_r06.
DR   EnsemblGenomes-Gn; SPy_r07.
DR   EnsemblGenomes-Gn; SPy_r08.
DR   EnsemblGenomes-Gn; SPy_r09.
DR   EnsemblGenomes-Gn; SPy_r10.
DR   EnsemblGenomes-Gn; SPy_r11.
DR   EnsemblGenomes-Gn; SPy_r12.
DR   EnsemblGenomes-Gn; SPy_s01.
DR   EnsemblGenomes-Gn; SPy_t01.
DR   EnsemblGenomes-Gn; SPy_t02.
DR   EnsemblGenomes-Gn; SPy_t03.
DR   EnsemblGenomes-Gn; SPy_t04.
DR   EnsemblGenomes-Gn; SPy_t05.
DR   EnsemblGenomes-Gn; SPy_t06.
DR   EnsemblGenomes-Gn; SPy_t07.
DR   EnsemblGenomes-Gn; SPy_t08.
DR   EnsemblGenomes-Gn; SPy_t09.
DR   EnsemblGenomes-Gn; SPy_t10.
DR   EnsemblGenomes-Gn; SPy_t11.
DR   EnsemblGenomes-Gn; SPy_t12.
DR   EnsemblGenomes-Gn; SPy_t13.
DR   EnsemblGenomes-Gn; SPy_t14.
DR   EnsemblGenomes-Gn; SPy_t15.
DR   EnsemblGenomes-Gn; SPy_t16.
DR   EnsemblGenomes-Gn; SPy_t17.
DR   EnsemblGenomes-Gn; SPy_t18.
DR   EnsemblGenomes-Gn; SPy_t19.
DR   EnsemblGenomes-Gn; SPy_t20.
DR   EnsemblGenomes-Gn; SPy_t21.
DR   EnsemblGenomes-Gn; SPy_t22.
DR   EnsemblGenomes-Gn; SPy_t23.
DR   EnsemblGenomes-Gn; SPy_t24.
DR   EnsemblGenomes-Gn; SPy_t25.
DR   EnsemblGenomes-Gn; SPy_t26.
DR   EnsemblGenomes-Gn; SPy_t27.
DR   EnsemblGenomes-Gn; SPy_t28.
DR   EnsemblGenomes-Gn; SPy_t29.
DR   EnsemblGenomes-Gn; SPy_t30.
DR   EnsemblGenomes-Gn; SPy_t31.
DR   EnsemblGenomes-Gn; SPy_t32.
DR   EnsemblGenomes-Gn; SPy_t33.
DR   EnsemblGenomes-Gn; SPy_t34.
DR   EnsemblGenomes-Gn; SPy_t35.
DR   EnsemblGenomes-Gn; SPy_t36.
DR   EnsemblGenomes-Gn; SPy_t37.
DR   EnsemblGenomes-Gn; SPy_t38.
DR   EnsemblGenomes-Gn; SPy_t39.
DR   EnsemblGenomes-Gn; SPy_t40.
DR   EnsemblGenomes-Gn; SPy_t41.
DR   EnsemblGenomes-Gn; SPy_t42.
DR   EnsemblGenomes-Gn; SPy_t43.
DR   EnsemblGenomes-Gn; SPy_t44.
DR   EnsemblGenomes-Gn; SPy_t45.
DR   EnsemblGenomes-Gn; SPy_t46.
DR   EnsemblGenomes-Gn; SPy_t47.
DR   EnsemblGenomes-Gn; SPy_t48.
DR   EnsemblGenomes-Gn; SPy_t49.
DR   EnsemblGenomes-Gn; SPy_t50.
DR   EnsemblGenomes-Gn; SPy_t51.
DR   EnsemblGenomes-Gn; SPy_t52.
DR   EnsemblGenomes-Gn; SPy_t53.
DR   EnsemblGenomes-Gn; SPy_t54.
DR   EnsemblGenomes-Gn; SPy_t55.
DR   EnsemblGenomes-Gn; SPy_t56.
DR   EnsemblGenomes-Gn; SPy_t57.
DR   EnsemblGenomes-Gn; SPy_t58.
DR   EnsemblGenomes-Gn; SPy_t59.
DR   EnsemblGenomes-Gn; SPy_t60.
DR   EnsemblGenomes-Tr; SPy_r01-1.
DR   EnsemblGenomes-Tr; SPy_r02-1.
DR   EnsemblGenomes-Tr; SPy_r03-1.
DR   EnsemblGenomes-Tr; SPy_r04-1.
DR   EnsemblGenomes-Tr; SPy_r05-1.
DR   EnsemblGenomes-Tr; SPy_r06-1.
DR   EnsemblGenomes-Tr; SPy_r07-1.
DR   EnsemblGenomes-Tr; SPy_r08-1.
DR   EnsemblGenomes-Tr; SPy_r09-1.
DR   EnsemblGenomes-Tr; SPy_r10-1.
DR   EnsemblGenomes-Tr; SPy_r11-1.
DR   EnsemblGenomes-Tr; SPy_r12-1.
DR   EnsemblGenomes-Tr; SPy_s01-1.
DR   EnsemblGenomes-Tr; SPy_t01-1.
DR   EnsemblGenomes-Tr; SPy_t02-1.
DR   EnsemblGenomes-Tr; SPy_t03-1.
DR   EnsemblGenomes-Tr; SPy_t04-1.
DR   EnsemblGenomes-Tr; SPy_t05-1.
DR   EnsemblGenomes-Tr; SPy_t06-1.
DR   EnsemblGenomes-Tr; SPy_t07-1.
DR   EnsemblGenomes-Tr; SPy_t08-1.
DR   EnsemblGenomes-Tr; SPy_t09-1.
DR   EnsemblGenomes-Tr; SPy_t10-1.
DR   EnsemblGenomes-Tr; SPy_t11-1.
DR   EnsemblGenomes-Tr; SPy_t12-1.
DR   EnsemblGenomes-Tr; SPy_t13-1.
DR   EnsemblGenomes-Tr; SPy_t14-1.
DR   EnsemblGenomes-Tr; SPy_t15-1.
DR   EnsemblGenomes-Tr; SPy_t16-1.
DR   EnsemblGenomes-Tr; SPy_t17-1.
DR   EnsemblGenomes-Tr; SPy_t18-1.
DR   EnsemblGenomes-Tr; SPy_t19-1.
DR   EnsemblGenomes-Tr; SPy_t20-1.
DR   EnsemblGenomes-Tr; SPy_t21-1.
DR   EnsemblGenomes-Tr; SPy_t22-1.
DR   EnsemblGenomes-Tr; SPy_t23-1.
DR   EnsemblGenomes-Tr; SPy_t24-1.
DR   EnsemblGenomes-Tr; SPy_t25-1.
DR   EnsemblGenomes-Tr; SPy_t26-1.
DR   EnsemblGenomes-Tr; SPy_t27-1.
DR   EnsemblGenomes-Tr; SPy_t28-1.
DR   EnsemblGenomes-Tr; SPy_t29-1.
DR   EnsemblGenomes-Tr; SPy_t30-1.
DR   EnsemblGenomes-Tr; SPy_t31-1.
DR   EnsemblGenomes-Tr; SPy_t32-1.
DR   EnsemblGenomes-Tr; SPy_t33-1.
DR   EnsemblGenomes-Tr; SPy_t34-1.
DR   EnsemblGenomes-Tr; SPy_t35-1.
DR   EnsemblGenomes-Tr; SPy_t36-1.
DR   EnsemblGenomes-Tr; SPy_t37-1.
DR   EnsemblGenomes-Tr; SPy_t38-1.
DR   EnsemblGenomes-Tr; SPy_t39-1.
DR   EnsemblGenomes-Tr; SPy_t40-1.
DR   EnsemblGenomes-Tr; SPy_t41-1.
DR   EnsemblGenomes-Tr; SPy_t42-1.
DR   EnsemblGenomes-Tr; SPy_t43-1.
DR   EnsemblGenomes-Tr; SPy_t44-1.
DR   EnsemblGenomes-Tr; SPy_t45-1.
DR   EnsemblGenomes-Tr; SPy_t46-1.
DR   EnsemblGenomes-Tr; SPy_t47-1.
DR   EnsemblGenomes-Tr; SPy_t48-1.
DR   EnsemblGenomes-Tr; SPy_t49-1.
DR   EnsemblGenomes-Tr; SPy_t50-1.
DR   EnsemblGenomes-Tr; SPy_t51-1.
DR   EnsemblGenomes-Tr; SPy_t52-1.
DR   EnsemblGenomes-Tr; SPy_t53-1.
DR   EnsemblGenomes-Tr; SPy_t54-1.
DR   EnsemblGenomes-Tr; SPy_t55-1.
DR   EnsemblGenomes-Tr; SPy_t56-1.
DR   EnsemblGenomes-Tr; SPy_t57-1.
DR   EnsemblGenomes-Tr; SPy_t58-1.
DR   EnsemblGenomes-Tr; SPy_t59-1.
DR   EnsemblGenomes-Tr; SPy_t60-1.
DR   EuropePMC; PMC1142405; 15933207.
DR   EuropePMC; PMC1230926; 16177372.
DR   EuropePMC; PMC123705; 11917108.
DR   EuropePMC; PMC1253647; 16223875.
DR   EuropePMC; PMC126685; 11823238.
DR   EuropePMC; PMC127702; 11796638.
DR   EuropePMC; PMC127806; 11854196.
DR   EuropePMC; PMC1392966; 16461700.
DR   EuropePMC; PMC1459018; 16636287.
DR   EuropePMC; PMC149598; 12517855.
DR   EuropePMC; PMC162022; 12819057.
DR   EuropePMC; PMC1636624; 17066081.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC1913099; 17616984.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2583620; 18820018.
DR   EuropePMC; PMC2654543; 19325880.
DR   EuropePMC; PMC2668326; 19193846.
DR   EuropePMC; PMC2786636; 19846638.
DR   EuropePMC; PMC2848555; 20368967.
DR   EuropePMC; PMC2863574; 20233933.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC303441; 14679231.
DR   EuropePMC; PMC308880; 14638753.
DR   EuropePMC; PMC309049; 14665680.
DR   EuropePMC; PMC31890; 11296296.
DR   EuropePMC; PMC3411356; 21115137.
DR   EuropePMC; PMC343989; 14688086.
DR   EuropePMC; PMC356025; 14977969.
DR   EuropePMC; PMC3668253; 23506117.
DR   EuropePMC; PMC3716101; 23515542.
DR   EuropePMC; PMC3911122; 24142257.
DR   EuropePMC; PMC4035937; 24733896.
DR   EuropePMC; PMC403657; 12799345.
DR   EuropePMC; PMC420483; 15128458.
DR   EuropePMC; PMC4400423; 25883280.
DR   EuropePMC; PMC4502508; 26174161.
DR   EuropePMC; PMC4710455; 26756207.
DR   EuropePMC; PMC4845074; 27158513.
DR   EuropePMC; PMC5069739; 27822519.
DR   EuropePMC; PMC532412; 15576803.
DR   EuropePMC; PMC5374712; 28361960.
DR   EuropePMC; PMC5660057; 29109702.
DR   EuropePMC; PMC5876283; 29628918.
DR   EuropePMC; PMC6189468; 30356787.
DR   EuropePMC; PMC6342470; 30632480.
DR   EuropePMC; PMC6374595; 30760615.
DR   EuropePMC; PMC95584; 11717294.
DR   GOA; P68999.
DR   GOA; Q48WA5.
DR   GOA; Q490D8.
DR   InterPro; IPR001705; Ribosomal_L33.
DR   InterPro; IPR011332; Ribosomal_zn-bd.
DR   InterPro; IPR028883; tRNA_aden_deaminase.
DR   InterPro; IPR038584; L33_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02099; rivX.
DR   SILVA-LSU; AE004092.
DR   SILVA-SSU; AE004092.
DR   StrainInfo; 117801; 0.
DR   UniProtKB/Swiss-Prot; P68999; TADA_STRP1.
DR   UniProtKB/Swiss-Prot; Q48WA5; RL332_STRP1.
DR   UniProtKB/Swiss-Prot; Q490D8; RL331_STRP1.
XX
CC   On Apr 1, 2014 this sequence version replaced gi:14286347.
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..529586,570505..778519,821005..1189119,
FT                   1222650..1773338,1786889..1852433)
FT                   /organism="Streptococcus pyogenes M1 GAS"
FT                   /focus
FT                   /strain="SF370"
FT                   /serotype="M1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:160490"
FT   source          529587..570504
FT                   /organism="Streptococcus phage 370.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:430512"
FT   source          778520..821004
FT                   /organism="Streptococcus phage 370.2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:430514"
FT   source          1189120..1222649
FT                   /organism="Streptococcus phage 370.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:430513"
FT   source          1773339..1786888
FT                   /organism="Streptococcus phage 370.4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:430515"
FT   gene            232..1587
FT                   /gene="dnaA"
FT                   /locus_tag="SPy_0002"
FT                   /old_locus_tag="SPy0002"
FT   CDS_pept        232..1587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SPy_0002"
FT                   /old_locus_tag="SPy0002"
FT                   /product="Chromosomal initiator protein"
FT                   /note="Best Blastp hit = gb|AAF71535.1|AF255728_1
FT                   (AF255728) chromosomal initiator protein DnaA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33146"
FT                   /db_xref="GOA:P0A3A4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3A4"
FT                   /protein_id="AAK33146.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLLKVDKHIATIY
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNS
FT                   LPTVTSDLNSKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNSVLLENPNARIKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD
FT                   IAAEAIRARKQDGPKMTVIPIEEIQAQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNKIK"
FT   gene            1742..2878
FT                   /gene="dnaN"
FT                   /locus_tag="SPy_0003"
FT                   /old_locus_tag="SPy0003"
FT   CDS_pept        1742..2878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SPy_0003"
FT                   /old_locus_tag="SPy0003"
FT                   /product="beta subunit of DNA polymerase III"
FT                   /EC_number="2.7.7.7"
FT                   /note="Best Blastp hit = sp|O06672|DP3B_STRPN DNA
FT                   POLYMERASE III, BETA CHAIN >gi|2109446|gb|AAC45337.1|
FT                   (AF000658) beta subunit of DNA polymerase III
FT                   [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33147"
FT                   /db_xref="GOA:Q9A209"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A209"
FT                   /protein_id="AAK33147.1"
FT                   /translation="MIQFSINRTLFIHALNTTKRAISTKNAIPILSSIKIEVTSTGVTL
FT                   TGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILT
FT                   GVHIVLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETV
FT                   EVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKA
FT                   IKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVRTN"
FT   gene            2953..3150
FT                   /locus_tag="SPy_0004"
FT                   /old_locus_tag="SPy0004"
FT   CDS_pept        2953..3150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0004"
FT                   /old_locus_tag="SPy0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC45338.1| (AF000658) ORFX
FT                   [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33148"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A208"
FT                   /protein_id="AAK33148.1"
FT                   /translation="MYQIGSFVEMKKPHACVIKETGKKANQWKVLRVGADIKIQCTNCQ
FT                   HVIMMSRYDFERKLKKVLQP"
FT   gene            3480..4595
FT                   /locus_tag="SPy_0006"
FT                   /old_locus_tag="SPy0006"
FT   CDS_pept        3480..4595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0006"
FT                   /old_locus_tag="SPy0006"
FT                   /product="putative GTP-binding protein"
FT                   /note="Best Blastp hit = dbj|BAB07770.1| (AP001520)
FT                   GTP-binding protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33149"
FT                   /db_xref="GOA:Q9A207"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A207"
FT                   /protein_id="AAK33149.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREIDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTEDEAKVVKGLFLLTTKPVLYVANVDEDKVANPD
FT                   GIDYVKQIRDFAATENAEVVVISARAEEEISELDDEDKEEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLMTYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   gene            4665..5234
FT                   /gene="pth"
FT                   /locus_tag="SPy_0007"
FT                   /old_locus_tag="SPy0007"
FT   CDS_pept        4665..5234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SPy_0007"
FT                   /old_locus_tag="SPy0007"
FT                   /product="putative peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="Best Blastp hit = dbj|BAB03787.1| (AP001507) stage V
FT                   sporulation protein C (peptidyl-tRNA hydrolase) [Bacillus
FT                   halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33150"
FT                   /db_xref="GOA:Q9A206"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A206"
FT                   /protein_id="AAK33150.1"
FT                   /translation="MVKMIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFK
FT                   AQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRL
FT                   RSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLT
FT                   LDRVVNAVKFYLQENDFEKTMQKFNG"
FT   gene            5237..8740
FT                   /gene="trcF"
FT                   /locus_tag="SPy_0008"
FT                   /old_locus_tag="SPy0008"
FT   CDS_pept        5237..8740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="SPy_0008"
FT                   /old_locus_tag="SPy0008"
FT                   /product="putative transcription-repair coupling factor"
FT                   /note="Best Blastp hit = gb|AAD03810.1| (AF054624)
FT                   transcription-repair coupling factor [Lactobacillus sakei]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33151"
FT                   /db_xref="GOA:Q9A205"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A205"
FT                   /protein_id="AAK33151.1"
FT                   /translation="MDILELFSQNKKVQSWHSGLTTLGRQLVMGLSGSSKTLAIASAYL
FT                   DDQKKIVVVTSTQNEVEKLASDLSSLLDEELVFQFFADDVAAAEFIFASMDKALSRIET
FT                   LQFLRNPKSQGVLIVSLSGLRILLPNPDVFTKSQIQLTVGEDYDSDTLTKQLMTIGYQK
FT                   VSQVISPGEFSRRGDILDIYEITQELPYRLEFFGDDIDSIRQFHPETQKSFEQLEGIFI
FT                   NPASDLIFEVSDFQRGIEQLEKALQTAQDDKKSYLEDVLAVSKNGFKHKDIRKFQSLFY
FT                   EKEWSLLDYIPKGTPIFFDDFQKLVDKNARFDLEIANLLTEDLQQGKALSNLNYFTDNY
FT                   RELRHYKPATFFSNFHKGLGNIKFDQMHQLTQYAMQEFFNQFPLLIDEIKRYQKNQTTV
FT                   IVQVESQYAYERLEKSFQDYQFRLPLVSANQIVSRESQIVIGAISSGFYFADEKLALIT
FT                   EHEIYHKKIKRRARRSNISNAERLKDYNELAVGDYVVHNVHGIGRFLGIETIQIQGIHR
FT                   DYVTIQYQNSDRISLPIDQISSLSKYVSADGKEPKINKLNDGRFQKTKQKVARQVEDIA
FT                   DDLLKLYAERSQQKGFSFSPDDDLQRAFDDDFAFVETEDQLRSIKEIKADMESMQPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVAVLVPTTVLAQQHYENFKARFENYPVEVDVL
FT                   SRFRSKKEQAETLERVRKGQIDIIIGTHRLLSKDVVFSDLGLIVIDEEQRFGVKHKETL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLENNPGLVREA
FT                   IIREMDRGGQIFYVYNKVDTIEKKVAELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KVLTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEQAIASKQGKTTVRQKGNTEINLQIDAYLPDDYIADERQKIDIYKRIREIQSREDYLN
FT                   LQDELMDRFGEYPDQVAYLLEIALLKHYMDNAFAELVERKNNQVIVRFEVTSLTYFLTQ
FT                   DYFEALSKTHLKAKISEHQGKIDIVFDVRHQKDYRILEELMLFGERLSEIKIRKNNSVF
FT                   K"
FT   gene            8878..9174
FT                   /locus_tag="SPy_0009"
FT                   /old_locus_tag="SPy0009"
FT   CDS_pept        8878..9174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0009"
FT                   /old_locus_tag="SPy0009"
FT                   /product="conserved hypothetical proteins"
FT                   /note="Best Blastp hit = sp|P37557|YABO_BACSU HYPOTHETICAL
FT                   9.7 KDA PROTEIN IN MFD-DIVIC INTERGENIC REGION
FT                   >gi|2127042|pir||S66089 conserved hypothetical protein yabO
FT                   - Bacillus subtilis >gi|467448|dbj|BAA05294.1| (D26185)
FT                   unknown [Bacillus subtilis] >gi|2632326|emb|CAB11835.1|
FT                   (Z99104) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33152"
FT                   /db_xref="GOA:Q9A204"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A204"
FT                   /protein_id="AAK33152.1"
FT                   /translation="MKRIVGEIMRLDKYLKVSRLIKRRSVAKEVADKGRIKVNGILAKS
FT                   STNIKLNDHIEISFGNKLLTVRVIEIKDSTKKEDALKMYEIISETRITLNEEA"
FT   gene            9161..9532
FT                   /gene="divIC"
FT                   /locus_tag="SPy_0010"
FT                   /old_locus_tag="SPy0010"
FT   CDS_pept        9161..9532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="SPy_0010"
FT                   /old_locus_tag="SPy0010"
FT                   /product="putative cell division protein (DivIC)"
FT                   /note="Best Blastp hit = gb|AAC98903.1| (AF023181) DivIC
FT                   homolog [Listeria monocytogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33153"
FT                   /db_xref="GOA:Q9A203"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A203"
FT                   /protein_id="AAK33153.1"
FT                   /translation="MKKPSIVQLNNHYIKKENLKKKFEEEESQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKSYVDFEKQNQQVVKLKKEYNELSESTKKEKQLAERLKDDNFVKKYARAK
FT                   YYLSREGEMIYPIPGLLPK"
FT   gene            9667..10953
FT                   /locus_tag="SPy_0012"
FT                   /old_locus_tag="SPy0012"
FT   CDS_pept        9667..10953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0012"
FT                   /old_locus_tag="SPy0012"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gi|4758794 nebulin [Homo sapiens]
FT                   >gi|1082786|pir||S55024 nebulin, skeletal muscle - human
FT                   >gi|806562|emb|CAA58788.1| (X83957) nebulin [Homo sapiens]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33154"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A202"
FT                   /protein_id="AAK33154.1"
FT                   /translation="MRKLLAAMLMTFFLTPLPVISTEKKLIFSKNAVYQLKQDVVQSTQ
FT                   FYNQIPSNPNLYQETCAYKDSDLTLPAGRLGVNQPLLIKSLVLNKESLPVFELADGTYV
FT                   EANRQLIYDDIVLNQVDIDSYFWTQKKLRLYSAPYVLGTQTIPSSFLFAQKVHATQMAQ
FT                   TNHGTYYLIDDKGWASQEDLVQFDNRMLKVQEMLLQKYNNPNYSIFVKQLNTQTSAGIN
FT                   ADKKMYAASISKLAPLYIVQKQLQKKKLAENKTLTYTKDVNHFYGDYDPLGSGKISKIA
FT                   DNKDYRVEDLLKAVAQQSDNVATNILGYYLCHQYDKAFRSEIKALSGIDWDMEQRLLTS
FT                   RSAANMMEAIYHQKGQIISYLSNTEFDQQRITKNITVPVAHKIGDAYDYKHDVAIVYGN
FT                   TPFILSIFTNKSTYEDITAIADDVYGILK"
FT   gene            10950..12236
FT                   /locus_tag="SPy_0013"
FT                   /old_locus_tag="SPy0013"
FT   CDS_pept        10950..12236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0013"
FT                   /old_locus_tag="SPy0013"
FT                   /product="putative cell-cycle protein"
FT                   /note="Best Blastp hit = pir||S66097 cell-cycle protein
FT                   homolog yacA - Bacillus subtilis >gi|467456|dbj|BAA05302.1|
FT                   (D26185) unknown [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33155"
FT                   /db_xref="GOA:Q9A201"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A201"
FT                   /protein_id="AAK33155.1"
FT                   /translation="MMTYQEIFNEIKNKAYFKNHRHVLIAVSGGVDSMNLLHFLYLFQD
FT                   KLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNFEGIFSEKAARDWRYAFF
FT                   KSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTF
FT                   SKKDLPEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAF
FT                   KELTNHITTTDLTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYY
FT                   YLKKDYYIFIDKFSFKITKIVPKTELVKEEKMLEYDSNLCYRDYYFSFMPKSNEDQGQV
FT                   SIPLFSLSSIKLRSRQSGDYISFGHFSKKIRRLFIDEKFTIAERQNAIIGEQDEQIIFV
FT                   LIGNKTYLRKACKHDIMLAKLYIDKLEKG"
FT   gene            12805..14784
FT                   /gene="ftsH"
FT                   /locus_tag="SPy_0015"
FT                   /old_locus_tag="SPy0015"
FT   CDS_pept        12805..14784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SPy_0015"
FT                   /old_locus_tag="SPy0015"
FT                   /product="putative cell division protein"
FT                   /note="Best Blastp hit = gb|AAC16243.2| (AF061748) cell
FT                   division protein FtsH [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33156"
FT                   /db_xref="GOA:Q9A200"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A200"
FT                   /protein_id="AAK33156.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIIVVITGFQFYLKGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIIEVKGKYEKPQKVTVNSGLSFLGGRASTQVTEFSSLVL
FT                   PSDTILKEMTAAADKNGTELTVKQESSSGTWITFLMSFLPIVIFAAFMMMMMNQGGGGA
FT                   RGAMSFGKNKAKSQSKGNVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKSLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERA
FT                   IIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNENIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILRVHAKNKPLANDVNLKVVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKIKIDASDIDEAEDRVIAGPSKKDRTISQKEREMVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDLKEQLAGLMGGRVAEEIVFNA
FT                   QTSGASNDFEQATQIARAMVTEYGMSEKLGPVQYEGNHAMMPGQISPEKAYSAQTAQMI
FT                   DDEVRELLNQARNQAADIINENRDTHKLIAEALLKYETLDAAQIKSIYETGKMPVDLET
FT                   DDNEAHALSYDEIKNKMTESESAE"
FT   gene            15109..16500
FT                   /locus_tag="SPy_0016"
FT                   /old_locus_tag="SPy0016"
FT   CDS_pept        15109..16500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0016"
FT                   /old_locus_tag="SPy0016"
FT                   /product="putative amino acid permease"
FT                   /note="Best Blastp hit = pir||D69814 metabolite transporter
FT                   homolog yfnA - Bacillus subtilis
FT                   >gi|2633047|emb|CAB12553.1| (Z99107) similar to metabolite
FT                   transporter [Bacillus subtilis] >gi|2633058|emb|CAB12563.1|
FT                   (Z99108) similar to metabolite transporter [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33157"
FT                   /db_xref="GOA:Q9A1Z9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Z9"
FT                   /protein_id="AAK33157.1"
FT                   /translation="MTIFRKKKKYSNKTEMQRHFKVIDLVFLGLGSMVGTGIFTVTGIG
FT                   AAKYAGPALTISIIISAIAIGILALFYAEFASRMPSNGGAYSYVYATLGEFPAWLVGWY
FT                   IIMEFLTAISSVAVGWGSYLKGLLANYNIVLPNALNGTFNLKNGTYIDILPVLVMFFVT
FT                   GIVLMNSKLALRFNSFLVILKFSALALFIFVGIFFIDHNNWSHFAPYGVGQITGGKTGI
FT                   FAGASVMFFAFLGFESISMAVDEVKEPQKTIPKGIILSLIIVTALYIVVTTILTGIVHY
FT                   TKLNVPDAVAFALRNIRLYWAADYVSIVAILTLITVCISMTYALARTIYSISRDGLLPK
FT                   SLYTLTKKNKVPQNATLVTGLLAMICAGIFPLSSLAEFVNICTLAYLIILSGAIIKLRR
FT                   IEGEPKANEFKTPLVPFLPMLAIIICLSFMSQYKAFTWIAFAIATIIGTLIYLAYGYTH
FT                   SIENK"
FT   gene            17169..18503
FT                   /locus_tag="SPy_r01"
FT   rRNA            17169..18503
FT                   /locus_tag="SPy_r01"
FT                   /product="16S ribosomal RNA"
FT   gene            18665..18740
FT                   /locus_tag="SPy_t01"
FT   tRNA            18665..18740
FT                   /locus_tag="SPy_t01"
FT                   /product="tRNA-Ala"
FT   gene            19036..21936
FT                   /locus_tag="SPy_r02"
FT   rRNA            19036..21936
FT                   /locus_tag="SPy_r02"
FT                   /product="23S ribosomal RNA"
FT   gene            22157..22229
FT                   /locus_tag="SPy_t02"
FT   tRNA            22157..22229
FT                   /locus_tag="SPy_t02"
FT                   /product="tRNA-Val"
FT   gene            22247..22319
FT                   /locus_tag="SPy_t03"
FT   tRNA            22247..22319
FT                   /locus_tag="SPy_t03"
FT                   /product="tRNA-Asp"
FT   gene            22351..22423
FT                   /locus_tag="SPy_t04"
FT   tRNA            22351..22423
FT                   /locus_tag="SPy_t04"
FT                   /product="tRNA-Lys"
FT   gene            22429..22510
FT                   /locus_tag="SPy_t05"
FT   tRNA            22429..22510
FT                   /locus_tag="SPy_t05"
FT                   /product="tRNA-Leu"
FT   gene            22521..22593
FT                   /locus_tag="SPy_t06"
FT   tRNA            22521..22593
FT                   /locus_tag="SPy_t06"
FT                   /product="tRNA-Thr"
FT   gene            22606..22677
FT                   /locus_tag="SPy_t07"
FT   tRNA            22606..22677
FT                   /locus_tag="SPy_t07"
FT                   /product="tRNA-Gly"
FT   gene            22686..22770
FT                   /locus_tag="SPy_t08"
FT   tRNA            22686..22770
FT                   /locus_tag="SPy_t08"
FT                   /product="tRNA-Leu"
FT   gene            22787..22863
FT                   /locus_tag="SPy_t09"
FT   tRNA            22787..22863
FT                   /locus_tag="SPy_t09"
FT                   /product="tRNA-Arg"
FT   gene            22867..22940
FT                   /locus_tag="SPy_t10"
FT   tRNA            22867..22940
FT                   /locus_tag="SPy_t10"
FT                   /product="tRNA-Pro"
FT   gene            23170..24504
FT                   /locus_tag="SPy_r03"
FT   rRNA            23170..24504
FT                   /locus_tag="SPy_r03"
FT                   /product="16S ribosomal RNA"
FT   gene            24666..24741
FT                   /locus_tag="SPy_t11"
FT   tRNA            24666..24741
FT                   /locus_tag="SPy_t11"
FT                   /product="tRNA-Ala"
FT   gene            25037..27937
FT                   /locus_tag="SPy_r04"
FT   rRNA            25037..27937
FT                   /locus_tag="SPy_r04"
FT                   /product="23S ribosomal RNA"
FT   gene            28158..28230
FT                   /locus_tag="SPy_t12"
FT   tRNA            28158..28230
FT                   /locus_tag="SPy_t12"
FT                   /product="tRNA-Val"
FT   gene            28236..28306
FT                   /locus_tag="SPy_t13"
FT   tRNA            28236..28306
FT                   /locus_tag="SPy_t13"
FT                   /product="tRNA-Gly"
FT   gene            28341..28414
FT                   /locus_tag="SPy_t14"
FT   tRNA            28341..28414
FT                   /locus_tag="SPy_t14"
FT                   /product="tRNA-Ile"
FT   gene            28437..28508
FT                   /locus_tag="SPy_t15"
FT   tRNA            28437..28508
FT                   /locus_tag="SPy_t15"
FT                   /product="tRNA-Glu"
FT   gene            28518..28606
FT                   /locus_tag="SPy_t16"
FT   tRNA            28518..28606
FT                   /locus_tag="SPy_t16"
FT                   /product="tRNA-Ser"
FT   gene            28617..28690
FT                   /locus_tag="SPy_t17"
FT   tRNA            28617..28690
FT                   /locus_tag="SPy_t17"
FT                   /product="tRNA-Met"
FT   gene            28711..28783
FT                   /locus_tag="SPy_t18"
FT   tRNA            28711..28783
FT                   /locus_tag="SPy_t18"
FT                   /product="tRNA-Phe"
FT   gene            28796..28866
FT                   /locus_tag="SPy_t19"
FT   tRNA            28796..28866
FT                   /locus_tag="SPy_t19"
FT                   /product="tRNA-Gly"
FT   gene            28901..28974
FT                   /locus_tag="SPy_t20"
FT   tRNA            28901..28974
FT                   /locus_tag="SPy_t20"
FT                   /product="tRNA-Ile"
FT   gene            28984..29071
FT                   /locus_tag="SPy_t21"
FT   tRNA            28984..29071
FT                   /locus_tag="SPy_t21"
FT                   /product="tRNA-Ser"
FT   gene            30545..31741
FT                   /locus_tag="SPy_0019"
FT                   /old_locus_tag="SPy0019"
FT   CDS_pept        30545..31741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0019"
FT                   /old_locus_tag="SPy0019"
FT                   /product="putative secreted protein"
FT                   /note="Best Blastp hit = gb|AAD00288.1| (U78607) putative
FT                   secreted protein [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33158"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Z8"
FT                   /protein_id="AAK33158.1"
FT                   /translation="MKKRILSAVLVSGVTLGAATTVGAEDLSTKIAKQDSIISNLTTEQ
FT                   KAAQNQVSALQAQVSSLQSEQDKLTARNTELEALSKRFEQEIKALTSQIVARNEKLKNQ
FT                   ARSAYKNNETSGYINALLNSKSISDVVNRLVAINRAVSANAKLLEQQKADKVSLEEKQA
FT                   ANQTAINTIAANMAMAEENQNTLRTQQANLVAATANLALQLASATEDKANLVAQKEAAE
FT                   KAAAEALAQEQAAKVKAQEQAAQQAASVEAAKSAITPAPQATPAAQSSNAIEPAALTAP
FT                   AAPSAGPQTSYDSSNTYPVGQCTWGAKSLAPWAGNNWGNGGQWAYSAQAAGYRTGSTPM
FT                   VGAIAVWNDGGYGHVAVVVEVQSASSIRVMESNYSGRQYIADHRGWFNPTGVTFIYPH"
FT   gene            31994..32956
FT                   /gene="prsA.2"
FT                   /locus_tag="SPy_0020"
FT                   /old_locus_tag="SPy0020"
FT   CDS_pept        31994..32956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA.2"
FT                   /locus_tag="SPy_0020"
FT                   /old_locus_tag="SPy0020"
FT                   /product="putative ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="Best Blastp hit = gb|AAA62181.1| (M92842) prs
FT                   [Listeria monocytogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33159"
FT                   /db_xref="GOA:P65243"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65243"
FT                   /protein_id="AAK33159.1"
FT                   /translation="MSYSDLKLFALSSNKELAEKVASAMGIQLGKSTVRQFSDGEIQVN
FT                   IEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQDRKAR
FT                   SREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRHGLV
FT                   GEDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGNVSGKKCIL
FT                   IDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQRSAIEKLIVLDTIYL
FT                   PKERLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGN"
FT   gene            33142..33897
FT                   /locus_tag="SPy_0021"
FT                   /old_locus_tag="SPy0021"
FT   CDS_pept        33142..33897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0021"
FT                   /old_locus_tag="SPy0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB05088.1| (AP001511) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33160"
FT                   /db_xref="GOA:P65987"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65987"
FT                   /protein_id="AAK33160.1"
FT                   /translation="MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISRSKM
FT                   SSIIQPLTIADFIFKLNDTGLSYVVDYSNVNTYRYINNDIFRLAYASYVLALADAAIAD
FT                   NESDSHLFTFLKKTLDLMEEGLDYEILTNIFEIQILDRFGISLNFHECAICHRTDLPLD
FT                   FSHRFSAVLCSEHYYKDNRRNHLDPNVIYLLSRFQKITFDDLRTISLNKDIKKKLRQFI
FT                   DELYHDYVGIKLKSKTFIDNLVKWGDIMK"
FT   gene            34000..35007
FT                   /gene="plsX"
FT                   /locus_tag="SPy_0022"
FT                   /old_locus_tag="SPy0022"
FT   CDS_pept        34000..35007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SPy_0022"
FT                   /old_locus_tag="SPy0022"
FT                   /product="putative fatty acid/phospholipid synthesis
FT                   protein"
FT                   /note="Best Blastp hit = sp|P71018|PLSX_BACSU FATTY
FT                   ACID/PHOSPHOLIPID SYNTHESIS PROTEIN PLSX
FT                   >gi|7441727|pir||H69679 involved in fatty acid/phospholipid
FT                   synthesis plsX - Bacillus subtilis
FT                   >gi|2337818|emb|CAA74248.1| (Y13937) putative PlsX protein
FT                   [Bacillus subtilis] >gi|2633961|emb|CAB13462.1| (Z99112)
FT                   alternate gene name: ylpD [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33161"
FT                   /db_xref="GOA:P65742"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65742"
FT                   /protein_id="AAK33161.1"
FT                   /translation="MKRIAIDAMGGDNAPKAIVEGVNQAIEAFSDIEIQLYGDQTKINS
FT                   YLIQSDRVAIIHTDEKIMSDDEPAKAVRRKKKASMVLAAKAVKEGKADAIISAGNTGAL
FT                   LAVGLFVVGRIKGVDRPGLLSTIPTVTGLGFDMLDLGANAENTAKHLHQYAILGSFYAK
FT                   NVRGIANPRVGLLNNGTEETKGDPLRKATYELLTADNTISFVGNVEARELMSGVADVIV
FT                   SDGFTGNAVLKSIEGTAISIMGQLKQIINSGGIKTKIGASLLKSSLYEMKKTLDYSSAG
FT                   GAVLFGLKAPVVKSHGSSDVKAIFSTIKQVRTMLDTNVVGQLVEEFAKETQVND"
FT   gene            35000..35242
FT                   /gene="acpP.2"
FT                   /locus_tag="SPy_0023"
FT                   /old_locus_tag="SPy0023"
FT   CDS_pept        35000..35242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP.2"
FT                   /locus_tag="SPy_0023"
FT                   /old_locus_tag="SPy0023"
FT                   /product="putative acyl carrier protein"
FT                   /note="Best Blastp hit = gb|AAG22707.1| (AF276618) acyl
FT                   carrier protein; AcpP; ACP [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33162"
FT                   /db_xref="GOA:Q9A1Z4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Z4"
FT                   /protein_id="AAK33162.1"
FT                   /translation="MTRQEIFERLINLIQKQRSYLSVAITEQTHLKNDLAVDSIELVEF
FT                   IINVEDEFHIAIPDEDVEDMVFMRDILDYLVQRLT"
FT   gene            35363..36097
FT                   /gene="purC"
FT                   /locus_tag="SPy_0024"
FT                   /old_locus_tag="SPy0024"
FT   CDS_pept        35363..36097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SPy_0024"
FT                   /old_locus_tag="SPy0024"
FT                   /product="putative
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   (SAICAR synthetase)"
FT                   /EC_number="6.3.2.6"
FT                   /note="Best Blastp hit = sp|Q07296|PUR7_STRPN
FT                   PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
FT                   (SAICAR SYNTHETASE) >gi|625868|pir||A36941
FT                   phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC
FT                   6.3.2.6) - Streptococcus pneumoniae
FT                   >gi|295192|gb|AAA03540.1| (L15190) SAICAR synthetase
FT                   [Streptococcus pneumoniae] >gi|663281|gb|AAA69512.1|
FT                   (M36180) SAICAR synthetase [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33163"
FT                   /db_xref="GOA:Q9A1Z3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1Z3"
FT                   /protein_id="AAK33163.1"
FT                   /translation="MKTERKANNQVTNQLIYKGKAKDIYSTKDENVIRTVYKDQATMLN
FT                   GARKETIDGKGALNNQISSLIFEKLNKAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRN
FT                   VTAGSFSKRFGVEEGHVLETPIVEFYYKNDDLDDPFINDEHVKFLGIVNDEEIAYLKGE
FT                   TRRINELLKGWFAQIGLNLIDFKLEFGFDQEGTIILADEFSPDNCRLWDKNGNHMDKDV
FT                   FRRDLGNLTDVYQVVLEKLIAL"
FT   gene            36173..39946
FT                   /locus_tag="SPy_0025"
FT                   /old_locus_tag="SPy0025"
FT   CDS_pept        36173..39946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0025"
FT                   /old_locus_tag="SPy0025"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase II"
FT                   /note="Best Blastp hit = emb|CAC12194.1| (AL445066)
FT                   phosphoribosylformylglycinamidine synthase related protein
FT                   [Thermoplasma acidophilum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33164"
FT                   /db_xref="GOA:Q9A1Z2"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Z2"
FT                   /protein_id="AAK33164.1"
FT                   /translation="MSSYFPVAPLSDLVSYMNKRIFVEKKADFGIKSASLVKELTHNLQ
FT                   LTSLKALRIVQVYDVFNLAEDLLARAEKHIFSEQVTDCLLTETEITAELDKVAFFAIEA
FT                   LPGQFDQRAASSQEALLLFGSDSQVKVNTAQLYLVNKDITEAELEAVKNYLLNPVDSRF
FT                   KDITLPLEEQAFSVSDKTIPNLDFFETYQADDFATYKAEQGLAMEVDDLLFIQNYFKSI
FT                   GCVPTETELKVLDTYWSDHCRHTTFETELKNIDFSASKFQKQLQTTYDKYIAMRDELGR
FT                   SEKPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNET
FT                   HNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITTPIAETRAGKLPQQV
FT                   ISKTAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPEAGD
FT                   VVILLGGKTGRDGVGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRDGNVTRL
FT                   IKKSNDFGAGGVCVAIGELADGLEIDLDKVPLKYQGLNGTEIAISESQERMSVVVRPND
FT                   VDAFIAACNKENIDAVVVATVTEKPNLVMTWNGEIIVDLERRFLDTNGVRVVVDAKVVD
FT                   KDLTVPEARTTSAETLEADTLKVLSDLNHASQKGLQTIFDSSVGRSTVNHPIGGRYQIT
FT                   PTESSVQKLPVQHGVTTTASVMAQGYNPYIAEWSPYHGAAYAVIEATARLVATGADWSR
FT                   ARFSYQEYFERMDKQAERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPT
FT                   LVAFGVTTADSRKVLSPEFKAAGENIYYIPGQAISEDIDFDLIKDNFSQFEAIQAQHKI
FT                   TAASAAKYGGVLESLALMTFGNRIGASVEIAELDSSLTAQLGGFVFTSAEEIADAVKIG
FT                   QTQADFTVTVNGNDLAGASLLAAFEGKLEEVYPTEFEQTDVLEEVPAVVSDTVIKAKET
FT                   IEKPVVYIPVFPGTNSEYDSAKAFEQVGASVNLVPFVTLNEVAIAESVDTMVANIAKAN
FT                   IIFFAGGFSAADEPDGSAKFIVNILLNEKVRAAIDSFIEKGGLIIGICNGFQALVKSGL
FT                   LPYGNFEEAGETSPTLFYNDANQHVAKMVETRIANTNSPWLAGVEVGDIHAIPVSHGEG
FT                   KLVVSASEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNGSVNAIEGITSKNGQIIGKMG
FT                   HSERWEDGLFQNIPGNKDQILFASAVKYFTGK"
FT   gene            40107..41561
FT                   /gene="purF"
FT                   /locus_tag="SPy_0026"
FT                   /old_locus_tag="SPy0026"
FT   CDS_pept        40107..41561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SPy_0026"
FT                   /old_locus_tag="SPy0026"
FT                   /product="putative phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="Best Blastp hit = pir||T51702
FT                   amidophosphoribosyltransferase (EC 2.4.2.14) [imported] -
FT                   Lactococcus lactis >gi|4097534|gb|AAD12627.1| (U64311)
FT                   phosphoribosylpyrophosphate amidotransferase [Lactococcus
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33165"
FT                   /db_xref="GOA:Q9A1Z1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Z1"
FT                   /protein_id="AAK33165.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIV
FT                   SNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRYATAGSADIRNIQPFLYKFH
FT                   DGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMHLIRRSHNSSFMGKVKEALN
FT                   TVKGGFAYLLMTENKLIAALDPNAFRPLSIGQMQNGAWVISSETCAFEVVGAKWVRDVE
FT                   PGEVILIDDRGIQCDRYTDETQLAICSMEYVYFARPDSTIHGVNVHTARKNMGKRLAQE
FT                   FKQDADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASEVHVAIASPELKYPCFYGID
FT                   IQTRRELISANHSVDEVCDIIGADSLTYLSLDGLIESIGLETKAPNGGLCVAYFDGHYP
FT                   TPLYDYEEEYLRSLEEKTSFYIQKVK"
FT   gene            41589..42611
FT                   /gene="purM"
FT                   /locus_tag="SPy_0027"
FT                   /old_locus_tag="SPy0027"
FT   CDS_pept        41589..42611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SPy_0027"
FT                   /old_locus_tag="SPy0027"
FT                   /product="putative phosphoribosylformylglycinamide
FT                   cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="Best Blastp hit = gb|AAC16901.1| (AF016634)
FT                   phosphoribosylformylglycinamide cyclo-ligase [Lactococcus
FT                   lactis subsp. cremoris]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33166"
FT                   /db_xref="GOA:Q9A1Z0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1Z0"
FT                   /protein_id="AAK33166.1"
FT                   /translation="MSEKNAYAKSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLVSGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYIATGKNNPVKLEEVVSGVAEGCVQAGAALIGGETAEMPGMYGQDDYDLAGFAVGVA
FT                   EKSQIIDGSKVKEGDILLGLASSGIHSNGYSLVRRVFADYTGKELLPELEGKQLKDVLL
FT                   EPTRIYVKAALPLIKEELVKGIGHITGGGFIENIPRMFADDLAAEIDEDKVPVLPIFKA
FT                   LEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKELLDEPVYEIGRIIKKADASVVIK
FT                   "
FT   gene            42779..43333
FT                   /gene="purN"
FT                   /locus_tag="SPy_0028"
FT                   /old_locus_tag="SPy0028"
FT   CDS_pept        42779..43333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SPy_0028"
FT                   /old_locus_tag="SPy0028"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="Best Blastp hit = gb|AAF08602.1|U70775_1 (U70775)
FT                   phosphoribosylglycinamide formyltransferase homolog
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33167"
FT                   /db_xref="GOA:Q9A1Y9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Y9"
FT                   /protein_id="AAK33167.1"
FT                   /translation="MKIAVFASGNGSNFQVIAEQFPVSFVFSDHRDAYVLERAQNLAIP
FT                   SFAFELKEFENKVAYEQAIVDLLDKHEIDLVCLAGYMKIVGETLLLAYERRIINIHPAY
FT                   LPEFPGAHGIEDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVRVPRLADDSLESFETRIH
FT                   ETEYQLYPAVLDSLGVERKVI"
FT   gene            complement(45122..46246)
FT                   /locus_tag="SPy_0031"
FT                   /old_locus_tag="SPy0031"
FT   CDS_pept        complement(45122..46246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0031"
FT                   /old_locus_tag="SPy0031"
FT                   /product="putative choline binding protein"
FT                   /note="Best Blastp hit = gb|AAF87768.1|AF278686_1
FT                   (AF278686) choline binding protein D; CbpD [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33168"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Y8"
FT                   /protein_id="AAK33168.1"
FT                   /translation="MKKFHRFLVSGVILLGFNGLVPTMPSTLISQQENLVHAAVLGDNY
FT                   PSKWKKGNGIDSWNMYIRQCTSFAAFRLSSANGFQLPKGYGNACTWGHIAKNQGYPVNK
FT                   TPSIGAIAWFDKNAYQSNAAYGHVAWVADIRGDTVTIEEYNYNAGQGPERYHKRQIPKS
FT                   QVSGYIHFKDLSSQTSHSYPRQLKHISQASFDPSGTYHFTTRLPVKGQTSIDSPDLAYY
FT                   EAGQSVYYDKVVTAGGYTWLSYLSFSGNRRYIPIKEPAQSVVQNDNTKPSIKVGDTVTF
FT                   PGVFRVDQLVNNLIVNKELAGGDPTPLNWIDPTPLDETDNQGKVLGDQILRVGEYFIVT
FT                   GSYKVLKIDQPSNGIYVQIGSRGTWVNADKANKL"
FT   gene            46499..47764
FT                   /gene="purD"
FT                   /locus_tag="SPy_0032"
FT                   /old_locus_tag="SPy0032"
FT   CDS_pept        46499..47764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SPy_0032"
FT                   /old_locus_tag="SPy0032"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /note="Best Blastp hit = sp|Q9ZF44|PUR2_LACLA
FT                   PHOSPHORIBOSYLAMINE-GLYCINE LIGASE (GARS) (GLYCINAMIDE
FT                   RIBONUCLEOTIDE SYNTHETASE) (PHOSPHORIBOSYLGLYCINAMIDE
FT                   SYNTHETASE) >gi|3892883|emb|CAA04374.1| (AJ000883) purD
FT                   [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33169"
FT                   /db_xref="GOA:Q9A1Y7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1Y7"
FT                   /protein_id="AAK33169.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLASKGVDQVFVAPGNDGMTLDGLDLV
FT                   NIVVSEHSRLIAFAKENEISWAFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSK
FT                   DFAKEIMVKYNVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFANGDKFYIMPTAQDHKRAFDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVEMIVRPVLEGMVAEGRPYLGVLYVGLILTADGPK
FT                   VIEFNSRFGDPETQIILPRLTSDFAQNIDDIMMGIEPYITWQKDGVTLGVVVASEGYPF
FT                   DYEKGVPLPEKTDGDIITYYAGVKFSENSELLLSNGGRVYMLVTTEDSVKAGQDKIYTQ
FT                   LAQQDTTGLFYRNDIGSKAIRE"
FT   gene            48042..48533
FT                   /gene="purE"
FT                   /locus_tag="SPy_0033"
FT                   /old_locus_tag="SPy0033"
FT   CDS_pept        48042..48533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SPy_0033"
FT                   /old_locus_tag="SPy0033"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   I"
FT                   /EC_number="4.1.1.21"
FT                   /note="Best Blastp hit = emb|CAA04375.1| (AJ000883) purE
FT                   [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33170"
FT                   /db_xref="GOA:Q9A1Y6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Y6"
FT                   /protein_id="AAK33170.1"
FT                   /translation="MKTPIISIIMGSKSDWATMQKTAEVLDNFGIAYEKKVVSAHRTPD
FT                   LMFKHAEEARGRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGLDSLYSIV
FT                   QMPGGVPVATMAIGEAGATNAALTALRILSIEDQNLADALAHFHEEQGKIAEESSGELI
FT                   "
FT   gene            48484..49593
FT                   /gene="purK"
FT                   /locus_tag="SPy_0034"
FT                   /old_locus_tag="SPy0034"
FT   CDS_pept        48484..49593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SPy_0034"
FT                   /old_locus_tag="SPy0034"
FT                   /product="phosphoribosylaminoimidazole carboxylase II"
FT                   /EC_number="4.1.1.21"
FT                   /note="Best Blastp hit = emb|CAA04376.1| (AJ000883) purK
FT                   [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33171"
FT                   /db_xref="GOA:Q9A1Y5"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Y5"
FT                   /protein_id="AAK33171.1"
FT                   /translation="MRNKEKSQRSQVVNSFKTIGIIGGGQLGQMMAIAAIYMGHKVITL
FT                   DPASDSPASRVSEVIVAPYDDVEALGQLAARCDVLTYEFENVDADGLDAVVSACQLPQG
FT                   TDLLRISQNRIVEKDFLANKAGVTVAPYKVVTSSLDLGGLDLTKTYVLKTETGGYDGHG
FT                   QKIIRSAEDLPEAQQLANSAQCVLEEFVNFDLEISVIVSGNGKDVTVFPVQENIHRNNI
FT                   LSKTIVPARISDQLADKAKKTAVQIAKKLQLSGTLCVEMFTTADDIIVNEIAPRPHNSG
FT                   RYSIEACDFSQFDTHILGVLGAPLPQIQLHAPAVMLNVLGQHVQQATDYVAKNPSAHLH
FT                   MYGKLEAKHNRKMGHVTVFAKDADEVKEF"
FT   gene            49620..51263
FT                   /gene="abiR"
FT                   /locus_tag="SPy_0035"
FT                   /old_locus_tag="SPy0035"
FT   CDS_pept        49620..51263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abiR"
FT                   /locus_tag="SPy_0035"
FT                   /old_locus_tag="SPy0035"
FT                   /product="possible abortive infection phage resistance
FT                   protein"
FT                   /note="Best Blastp hit = gb|AAG17058.1|AF188839_1
FT                   (AF188839) abortive infection phage resistance protein abiR
FT                   [Lactococcus lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33172"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Y4"
FT                   /protein_id="AAK33172.1"
FT                   /translation="MANIQINRIKSKLTELFSSIIYMGNIKVDEDSEEYKKMWYSRAYS
FT                   AYSTFLLGAENVDEATKSVTDGFADNGIDAIYNDKNKKILYFIQTKFSNEANGSISEGD
FT                   TLKFIKGVKKITTSDFSNFNDLIVAKQKEIEKALSDFNYRIEIIVCTSSNQNISSNSQE
FT                   VIDDFLQGVNSDGSDDVVTYRHIKLNDVYDHMANQGVAPKIDFEDVVVHNWGRPTLYND
FT                   SYKVYYGWLSATDIVNWKEQYGDRIFEKNIRNFKQNTDVNNGIKIISEKVEKNLKGVST
FT                   TDYINLKLIGASIINGAQTTGSLFEAYHSEDIDLTNVSVQVQIIVLGEDIDNIGPKITK
FT                   LSNTQNRIENKDFAAQDKEQERLMKDLAIDGKQYVYRQGVELPNSDEGCDLDSATVALG
FT                   CYLDDVAISTQMKRAYGSIFDNTNKPPYKLIFNSGTSAYKLWNCVEVYRELQNIEGEYQ
FT                   QDPNNQSKKLMSIHGNRFILHLIFQKLKNNPSLDFENGYITTFPNLTEEYCLIMEELIR
FT                   AKEELYPEAYPANIFKNGKRTKELKEKMSF"
FT   gene            51281..52573
FT                   /gene="purB"
FT                   /locus_tag="SPy_0036"
FT                   /old_locus_tag="SPy0036"
FT   CDS_pept        51281..52573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SPy_0036"
FT                   /old_locus_tag="SPy0036"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="Best Blastp hit = dbj|BAB04344.1| (AP001509)
FT                   adenylosuccinate lyase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33173"
FT                   /db_xref="GOA:Q9A1Y3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Y3"
FT                   /protein_id="AAK33173.1"
FT                   /translation="MLERYSRPEMAAIWTEENKYHAWLEVEILADEAWAELGEIPKEDV
FT                   AKIREKADFDIDRILEIEQDTRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRPQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVSLWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MMRNMESTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEEDTKV
FT                   TSCLTQEEIDELFNPIYYTKRVDDIFKRLGI"
FT   gene            52705..53616
FT                   /locus_tag="SPy_0037"
FT                   /old_locus_tag="SPy0037"
FT   CDS_pept        52705..53616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0037"
FT                   /old_locus_tag="SPy0037"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||I40868 hypothetical protein 3
FT                   nanH region - Clostridium perfringens
FT                   >gi|853809|emb|CAA60798.1| (X87369) ORF3 [Clostridium
FT                   perfringens]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33174"
FT                   /db_xref="GOA:Q9A1Y2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR040799"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Y2"
FT                   /protein_id="AAK33174.1"
FT                   /translation="MLEHFGGKVKVLRLEKRISREDLCGDESELSVRQLARIELGQSIP
FT                   SLSKVIFIAKALNVSVGYLTDGADLELPKRYKELKYLILRTPTYMDDGKLQVREEQFDE
FT                   IFEDYYDKLPEEEKIIIDCLQATLDTLLSENTNFGIDLLQEYFNQIKTKVRFRQNDLIL
FT                   LELYLAYLDIEGMDGQYSDKIFYDSLLDNLSEQFEQFELDELFIVNKIIIDISSLSLKN
FT                   NRLDNLEKAIEMSQKIMAKIQDWNRMPILKLIEWKYFLIKQKDIIKAEQSFMKACLFAQ
FT                   MTADQYLENKLIQEWEKDVKSY"
FT   gene            53842..54840
FT                   /gene="ruvB"
FT                   /locus_tag="SPy_0038"
FT                   /old_locus_tag="SPy0038"
FT   CDS_pept        53842..54840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SPy_0038"
FT                   /old_locus_tag="SPy0038"
FT                   /product="putative Holliday junction DNA helicase, subunit
FT                   B"
FT                   /note="Best Blastp hit = sp|O32055|RUVB_BACSU HOLLIDAY
FT                   JUNCTION DNA HELICASE RUVB >gi|6977806|emb|CAB75331.1|
FT                   (Y15896) RuvB protein [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33175"
FT                   /db_xref="GOA:Q9A1Y1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1Y1"
FT                   /protein_id="AAK33175.1"
FT                   /translation="MARILDNNVMGNEEFSDRTLRPQYLHEYIGQDKVKEQFAIFIEAA
FT                   KRRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPAVEKAGDLVAILNELEPG
FT                   DILFIDEIHRMPMSVEEVLYSAMEDFYIDIMIGAGDTSRSIHLDLPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYQEKDLTEIVERTATIFEIKIDHEAARKLACRSRGTPRIANR
FT                   LLKRVRDYAQIIGDGIITAQITDRALTMLDVDREGLDYIDQKILRTMIEMYQGGPVGLG
FT                   TLSVNIAEERNTVEEMYEPYLIQKGFLMRTRTGRVATQKAYRHLGYPYQNT"
FT   gene            54978..55415
FT                   /locus_tag="SPy_0039"
FT                   /old_locus_tag="SPy0039"
FT   CDS_pept        54978..55415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0039"
FT                   /old_locus_tag="SPy0039"
FT                   /product="putative protein-tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="Best Blastp hit = pir||E69808 protein-tyrosine
FT                   phosphatase homolog yfkJ - Bacillus subtilis
FT                   >gi|2626822|dbj|BAA23400.1| (D83967) YfkJ [Bacillus
FT                   subtilis] >gi|2633112|emb|CAB12617.1| (Z99108) similar to
FT                   protein-tyrosine phosphatase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33176"
FT                   /db_xref="GOA:Q9A1Y0"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="PDB:5GOT"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Y0"
FT                   /protein_id="AAK33176.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGN
FT                   PIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSK
FT                   IYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMSKEY"
FT   gene            55438..55839
FT                   /locus_tag="SPy_0040"
FT                   /old_locus_tag="SPy0040"
FT   CDS_pept        55438..55839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0040"
FT                   /old_locus_tag="SPy0040"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||S74454 hypothetical protein
FT                   slr1485 - Synechocystis sp. (strain PCC 6803)
FT                   >gi|1651678|dbj|BAA16606.1| (D90899) hypothetical protein
FT                   [Synechocystis sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33177"
FT                   /db_xref="GOA:Q9A1X9"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1X9"
FT                   /protein_id="AAK33177.1"
FT                   /translation="MIDMQDIVKKWSITRAKLEIVSVIVILVCAISVFSVRISNKTSLT
FT                   YDKGRMHYTGYVINHKMNGEGKLVYPNGDIYEGTFKDGLFEGKGTFTAKTGWLYNGEFH
FT                   KGQANGKGVLKAKNNKVYKGIFKQGIFQK"
FT   gene            55836..57611
FT                   /locus_tag="SPy_0041"
FT                   /old_locus_tag="SPy0041"
FT   CDS_pept        55836..57611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0041"
FT                   /old_locus_tag="SPy0041"
FT                   /product="putative acyltransferase"
FT                   /note="Best Blastp hit = pir||T18748 hypothetical protein
FT                   B0399.2 - Caenorhabditis elegans
FT                   >gi|3947538|emb|CAB03808.1| (Z81455) contains similarity to
FT                   Pfam domain: PF01757 (Domain of unknown function),
FT                   Score=520.1, E-value=5.2e-153, N=1 [Caenorhabditis elegans]
FT                   >gi|3947633|emb|CAA21519.1| (AL032623) contains similarity
FT                   to Pfam domain: PF01757 (Domain of unknown function),
FT                   Score=520.1, E-value=5.2e-153, N=1 [Caenorhabditis
FT                   elegans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33178"
FT                   /db_xref="GOA:Q9A1X8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1X8"
FT                   /protein_id="AAK33178.1"
FT                   /translation="MRIKWFSFVRVTGLLLVLLYHFFKNVFPGGFIGVDIFFTFSGYLI
FT                   TALLIDEYTKKESIDIIGFLKRRFYRIVPPLVLMILLTIPFTFLIKKDFIANIGSQITA
FT                   VLGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLFWGVFVWLLARRKETQKQL
FT                   RGLLFLISLGIFAISFLSMFIRSFMTSNFSLIYFSSLSHSFPFFLGAMFATITGINETT
FT                   VRFQKNVRLWPRQYVLAAMIGAFTLLLVLTVTLDFNHITTYLFGFALASLFASIMIYAA
FT                   RVLHEQTPDVQEPKAITYIADISYGIYLFHWPFYIIFSQLMSHILAVILTVFFSILFAT
FT                   VSYYIVEPLVQGRKPNLLGLEIDCSPYYKWIVGGSLALALLTLGTCMIAPKVGKFEKQL
FT                   LVSSLQQAQSNMERTHTLAAGDANALSDVGIIGDSVALRSSAAFSQIMPQAQLDAAVSR
FT                   NFKEAFDLFNNQIKSKSLSKTVVLAVGVNSLDNYSQAVQSFIEALPKGHRLVLVSPYNA
FT                   KNASQVAEARDYGLKLSKKYKYVTIADWYKVAVEHPDIWYGSDGVHYSEDSQGAELYVS
FT                   TIQTAVEKSAKKPAK"
FT   gene            60814..61830
FT                   /gene="adhA"
FT                   /locus_tag="SPy_0044"
FT                   /old_locus_tag="SPy0044"
FT   CDS_pept        60814..61830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="SPy_0044"
FT                   /old_locus_tag="SPy0044"
FT                   /product="putative alcohol dehydrogenase I"
FT                   /EC_number="1.1.1.1"
FT                   /note="Best Blastp hit = pir||H81186 alcohol dehydrogenase,
FT                   propanol-preferring NMB0546 [imported] - Neisseria
FT                   meningitidis (group B strain MD58)
FT                   >gi|7225772|gb|AAF40975.1| (AE002410) alcohol
FT                   dehydrogenase, propanol-preferring [Neisseria meningitidis
FT                   MC58]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33179"
FT                   /db_xref="GOA:Q9A1X7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1X7"
FT                   /protein_id="AAK33179.1"
FT                   /translation="MKAVVVNQASTGVEVVEHDLPNIGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPG
FT                   QWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADILVNGKEIEDVPG
FT                   YIQEKTGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
FT                   VGSLVGTRKDLEEAFAFGAEGLVAPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS"
FT   gene            62218..63510
FT                   /locus_tag="SPy_0045"
FT                   /old_locus_tag="SPy0045"
FT   CDS_pept        62218..63510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0045"
FT                   /old_locus_tag="SPy0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06655.1| (AP001517) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33180"
FT                   /db_xref="GOA:Q9A1X6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1X6"
FT                   /protein_id="AAK33180.1"
FT                   /translation="MIYNNRRKIFSLALPSMIENILQMLMGMVDNYLVAQIGLVAVSGV
FT                   SIANNIISIYQSLFIALGAAVSSLIARSIGENNQNKQLNYMAGVLQVTLLLSVGLGLLS
FT                   VAGHHQVLEWLGAEASVTLVGGQYLSIVGGMIVSLGLLTSLGAIVRAQGYPKIPMQVSL
FT                   LINVLNAIFSALSIYVWGFGLLGVAWATVLSRLVGVFLLCQFIPIKQVAKRLMRPLDKI
FT                   IFDLSLPAAGERLMMRAGDVLIIGIVVRFGTTALAGNAIGETLTQFNYMPGLAMATATI
FT                   ILVARQLGGGKVTEIRYIIREAFILSTLMMLVMGALTYLLGPSLLPLFTQNTDAQRSAM
FT                   IVLLFSLLGAPATAGTLVYTAVWQGLGKAKLPFYATTIGMWVIRIGLGYVIGVVWQYGL
FT                   IGVWMATVLDNTSRWFILSKHFKKYQEITFH"
FT   gene            63711..64019
FT                   /gene="rpsJ"
FT                   /locus_tag="SPy_0047"
FT                   /old_locus_tag="SPy0047"
FT   CDS_pept        63711..64019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SPy_0047"
FT                   /old_locus_tag="SPy0047"
FT                   /product="30S ribosomal protein S10"
FT                   /note="Best Blastp hit = sp|P48853|RS10_STRMU 30S RIBOSOMAL
FT                   PROTEIN S10 >gi|467321|gb|AAB46363.1| (L29637) S10
FT                   ribosomal protein [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33181"
FT                   /db_xref="GOA:P66341"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66341"
FT                   /protein_id="AAK33181.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            64267..64893
FT                   /gene="rplC"
FT                   /locus_tag="SPy_0049"
FT                   /old_locus_tag="SPy0049"
FT   CDS_pept        64267..64893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SPy_0049"
FT                   /old_locus_tag="SPy0049"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Best Blastp hit = sp|P42920|RL3_BACSU 50S RIBOSOMAL
FT                   PROTEIN L3 (BL3) >gi|7440603|pir||G69694 ribosomal protein
FT                   L3 (BL3) rplC - Bacillus subtilis
FT                   >gi|1165303|gb|AAC45956.1| (U43929) L3 [Bacillus subtilis]
FT                   >gi|2632383|emb|CAB11892.1| (Z99104) ribosomal protein L3
FT                   (BL3) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33182"
FT                   /db_xref="GOA:Q9A1X4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1X4"
FT                   /protein_id="AAK33182.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGD
FT                   VVDVTGISKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMG
FT                   GNRVTVQNLEIVQVIPEKNVILVKGNVPGAKKSLITIKSAVKAAK"
FT   gene            64917..65540
FT                   /gene="rplD"
FT                   /locus_tag="SPy_0050"
FT                   /old_locus_tag="SPy0050"
FT   CDS_pept        64917..65540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SPy_0050"
FT                   /old_locus_tag="SPy0050"
FT                   /product="50S ribosomal protein L4"
FT                   /note="Best Blastp hit = sp|P42921|RL4_BACSU 50S RIBOSOMAL
FT                   PROTEIN L4 >gi|7440640|pir||H69694 ribosomal protein L4
FT                   rplD - Bacillus subtilis >gi|786154|dbj|BAA08832.1|
FT                   (D50302) Ribosomal Protein L4 [Bacillus subtilis]
FT                   >gi|1165304|gb|AAC45957.1| (U43929) L4 [Bacillus subtilis]
FT                   >gi|2632384|emb|CAB11893.1| (Z99104) ribosomal protein L4
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33183"
FT                   /db_xref="GOA:P0C0D6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0D6"
FT                   /protein_id="AAK33183.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFA
FT                   ALSARNLPNVTVATAATASVLDIVNADKLLVTKEAISTIEEVLA"
FT   gene            65540..65836
FT                   /gene="rplW"
FT                   /locus_tag="SPy_0051"
FT                   /old_locus_tag="SPy0051"
FT   CDS_pept        65540..65836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SPy_0051"
FT                   /old_locus_tag="SPy0051"
FT                   /product="50S ribosomal protein L23"
FT                   /note="Best Blastp hit = sp|Q9Z9L2|RL23_BACHD 50S RIBOSOMAL
FT                   PROTEIN L23 >gi|11276846|pir||T44385 ribosomal protein L23
FT                   [imported] - Bacillus halodurans
FT                   >gi|4512406|dbj|BAA75273.1| (AB017508) rplW homologue
FT                   (identity of 71% to B. subtilis ) [Bacillus halodurans]
FT                   >gi|10172748|dbj|BAB03855.1| (AP001507) ribosomal protein
FT                   L23 [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33184"
FT                   /db_xref="GOA:Q9A1X2"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1X2"
FT                   /protein_id="AAK33184.1"
FT                   /translation="MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   gene            65854..66687
FT                   /gene="rplB"
FT                   /locus_tag="SPy_0052"
FT                   /old_locus_tag="SPy0052"
FT   CDS_pept        65854..66687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SPy_0052"
FT                   /old_locus_tag="SPy0052"
FT                   /product="50S ribosomal protein L2"
FT                   /note="Best Blastp hit = sp|P04257|RL2_BACST 50S RIBOSOMAL
FT                   PROTEIN L2"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33185"
FT                   /db_xref="GOA:P60434"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60434"
FT                   /protein_id="AAK33185.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            66826..67104
FT                   /gene="rpsS"
FT                   /locus_tag="SPy_0053"
FT                   /old_locus_tag="SPy0053"
FT   CDS_pept        66826..67104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SPy_0053"
FT                   /old_locus_tag="SPy0053"
FT                   /product="30S ribosomal protein S19"
FT                   /note="Best Blastp hit = sp|Q9WW12|RS19_STRPN 30S RIBOSOMAL
FT                   PROTEIN S19 >gi|4927744|gb|AAD33260.1|AF126059_1 (AF126059)
FT                   RpS19 [Streptococcus pneumoniae] >gi|4927753|gb|AAD33269.1|
FT                   (AF126060) RpS19 [Streptococcus pneumoniae]
FT                   >gi|4927762|gb|AAD33278.1| (AF126061) RpS19 [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33186"
FT                   /db_xref="GOA:P66496"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66496"
FT                   /protein_id="AAK33186.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR"
FT   gene            67120..67464
FT                   /gene="rplV"
FT                   /locus_tag="SPy_0055"
FT                   /old_locus_tag="SPy0055"
FT   CDS_pept        67120..67464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SPy_0055"
FT                   /old_locus_tag="SPy0055"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Best Blastp hit = sp|Q9WVU5|RL22_STRPN 50S RIBOSOMAL
FT                   PROTEIN L22 >gi|4927745|gb|AAD33261.1|AF126059_2 (AF126059)
FT                   RpL22 [Streptococcus pneumoniae] >gi|4927754|gb|AAD33270.1|
FT                   (AF126060) RpL22 [Streptococcus pneumoniae]
FT                   >gi|4927763|gb|AAD33279.1| (AF126061) RpL22 [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33187"
FT                   /db_xref="GOA:P0C0D4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0D4"
FT                   /protein_id="AAK33187.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   gene            67477..68130
FT                   /gene="rpsC"
FT                   /locus_tag="SPy_0056"
FT                   /old_locus_tag="SPy0056"
FT   CDS_pept        67477..68130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SPy_0056"
FT                   /old_locus_tag="SPy0056"
FT                   /product="30S ribosomal protein S3"
FT                   /note="Best Blastp hit = sp|Q9WW37|RS3_STRPN 30S RIBOSOMAL
FT                   PROTEIN S3 >gi|4927746|gb|AAD33262.1|AF126059_3 (AF126059)
FT                   RpS3 [Streptococcus pneumoniae] >gi|4927755|gb|AAD33271.1|
FT                   (AF126060) RpS3 [Streptococcus pneumoniae]
FT                   >gi|4927764|gb|AAD33280.1| (AF126061) RpS3 [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33188"
FT                   /db_xref="GOA:P66555"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66555"
FT                   /protein_id="AAK33188.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LADASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            68134..68547
FT                   /gene="rplP"
FT                   /locus_tag="SPy_0057"
FT                   /old_locus_tag="SPy0057"
FT   CDS_pept        68134..68547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SPy_0057"
FT                   /old_locus_tag="SPy0057"
FT                   /product="50S ribosomal protein L16"
FT                   /note="Best Blastp hit = sp|Q9X5K1|RL16_STRPN 50S RIBOSOMAL
FT                   PROTEIN L16 >gi|4927747|gb|AAD33263.1|AF126059_4 (AF126059)
FT                   RpL16 [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33189"
FT                   /db_xref="GOA:Q9A1W7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1W7"
FT                   /protein_id="AAK33189.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            68557..68763
FT                   /gene="rpmC"
FT                   /locus_tag="SPy_0059"
FT                   /old_locus_tag="SPy0059"
FT   CDS_pept        68557..68763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SPy_0059"
FT                   /old_locus_tag="SPy0059"
FT                   /product="50S ribosomal protein L29"
FT                   /note="Best Blastp hit = sp|Q9WVW8|RL29_STRPN 50S RIBOSOMAL
FT                   PROTEIN L29 >gi|4927748|gb|AAD33264.1|AF126059_5 (AF126059)
FT                   RpL29 [Streptococcus pneumoniae] >gi|4927757|gb|AAD33273.1|
FT                   (AF126060) RpL29 [Streptococcus pneumoniae]
FT                   >gi|4927766|gb|AAD33282.1| (AF126061) RpL29 [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33190"
FT                   /db_xref="GOA:P66176"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66176"
FT                   /protein_id="AAK33190.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFDLRFQAAAGQLE
FT                   KTARLDEVKKQIARVKTVQSEMK"
FT   gene            68789..69049
FT                   /gene="rpsQ"
FT                   /locus_tag="SPy_0060"
FT                   /old_locus_tag="SPy0060"
FT   CDS_pept        68789..69049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SPy_0060"
FT                   /old_locus_tag="SPy0060"
FT                   /product="30S ribosomal protein S17"
FT                   /note="Best Blastp hit = sp|Q9WW03|RS17_STRPN 30S RIBOSOMAL
FT                   PROTEIN S17 >gi|4927749|gb|AAD33265.1|AF126059_6 (AF126059)
FT                   RpS17 [Streptococcus pneumoniae] >gi|4927758|gb|AAD33274.1|
FT                   (AF126060) RpS17 [Streptococcus pneumoniae]
FT                   >gi|4927767|gb|AAD33283.1| (AF126061) RpS17 [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33191"
FT                   /db_xref="GOA:Q9A1W5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1W5"
FT                   /protein_id="AAK33191.1"
FT                   /translation="MERNQRKTLYGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEKAVII"
FT   gene            69074..69442
FT                   /locus_tag="SPy_0061"
FT                   /old_locus_tag="SPy0061"
FT   CDS_pept        69074..69442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0061"
FT                   /old_locus_tag="SPy0061"
FT                   /product="50S ribosomal protein L14"
FT                   /note="Best Blastp hit = sp|Q9WVZ2|RL14_STRPN 50S RIBOSOMAL
FT                   PROTEIN L14 >gi|4927750|gb|AAD33266.1|AF126059_7 (AF126059)
FT                   RpL14 [Streptococcus pneumoniae] >gi|4927759|gb|AAD33275.1|
FT                   (AF126060) RpL14 [Streptococcus pneumoniae]
FT                   >gi|4927768|gb|AAD33284.1| (AF126061) RpL14 [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33192"
FT                   /db_xref="GOA:Q9A1W4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1W4"
FT                   /protein_id="AAK33192.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   gene            69521..69826
FT                   /gene="rplX"
FT                   /locus_tag="SPy_0062"
FT                   /old_locus_tag="SPy0062"
FT   CDS_pept        69521..69826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SPy_0062"
FT                   /old_locus_tag="SPy0062"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Best Blastp hit = sp|Q9WVW6|RL24_STRPN 50S RIBOSOMAL
FT                   PROTEIN L24 >gi|4927751|gb|AAD33267.1|AF126059_8 (AF126059)
FT                   RpL24 [Streptococcus pneumoniae] >gi|4927760|gb|AAD33276.1|
FT                   (AF126060) RpL24 [Streptococcus pneumoniae]
FT                   >gi|4927769|gb|AAD33285.1| (AF126061) RpL24 [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33193"
FT                   /db_xref="GOA:Q9A1W3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1W3"
FT                   /protein_id="AAK33193.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVIVEGVGMIKKHQ
FT                   KPNTENPQGAIVEKEAPIHVSNVQVLDKNGVAGRIGYKVVDGKKVRYSKKSGEVLD"
FT   gene            69850..70392
FT                   /gene="rplE"
FT                   /locus_tag="SPy_0063"
FT                   /old_locus_tag="SPy0063"
FT   CDS_pept        69850..70392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SPy_0063"
FT                   /old_locus_tag="SPy0063"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Best Blastp hit = sp|Q9Z9K2|RL5_BACHD 50S RIBOSOMAL
FT                   PROTEIN L5 >gi|11276701|pir||T44395 ribosomal protein L5
FT                   [imported] - Bacillus halodurans
FT                   >gi|4512416|dbj|BAA75283.1| (AB017508) rplE homologue
FT                   (identity of 86% to B. subtilis ) [Bacillus halodurans]
FT                   >gi|10172758|dbj|BAB03865.1| (AP001507) ribosomal protein
FT                   L5 (BL6) [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33194"
FT                   /db_xref="GOA:Q9A1W2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1W2"
FT                   /protein_id="AAK33194.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   gene            70408..70593
FT                   /gene="rpsN"
FT                   /locus_tag="SPy_0064"
FT                   /old_locus_tag="SPy0064"
FT   CDS_pept        70408..70593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SPy_0064"
FT                   /old_locus_tag="SPy0064"
FT                   /product="30S ribosomal protein S14"
FT                   /note="Best Blastp hit = pir||S48688 ribosomal protein S14
FT                   - Bacillus stearothermophilus >gi|633867|gb|AAB31802.1| 30S
FT                   ribosomal protein subunit S14 [Bacillus stearothermophilus,
FT                   799, Peptide, 60 aa]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33195"
FT                   /db_xref="GOA:P66421"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66421"
FT                   /protein_id="AAK33195.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   gene            70744..71142
FT                   /gene="rpsH"
FT                   /locus_tag="SPy_0065"
FT                   /old_locus_tag="SPy0065"
FT   CDS_pept        70744..71142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SPy_0065"
FT                   /old_locus_tag="SPy0065"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Best Blastp hit = sp|P12879|RS8_BACSU 30S RIBOSOMAL
FT                   PROTEIN S8 (BS8) >gi|1044978|gb|AAB06813.1| (L47971)
FT                   ribosomal protein S8 [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33196"
FT                   /db_xref="GOA:P66634"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66634"
FT                   /protein_id="AAK33196.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGKNGERVITNLKRISKPGLRVYAKRDDMPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            71345..71881
FT                   /gene="rplF"
FT                   /locus_tag="SPy_0066"
FT                   /old_locus_tag="SPy0066"
FT   CDS_pept        71345..71881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SPy_0066"
FT                   /old_locus_tag="SPy0066"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Best Blastp hit = sp|P02391|RL6_BACST 50S RIBOSOMAL
FT                   PROTEIN L6 (BL10)"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33197"
FT                   /db_xref="GOA:Q9A1V9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1V9"
FT                   /protein_id="AAK33197.1"
FT                   /translation="MSRIGNKVITMPAGVELTNNNNVITVKGPKGELTREFNKNIEIKV
FT                   EGTEITVVRPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   gene            71986..72342
FT                   /gene="rplR"
FT                   /locus_tag="SPy_0067"
FT                   /old_locus_tag="SPy0067"
FT   CDS_pept        71986..72342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SPy_0067"
FT                   /old_locus_tag="SPy0067"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Best Blastp hit = sp|P46899|RL18_BACSU 50S RIBOSOMAL
FT                   PROTEIN L18 >gi|1044980|gb|AAB06815.1| (L47971) ribosomal
FT                   protein L18 [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33198"
FT                   /db_xref="GOA:Q9A1V8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1V8"
FT                   /protein_id="AAK33198.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   gene            72361..72855
FT                   /gene="rpsE"
FT                   /locus_tag="SPy_0069"
FT                   /old_locus_tag="SPy0069"
FT   CDS_pept        72361..72855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SPy_0069"
FT                   /old_locus_tag="SPy0069"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Best Blastp hit = sp|P02357|RS5_BACST 30S RIBOSOMAL
FT                   PROTEIN S5 (BS5) >gi|70883|pir||R3BS5F ribosomal protein S5
FT                   - Bacillus stearothermophilus >gi|143417|gb|AAA22699.1|
FT                   (M57621) ribosomal protein S5 [Bacillus
FT                   stearothermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33199"
FT                   /db_xref="GOA:P66583"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66583"
FT                   /protein_id="AAK33199.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   gene            72870..73052
FT                   /gene="rpmD"
FT                   /locus_tag="SPy_0071"
FT                   /old_locus_tag="SPy0071"
FT   CDS_pept        72870..73052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SPy_0071"
FT                   /old_locus_tag="SPy0071"
FT                   /product="50S ribosomal protein L30"
FT                   /note="Best Blastp hit = sp|O06444|RL30_STAAU 50S RIBOSOMAL
FT                   PROTEIN L30 >gi|2078380|gb|AAB54020.1| (U96620) ribosomal
FT                   protein L30 [Staphylococcus aureus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33200"
FT                   /db_xref="GOA:Q9A1V6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1V6"
FT                   /protein_id="AAK33200.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   gene            73266..73706
FT                   /gene="rplO"
FT                   /locus_tag="SPy_0072"
FT                   /old_locus_tag="SPy0072"
FT   CDS_pept        73266..73706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SPy_0072"
FT                   /old_locus_tag="SPy0072"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Best Blastp hit = sp|O06445|RL15_STAAU 50S RIBOSOMAL
FT                   PROTEIN L15 >gi|2078381|gb|AAB54021.1| (U96620) ribosomal
FT                   protein L15 [Staphylococcus aureus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33201"
FT                   /db_xref="GOA:Q9A1V5"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1V5"
FT                   /protein_id="AAK33201.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINTKEYALVNLDQLNVFDDGTEVTPAILKDAGIVRA
FT                   EKSGVKVLGNGELTKKLTVKAAKFSKSAEAAIIAKGGSIEVI"
FT   gene            73723..75027
FT                   /gene="secY"
FT                   /locus_tag="SPy_0073"
FT                   /old_locus_tag="SPy0073"
FT   CDS_pept        73723..75027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SPy_0073"
FT                   /old_locus_tag="SPy0073"
FT                   /product="putative preprotein translocase"
FT                   /note="Best Blastp hit = sp|P27148|SECY_LACLA PREPROTEIN
FT                   TRANSLOCASE SECY SUBUNIT >gi|97983|pir||S17985 preprotein
FT                   translocase secY - Lactococcus lactis subsp. lactis
FT                   >gi|44073|emb|CAA41939.1| (X59250) SecY protein
FT                   [Lactococcus lactis] >gi|228026|prf||1715214A secY gene
FT                   [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33202"
FT                   /db_xref="GOA:Q9A1V4"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1V4"
FT                   /protein_id="AAK33202.1"
FT                   /translation="MFLKILKDALKIKTVRNKIFFTIFIILVFRIGTHITVPGVNAKSL
FT                   EQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFAQSIGITAGFNTLSNVALVKTPDIKTYLLIGALLTTGSVI
FT                   VTWLGEQITDKGFGNGVSMIIFAGIISSIPSAIATIREDYFVNVKASDLHSSYLIVGIL
FT                   IIAVLAIVFFTTYVQQAEYKIPIQYTKLMQGAPTSSYLPLKVNPAGVIPVIFASSITTI
FT                   PSTIIPFVQNGRDLPWLNRLQEIFNYQTPVGMIVYALLIILFSFFYTFVQVNPEKTAEN
FT                   LQKNSSYIPSVRPGRETEQFMSALLKKLATVGAIFLAFISLAPIAAQQALNLSSSIALG
FT                   GTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   gene            75177..75815
FT                   /gene="adk"
FT                   /locus_tag="SPy_0074"
FT                   /old_locus_tag="SPy0074"
FT   CDS_pept        75177..75815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SPy_0074"
FT                   /old_locus_tag="SPy0074"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="Best Blastp hit = sp|P27143|KAD_LACLA ADENYLATE
FT                   KINASE (ATP-AMP TRANSPHOSPHORYLASE) >gi|97972|pir||S17987
FT                   adenylate kinase (EC 2.7.4.3) - Lactococcus lactis subsp.
FT                   lactis >gi|322101|pir||B44812 adenylate kinase (EC 2.7.4.3)
FT                   - Lactococcus lactis >gi|44074|emb|CAA41940.1| (X59250)
FT                   adenylate kinase [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33203"
FT                   /db_xref="GOA:P69882"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69882"
FT                   /protein_id="AAK33203.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEEFGIAHISTGDMFRAAMANQTEM
FT                   GRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEEL
FT                   GLRLDGVINIKVDPSCLVERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNMAQGEPILEHYRKLGLVTDIEGNQEITDVFADVEKALLELK"
FT   gene            75933..76151
FT                   /gene="infA"
FT                   /locus_tag="SPy_0075"
FT                   /old_locus_tag="SPy0075"
FT   CDS_pept        75933..76151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SPy_0075"
FT                   /old_locus_tag="SPy0075"
FT                   /product="putative translation initiation factor IF-1"
FT                   /note="Best Blastp hit = pir||S17988 translation initiation
FT                   factor IF-1 - Lactococcus lactis subsp. lactis"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33204"
FT                   /db_xref="GOA:P65123"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65123"
FT                   /protein_id="AAK33204.1"
FT                   /translation="MAKEDVIEIEGKVVETMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILVGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            76177..76293
FT                   /gene="rpmJ"
FT                   /locus_tag="SPy_0076"
FT                   /old_locus_tag="SPy0076"
FT   CDS_pept        76177..76293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SPy_0076"
FT                   /old_locus_tag="SPy0076"
FT                   /product="50S ribosomal protein B"
FT                   /note="Best Blastp hit = sp|P27146|RL36_LACLA 50S RIBOSOMAL
FT                   PROTEIN L36 (RIBOSOMAL PROTEIN B) >gi|97981|pir||S17989
FT                   ribosomal protein L36 - Lactococcus lactis subsp. lactis
FT                   >gi|322111|pir||D44812 ribosomal protein B - Lactococcus
FT                   lactis >gi|44076|emb|CAA41942.1| (X59250) ribosomal protein
FT                   B [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33205"
FT                   /db_xref="GOA:P66303"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66303"
FT                   /protein_id="AAK33205.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   gene            76311..76676
FT                   /gene="rpsM"
FT                   /locus_tag="SPy_0077"
FT                   /old_locus_tag="SPy0077"
FT   CDS_pept        76311..76676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SPy_0077"
FT                   /old_locus_tag="SPy0077"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Best Blastp hit = sp|P20282|RS13_BACSU 30S RIBOSOMAL
FT                   PROTEIN S13 (BS14) >gi|1044989|gb|AAB06824.1| (L47971)
FT                   ribosomal protein S13 [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33206"
FT                   /db_xref="GOA:P66394"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66394"
FT                   /protein_id="AAK33206.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDIRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNMNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            76694..77077
FT                   /gene="rpsK"
FT                   /locus_tag="SPy_0078"
FT                   /old_locus_tag="SPy0078"
FT   CDS_pept        76694..77077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SPy_0078"
FT                   /old_locus_tag="SPy0078"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Best Blastp hit = sp|P04969|RS11_BACSU 30S RIBOSOMAL
FT                   PROTEIN S11 (BS11) >gi|70938|pir||R3BSS1 ribosomal protein
FT                   S11 - Bacillus subtilis >gi|142462|gb|AAA22216.1| (M26414)
FT                   ribosomal protein S11 [Bacillus subtilis]
FT                   >gi|143451|gb|AAA22707.1| (M13957) ribosomal protein S11
FT                   [Bacillus subtilis] >gi|1044990|gb|AAB06825.1| (L47971)
FT                   ribosomal protein S11 [Bacillus subtilis]
FT                   >gi|2632409|emb|CAB11918.1| (Z99104) ribosomal protein S11
FT                   (BS11) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33207"
FT                   /db_xref="GOA:Q9A1V0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1V0"
FT                   /protein_id="AAK33207.1"
FT                   /translation="MAKPTRKRRVKKDIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            77123..78061
FT                   /gene="rpoA"
FT                   /locus_tag="SPy_0080"
FT                   /old_locus_tag="SPy0080"
FT   CDS_pept        77123..78061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SPy_0080"
FT                   /old_locus_tag="SPy0080"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="The N-terminal amino acid sequence of this ORF has
FT                   been determined from a spot isolated by 2-D gel
FT                   electrophoresis from another strain of S. pyogenes. Hogan,
FT                   D. A., Whitton, M. M., Rogers, J. and R. A. VanBogelen.
FT                   2000. Two-dimensional gel electrophoresis map of
FT                   Streptococcus pyogenes proteins. Unpublished data.; Best
FT                   Blastp hit = sp|O50634|RPOA_BACHD DNA-DIRECTED RNA
FT                   POLYMERASE ALPHA CHAIN (TRANSCRIPTASE ALPHA CHAIN) (RNA
FT                   POLYMERASE ALPHA SUBUNIT) >gi|11261105|pir||T44410
FT                   DNA-directed RNA polymerase (EC 2.7.7.6) alpha chain rpoA
FT                   [imported] - Bacillus halodurans
FT                   >gi|2760185|dbj|BAA24194.1| (AB010082) RNA polymerase alpha
FT                   subunit [Bacillus halodurans] >gi|4512431|dbj|BAA75298.1|
FT                   (AB017508) rpoA homologue (identity of 85% to B. subtilis )
FT                   [Bacillus halodurans] >gi|10172774|dbj|BAB03881.1|
FT                   (AP001507) DNA-directed RNA polymerase alpha subunit
FT                   [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33208"
FT                   /db_xref="GOA:P66710"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66710"
FT                   /protein_id="AAK33208.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLRATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKATEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   gene            79388..80722
FT                   /locus_tag="SPy_r05"
FT   rRNA            79388..80722
FT                   /locus_tag="SPy_r05"
FT                   /product="16S ribosomal RNA"
FT   gene            80884..80959
FT                   /locus_tag="SPy_t22"
FT   tRNA            80884..80959
FT                   /locus_tag="SPy_t22"
FT                   /product="tRNA-Ala"
FT   gene            81255..84157
FT                   /locus_tag="SPy_r06"
FT   rRNA            81255..84157
FT                   /locus_tag="SPy_r06"
FT                   /product="23S ribosomal RNA"
FT   gene            84377..84449
FT                   /locus_tag="SPy_t23"
FT   tRNA            84377..84449
FT                   /locus_tag="SPy_t23"
FT                   /product="tRNA-Val"
FT   gene            84455..84525
FT                   /locus_tag="SPy_t24"
FT   tRNA            84455..84525
FT                   /locus_tag="SPy_t24"
FT                   /product="tRNA-Gly"
FT   gene            84560..84633
FT                   /locus_tag="SPy_t25"
FT   tRNA            84560..84633
FT                   /locus_tag="SPy_t25"
FT                   /product="tRNA-Ile"
FT   gene            84656..84727
FT                   /locus_tag="SPy_t26"
FT   tRNA            84656..84727
FT                   /locus_tag="SPy_t26"
FT                   /product="tRNA-Glu"
FT   gene            84738..84827
FT                   /locus_tag="SPy_t27"
FT   tRNA            84738..84827
FT                   /locus_tag="SPy_t27"
FT                   /product="tRNA-Ser"
FT   gene            84837..84910
FT                   /locus_tag="SPy_t28"
FT   tRNA            84837..84910
FT                   /locus_tag="SPy_t28"
FT                   /product="tRNA-Met"
FT   gene            84931..85003
FT                   /locus_tag="SPy_t29"
FT   tRNA            84931..85003
FT                   /locus_tag="SPy_t29"
FT                   /product="tRNA-Phe"
FT   gene            85023..85103
FT                   /locus_tag="SPy_t30"
FT   tRNA            85023..85103
FT                   /locus_tag="SPy_t30"
FT                   /product="tRNA-Tyr"
FT   gene            85110..85180
FT                   /locus_tag="SPy_t31"
FT   tRNA            85110..85180
FT                   /locus_tag="SPy_t31"
FT                   /product="tRNA-Trp"
FT   gene            85192..85264
FT                   /locus_tag="SPy_t32"
FT   tRNA            85192..85264
FT                   /locus_tag="SPy_t32"
FT                   /product="tRNA-His"
FT   gene            85274..85344
FT                   /locus_tag="SPy_t33"
FT   tRNA            85274..85344
FT                   /locus_tag="SPy_t33"
FT                   /product="tRNA-Gln"
FT   gene            85364..85447
FT                   /locus_tag="SPy_t34"
FT   tRNA            85364..85447
FT                   /locus_tag="SPy_t34"
FT                   /product="tRNA-Leu"
FT   gene            85707..85892
FT                   /locus_tag="SPy_0084"
FT                   /old_locus_tag="SPy0084"
FT   CDS_pept        85707..85892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0084"
FT                   /old_locus_tag="SPy0084"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33209"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1U8"
FT                   /protein_id="AAK33209.1"
FT                   /translation="MSFEIFTLIIGWKLVGYRVMECGSSFKQGDYRLVVHICLLNVRDE
FT                   MLSQQGHEDKADWLEP"
FT   gene            86530..87100
FT                   /locus_tag="SPy_0088"
FT                   /old_locus_tag="SPy0088"
FT                   /note="isopentenyl monophosphate kinase; Multiple mutation
FT                   within this gene have been confirmed by sequence analysis"
FT   gene            87213..87656
FT                   /gene="adcR"
FT                   /locus_tag="SPy_0092"
FT                   /old_locus_tag="SPy0092"
FT   CDS_pept        87213..87656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcR"
FT                   /locus_tag="SPy_0092"
FT                   /old_locus_tag="SPy0092"
FT                   /product="putative repressor protein"
FT                   /note="Best Blastp hit = emb|CAA96184.1| (Z71552) AdcR
FT                   protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33210"
FT                   /db_xref="GOA:Q9A1U7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1U7"
FT                   /protein_id="AAK33210.1"
FT                   /translation="MGILEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQQRLTNTDLAKALNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPI
FT                   ASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG"
FT   gene            87660..88379
FT                   /gene="adcC"
FT                   /locus_tag="SPy_0093"
FT                   /old_locus_tag="SPy0093"
FT   CDS_pept        87660..88379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcC"
FT                   /locus_tag="SPy_0093"
FT                   /old_locus_tag="SPy0093"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="Best Blastp hit = emb|CAA96186.1| (Z71552) AdcC
FT                   protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33211"
FT                   /db_xref="GOA:Q9A1U6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1U6"
FT                   /protein_id="AAK33211.1"
FT                   /translation="MRYISVKNLSFQYESEPVLEGITYHLDSGEFVTMTGENGAAKSTL
FT                   IKATLGILQPKAGRVTIAKKNKDGKQLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFRHLNKHDEEHVQASLEAVGMWENRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHQHGKSVLMITHDPEEVKAYADRNIHLVRNQKLPWRCF
FT                   NIHEAETDDEKGGHGHA"
FT   gene            88372..89187
FT                   /gene="adcB"
FT                   /locus_tag="SPy_0094"
FT                   /old_locus_tag="SPy0094"
FT   CDS_pept        88372..89187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcB"
FT                   /locus_tag="SPy_0094"
FT                   /old_locus_tag="SPy0094"
FT                   /product="putative ABC transporter (permease)"
FT                   /note="Best Blastp hit = emb|CAA96187.1| (Z71552) AdcB
FT                   protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33212"
FT                   /db_xref="GOA:Q9A1U5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1U5"
FT                   /protein_id="AAK33212.1"
FT                   /translation="MLDILFYDFMQRAVMAVVAISIFAPILGIFLILRRQSLMSDTLSH
FT                   VSLAGVALGVVLGISPTITTIIVVVLAAILLEYLRVVYKHYMEISTAILMSLGLALSLI
FT                   IMSKSHSSSSMSLEQYLFGSIITISMEQVVALFAIAAIILILTVLFIRPMYILTFDEDT
FT                   AFVDGLPVRLMSVLFNIVTGVAIALTIPAAGALLVSTIMVLPASIAMRLGKNFKTVILL
FT                   GIVIGFSGMLSGIFLSYFFETPASATITMIFISIFLLVSLGGMLKKRLF"
FT   gene            complement(89227..89610)
FT                   /locus_tag="SPy_0095"
FT                   /old_locus_tag="SPy0095"
FT   CDS_pept        complement(89227..89610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0095"
FT                   /old_locus_tag="SPy0095"
FT                   /product="putative histidine triad (HIT) protein"
FT                   /note="Best Blastp hit = pir||B64408 histidine triad (HIT)
FT                   protein MJ0866 - Methanococcus jannaschii"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33213"
FT                   /db_xref="GOA:Q9A1U4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1U4"
FT                   /protein_id="AAK33213.1"
FT                   /translation="MTECIFCHQLKANQLLTQSQYFKVVFDIDPIQKGHLLLISKDHYT
FT                   SLTQLPKEGHYDLIDLQAALVAKLEQHLPISGVTSVSNDKELMDEGTHFHLHLIPRLTN
FT                   DSFWEGITINQENWDLTPFLKHL"
FT   gene            complement(89661..90917)
FT                   /gene="tyrS"
FT                   /locus_tag="SPy_0096"
FT                   /old_locus_tag="SPy0096"
FT   CDS_pept        complement(89661..90917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SPy_0096"
FT                   /old_locus_tag="SPy0096"
FT                   /product="putative tyrosine-tRNA ligase"
FT                   /EC_number="6.1.1.1"
FT                   /note="Best Blastp hit = sp|P00952|SYY_BACST TYROSYL-TRNA
FT                   SYNTHETASE (TYROSINE-TRNA LIGASE) (TYRRS)
FT                   >gi|68502|pir||SYBSYF tyrosine-tRNA ligase (EC 6.1.1.1) -
FT                   Bacillus stearothermophilus >gi|230779|pdb|2TS1|
FT                   Tyrosyl-Transfer RNA Synthetase (E.C.6.1.1.1)
FT                   >gi|230940|pdb|3TS1| Tyrosyl-Transfer RNA Synthetase
FT                   (E.C.6.1.1.1) Complexed With Tyrosinyl Adenylate"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33214"
FT                   /db_xref="GOA:Q9A1U3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1U3"
FT                   /protein_id="AAK33214.1"
FT                   /translation="MNIFEELKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQ
FT                   LSTFLDFENGDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRKKADKTGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   TQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITEQLFAGNIKNLSANELKQGLSN
FT                   VPNYHVQSIDNHNIVEILVAAKISPSKRQAREDVQNGAIYINGDRVQDLDYQLSNDDKI
FT                   DDQLTVIRRGKKKYAVLTY"
FT   gene            91009..93321
FT                   /gene="pbp1b"
FT                   /locus_tag="SPy_0097"
FT                   /old_locus_tag="SPy0097"
FT   CDS_pept        91009..93321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1b"
FT                   /locus_tag="SPy_0097"
FT                   /old_locus_tag="SPy0097"
FT                   /product="putative penicillin-binding protein 1b"
FT                   /note="Best Blastp hit = emb|CAA05302.1| (AJ002291)
FT                   penicillin-binding protein 1b [Streptococcus pneumoniae]
FT                   >gi|6165962|gb|AAF04736.1|AF101781_1 (AF101781)
FT                   penicillin-binding protein 1b [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33215"
FT                   /db_xref="GOA:Q9A1U2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1U2"
FT                   /protein_id="AAK33215.1"
FT                   /translation="MRYFMVKWNTKQKRISHQRLGLLDLGPVLLRTLRLLSNFFYIVIF
FT                   LFGMMGFGMAFGYLASQIESVKVPSKESLVKQVESLTMISQMNYSDNSLISTLDTDLLR
FT                   TPVANDAISENIKKAIVSTEDEHFQEHKGIVPKAVFRATLASVLGFGEASGGSTLTQQL
FT                   VKQQVLGDDPTFKRKSKEIVYALALERYMSKDNILCDYLNVSPFGRNNKGQNIAGVEEA
FT                   ARGIFGVSAKDLTVPQAAFLAGLPQSPIVYSPYLSTGQLKSEKDMAYGIKRQQNVLFNM
FT                   YRTGVLSKKEYEDYKAYPIQKDFIQPGSAIVNNHDYLYYTVLADAKKAMYSYLIKRDKV
FT                   SSRDLKNDETKAAYEERALTELQQGGYTITTTINKPIYNAMQTAAAQFGGLLDDGTGTV
FT                   QMGNVLTDNATGAVLGFVGGRDYALNQNNHAFNTVRSPGSSIKPIIAYGPAIDQGLMGS
FT                   ASVLSNYPTTYSSGQKIMHADSEGTAMMPLQEALNTSWNIPAFWTQKLLREKGVDVENY
FT                   MTKMGYKIADYSIESLPLGGGIEVSVAQQTNAYQMLSNNGLYQKQYIVDKITASDGTVV
FT                   YKHENKPIRIFSAATATILQELLRGPITSGATTTFKNRLAAINPWLANADWIGKTGTTE
FT                   NYTDVWLVLSTPKVTLGGWAGHDDNTSLAPLTGYNNNSNYLAYLANAINQADPNVIGVG
FT                   QRFNLDPGVIKANVLKSTGLQPGTVNVNGHTFSVGGEMTTSLWSQKGPGAMTYRFAIGG
FT                   TDADYQKAWGNFGFRKN"
FT   gene            93585..97151
FT                   /gene="rpoB"
FT                   /locus_tag="SPy_0098"
FT                   /old_locus_tag="SPy0098"
FT   CDS_pept        93585..97151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SPy_0098"
FT                   /old_locus_tag="SPy0098"
FT                   /product="putative DNA-dependent RNA polymerase subunit
FT                   beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="Best Blastp hit = emb|CAB56706.1| (Y16468)
FT                   DNA-dependent RNA polymerase subunit beta [Listeria
FT                   monocytogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33216"
FT                   /db_xref="GOA:Q9A1U1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1U1"
FT                   /protein_id="AAK33216.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKVN
FT                   KKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVVSPIDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGTVTNEIVWLTADEEDEY
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQQNGKVVFSDAEKV
FT                   EIRRQDGSLDVYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GASSEDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDIMHVDD
FT                   LEKAREKQAQETQEVSETTDEK"
FT   gene            97242..100883
FT                   /gene="rpoC"
FT                   /locus_tag="SPy_0099"
FT                   /old_locus_tag="SPy0099"
FT   CDS_pept        97242..100883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SPy_0099"
FT                   /old_locus_tag="SPy0099"
FT                   /product="DNA-dependent RNA polymerase, B' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="Best Blastp hit = sp|P95816|RPOC_STRPY DNA-DIRECTED
FT                   RNA POLYMERASE BETA' CHAIN (TRANSCRIPTASE BETA' CHAIN) (RNA
FT                   POLYMERASE BETA' SUBUNIT) >gi|1839027|emb|CAA65249.1|
FT                   (X96385) DNA-dependent RNA polymerase [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33217"
FT                   /db_xref="GOA:P0C0E0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0E0"
FT                   /protein_id="AAK33217.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEPKSLLTEREYREKLQEYG
FT                   HGSFVAKMGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKAVRRLDVLDAFNKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDNQRHKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDRLDINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLIRAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGNVVEIEEDAST
FT                   RTKKVYVQGKTGMGEYVIPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAMNEIEVIDHTEVSAEAVFTAEAE"
FT   gene            101035..101400
FT                   /locus_tag="SPy_0100"
FT                   /old_locus_tag="SPy0100"
FT   CDS_pept        101035..101400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0100"
FT                   /old_locus_tag="SPy0100"
FT                   /product="putative DNA binding protein"
FT                   /note="Best Blastp hit = gb|AAC45309.1| (U81957) putative
FT                   DNA binding protein [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33218"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1U0"
FT                   /protein_id="AAK33218.1"
FT                   /translation="MYQVIKMYGDWEPWWFIDGWQDDIIDEQQFSDWQEALDYFNQEWQ
FT                   RMKAIFPSYHSQKNLLATFWEKEDKRWCEDCDEDLQQFHSLLLLKNKDIVPSNNYIPEF
FT                   EQRNDSPQVAYLCKLNL"
FT   gene            101493..102431
FT                   /gene="comYA"
FT                   /locus_tag="SPy_0101"
FT                   /old_locus_tag="SPy0101"
FT   CDS_pept        101493..102431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYA"
FT                   /locus_tag="SPy_0101"
FT                   /old_locus_tag="SPy0101"
FT                   /product="putative ABC transporter subunit ComYA"
FT                   /note="Best Blastp hit = gb|AAC45310.1| (U81957) putative
FT                   ABC transporter subunit ComYA [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33219"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T9"
FT                   /protein_id="AAK33219.1"
FT                   /translation="MVQALAKAILAKAEQVHAQDIYILPRADQYDLFLRIGDERRLVDV
FT                   YQSDRMAPLISHFKFVAGMIVGEKRRCQVGSCDYKLSKDKQLSLRLSSVGDYRGQESLV
FT                   IRLLHHQNKSVHYWFDGLTKVANQVGGRGLYLFAGPVGSGKTTLMYQLISNYHQEAQVI
FT                   SIEDPVEIKNHQILQLQVNDDIGMTYDNLIKLSLRHRPDILVIGEIRDSQTARAVIRAS
FT                   LTGAMVFSTVHAKSISGVYARLLELGVTKAELSNCLALIAYQRLLNGGALIDSTQNEFE
FT                   YYSSSNWNQQIDQLLEAGHLNPKQAKLEKII"
FT   gene            102553..103401
FT                   /gene="comYB"
FT                   /locus_tag="SPy_0102"
FT                   /old_locus_tag="SPy0102"
FT   CDS_pept        102553..103401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYB"
FT                   /locus_tag="SPy_0102"
FT                   /old_locus_tag="SPy0102"
FT                   /product="putative competence protein, ABC transporter
FT                   subunit"
FT                   /note="Best Blastp hit = gb|AAC45311.1| (U81957) putative
FT                   ABC transporter subunit ComYB [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33220"
FT                   /db_xref="GOA:Q9A1T8"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T8"
FT                   /protein_id="AAK33220.1"
FT                   /translation="MEESLLKGQGLADMLSGLGFSDAILTQISLADRHGNIETTLVAIQ
FT                   HYLNQMARIRRKTVEVITYPLILLLFLFVMMLGLRRYLVPQLETQNQITYFLNHFPAFF
FT                   IGFCSGLILLFGMVWLRWRSQSRLKLYSRLSRYPFLGKLLKQYLTSYYAREWGTLIGQG
FT                   LDLMTILDIMAIEKSSLMKELAEDIRMSLLEGQAFHIKVATYPFFKKELSLMIEYGEIK
FT                   SKLGAELEIYAQESWEQFFSQLYQVTQLIQPAIFLVVAVTIVMIYAAILLPIYQNMGGI
FT                   F"
FT   gene            103403..103729
FT                   /gene="comYC"
FT                   /locus_tag="SPy_0103"
FT                   /old_locus_tag="SPy0103"
FT   CDS_pept        103403..103729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="SPy_0103"
FT                   /old_locus_tag="SPy0103"
FT                   /product="putative competence protein"
FT                   /note="Best Blastp hit = emb|CAA75317.1| (Y15043) homology
FT                   to ComYC from Streptococcus gordonii, and ComGC from
FT                   Bacillus subtilis [Lactococcus lactis subsp. cremoris]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33221"
FT                   /db_xref="GOA:Q9A1T7"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T7"
FT                   /protein_id="AAK33221.1"
FT                   /translation="MINQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDR
FT                   VTETGNAAVVKLVENQAELYELSQGSKPSLSQLKADGSITEKQEKAYQDYYDKHKNEKA
FT                   RLSN"
FT   gene            103704..104132
FT                   /locus_tag="SPy_0104"
FT                   /old_locus_tag="SPy0104"
FT   CDS_pept        103704..104132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0104"
FT                   /old_locus_tag="SPy0104"
FT                   /product="putative competence protein"
FT                   /note="Best Blastp hit = gb|AAC23740.1| (AF052207)
FT                   competence protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33222"
FT                   /db_xref="GOA:Q9A1T6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T6"
FT                   /protein_id="AAK33222.1"
FT                   /translation="MKKPVLAIKAFTLLETLLSLSVMSFIILGLSVPVTKSYQKVEEHL
FT                   FFSHFEHLYRHQQKLAILQQKQRVLDISSTKIVTEGNSLTVPKSITVNHPYRLVIDQMG
FT                   GNHSLAKIIFDMTDRRFKYQFYLGSGNYQKTSQSLHSP"
FT   gene            104137..104373
FT                   /locus_tag="SPy_0105"
FT                   /old_locus_tag="SPy0105"
FT   CDS_pept        104137..104373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0105"
FT                   /old_locus_tag="SPy0105"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAA75316.1| (Y15043)
FT                   hypothetical protein [Lactococcus lactis subsp. cremoris]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33223"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T5"
FT                   /protein_id="AAK33223.1"
FT                   /translation="MIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTR
FT                   TKEMTLNGCHITILRTDRYISIHDDEGEVMKIE"
FT   gene            104366..104800
FT                   /gene="comYD"
FT                   /locus_tag="SPy_0106"
FT                   /old_locus_tag="SPy0106"
FT   CDS_pept        104366..104800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYD"
FT                   /locus_tag="SPy_0106"
FT                   /old_locus_tag="SPy0106"
FT                   /product="putative competence protein"
FT                   /note="Best Blastp hit = emb|CAA75315.1| (Y15043) homology
FT                   to ComYD from Streptococcus gordonii, and ComGD from
FT                   Bacillus subtilis [Lactococcus lactis subsp. cremoris]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33224"
FT                   /db_xref="GOA:Q9A1T4"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T4"
FT                   /protein_id="AAK33224.1"
FT                   /translation="MSKQLSNIKAFTLLEALIALLVISGSLLVYQGLTRTLLKHSHYLA
FT                   RHDQDNWLLFSHQLREELSGARFYKVADNKLYVEKGKKVLAFGQFKSHDFRKSASNGKG
FT                   YQPMLFGISRSHIHIEQSQICITLKWKSGLERTFYYAFQD"
FT   gene            104784..105110
FT                   /locus_tag="SPy_0107"
FT                   /old_locus_tag="SPy0107"
FT   CDS_pept        104784..105110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0107"
FT                   /old_locus_tag="SPy0107"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33225"
FT                   /db_xref="GOA:Q9A1T3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T3"
FT                   /protein_id="AAK33225.1"
FT                   /translation="MPFKTNLKAGILLYAMFMASIFLLVLQVYLSQVTALHKEYQAQTD
FT                   YVKARLIAEIVYQDHRYKASNPVFFKGGQVICRERKERWMLIVKLDQQRQYQFEYLKPK
FT                   QYSQ"
FT   gene            105208..106161
FT                   /locus_tag="SPy_0108"
FT                   /old_locus_tag="SPy0108"
FT   CDS_pept        105208..106161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0108"
FT                   /old_locus_tag="SPy0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P37876|YTXK_BACSU HYPOTHETICAL
FT                   37.4 KD PROTEIN IN ACKA-SSPA INTERGENIC REGION
FT                   >gi|7475419|pir||G70003 hypothetical protein ytxK -
FT                   Bacillus subtilis >gi|2293239|gb|AAC00317.1| (AF008220)
FT                   YtxK [Bacillus subtilis] >gi|2635432|emb|CAB14926.1|
FT                   (Z99119) alternate gene name: ythI [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33226"
FT                   /db_xref="GOA:Q9A1T2"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T2"
FT                   /protein_id="AAK33226.1"
FT                   /translation="MTFEKIEEAYQLLLENCQLIENDLKTHIYDAIVEQNSFYLGAEGA
FT                   SPQVAQNSDKLKALCLTKEEWRKAYQFLFIKAAQTEQLQANHQFTPDAIGFILLYLLEQ
FT                   LSDKDSLEVLEIGSGTGNLAQTLLNNTSKSLDYVGIELDDLLIDLSASIAEIMDSSAHF
FT                   IQEDAVRPQLLKESDIVISDLPVGYYPNDDIAKRYKVASSDKHTYAHHLLMEQSLKYLK
FT                   KDGFAIFLAPVNLLTSPQSQLLKQWLKDYAQVVTLITLPDSIFGHPSNAKSIIVLQKQT
FT                   DHPMETFVYPIRDLKLAENIHDFMENFKKWKLSNVN"
FT   gene            106220..107416
FT                   /gene="ackA"
FT                   /locus_tag="SPy_0109"
FT                   /old_locus_tag="SPy0109"
FT   CDS_pept        106220..107416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SPy_0109"
FT                   /old_locus_tag="SPy0109"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="Best Blastp hit = sp|P37877|ACKA_BACSU ACETATE
FT                   KINASE (ACETOKINASE) >gi|1075817|pir||B49935 acetate kinase
FT                   (EC 2.7.2.1) ackA - Bacillus subtilis
FT                   >gi|405134|gb|AAC36857.1| (L17320) acetate kinase [Bacillus
FT                   subtilis] >gi|2293240|gb|AAC00318.1| (AF008220) acetate
FT                   kinase [Bacillus subtilis] >gi|2635431|emb|CAB14925.1|
FT                   (Z99119) acetate kinase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33227"
FT                   /db_xref="GOA:P63415"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63415"
FT                   /protein_id="AAK33227.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEAVLAQGIIERIGLKDSISTVK
FT                   YDGKKEEQILDIHDHTEAVKILLNDLIHFGIIAAYDEITGVGHRVVAGGELFKESVVVN
FT                   DKVLEQIEELSVLAPLHNPGAAAGIRAFRDILPDITSVCVFDTSFHTSMAKHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAQEAAKMLGRPLEELKLITAHIGNGVSITANYHGKSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIEQDPELKDAADVVNMLNKKSGLSGVSGIS
FT                   SDMRDIEAGLQEDNPDAVLAYNIFIDRIKKCIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVIGGLTWFGMDIDPEKNVFGYRGDISTPESKVKVLVISTDEELCIARDVERLKNTK"
FT   gene            107603..107911
FT                   /locus_tag="SPy_0110"
FT                   /old_locus_tag="SPy0110"
FT   CDS_pept        107603..107911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0110"
FT                   /old_locus_tag="SPy0110"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAD41947.1|AF160864_35
FT                   (AF160864) orf443 [Tetrahymena pyriformis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33228"
FT                   /db_xref="GOA:Q9A1T0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1T0"
FT                   /protein_id="AAK33228.1"
FT                   /translation="MYVFIEPNDLKDYLITVYDERNRAIRKQTQVYCFYLMIVLFVALF
FT                   FFFPCLTIRDLVSYKLPLIFAYLYLIIRSLVAKKMEALGKITTNSQKPPFDTSQVLC"
FT   gene            complement(107994..108764)
FT                   /gene="proC"
FT                   /locus_tag="SPy_0112"
FT                   /old_locus_tag="SPy0112"
FT   CDS_pept        complement(107994..108764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SPy_0112"
FT                   /old_locus_tag="SPy0112"
FT                   /product="putative pyrroline carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Best Blastp hit = sp|Q04708|PROC_PEA
FT                   PYRROLINE-5-CARBOXYLATE REDUCTASE (P5CR) (P5C REDUCTASE)
FT                   >gi|7431797|pir||T06477 probable pyrroline-5-carboxylate
FT                   reductase (EC 1.5.1.2) - garden pea
FT                   >gi|20851|emb|CAA44646.1| (X62842) pyrroline carboxylate
FT                   reductase [Pisum sativum] >gi|445614|prf||1909360A
FT                   pyrroline carboxylate reductase [Pisum sativum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33229"
FT                   /db_xref="GOA:Q9A1S9"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2AHR"
FT                   /db_xref="PDB:2AMF"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S9"
FT                   /protein_id="AAK33229.1"
FT                   /translation="MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLAL
FT                   PYAMSHQDLIDQVDLVILGIKPQLFETVLKPLHFKQPIISMAAGISLQRLATFVGQDLP
FT                   LLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSP
FT                   GGTTIAGLMELERLGLTATVSSAIDKTIDKAKSL"
FT   gene            complement(108812..109879)
FT                   /gene="pepA"
FT                   /locus_tag="SPy_0115"
FT                   /old_locus_tag="SPy0115"
FT   CDS_pept        complement(108812..109879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SPy_0115"
FT                   /old_locus_tag="SPy0115"
FT                   /product="putative glutamyl-aminopeptidase"
FT                   /note="Best Blastp hit = pir||B69998
FT                   endo-1,4-beta-glucanase homolog ytoP - Bacillus subtilis
FT                   >gi|2293210|gb|AAC00288.1| (AF008220) YtoP [Bacillus
FT                   subtilis] >gi|2635470|emb|CAB14964.1| (Z99119) similar to
FT                   endo-1,4-beta-glucanase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33230"
FT                   /db_xref="GOA:Q9A1S8"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S8"
FT                   /protein_id="AAK33230.1"
FT                   /translation="MTDLFSKIKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLG
FT                   GIFGIRDSKAEKAPRILVAAHMDEVGFMVSDIKVDGTLRVVGIGGWNPLVVSSQRFTLY
FT                   TRTGQVIPLISGSVPPHFLRGANGSASLPHIEDIVFDGGFTDKAEAERFGITPGDIIIP
FT                   QSETILTANQKNIISKAWDNRYGVLMITEMLEALKGQDLNNTLIAGANVQEEVGLRGAH
FT                   VSTTKFDPELFFAVDCSPAGDIYGNPGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEEA
FT                   GVNFQYYCGKGGTDAGAAHLQNGGVPSTTIGVCARYIHSHQTLYAMDDFVEAQAFLQAI
FT                   IKKLDRSTVDLIKCY"
FT   gene            complement(109989..110153)
FT                   /locus_tag="SPy_0116"
FT                   /old_locus_tag="SPy0116"
FT   CDS_pept        complement(109989..110153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0116"
FT                   /old_locus_tag="SPy0116"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33231"
FT                   /db_xref="GOA:Q9A1S7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S7"
FT                   /protein_id="AAK33231.1"
FT                   /translation="MTPLSLLFASEESFRILSALLFLLTSLCFIILMISLLPKKTGYRQ
FT                   KTNTSSRDL"
FT   gene            110344..110628
FT                   /locus_tag="SPy_0117"
FT                   /old_locus_tag="SPy0117"
FT   CDS_pept        110344..110628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0117"
FT                   /old_locus_tag="SPy0117"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33232"
FT                   /db_xref="GOA:Q9A1S6"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S6"
FT                   /protein_id="AAK33232.1"
FT                   /translation="MSKKKIGMISGIFGFSLAIGLGIVIKDYCQDRQRRQMTRDLRTFF
FT                   SPLGQIEVLYINPCQVKQDYISGGVVMSNGKQYQFTYHSRQISFEEDKG"
FT   gene            complement(112393..113034)
FT                   /locus_tag="SPy_0121"
FT                   /old_locus_tag="SPy0121"
FT   CDS_pept        complement(112393..113034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0121"
FT                   /old_locus_tag="SPy0121"
FT                   /product="putative deoxyguanosine kinase/deoxyadenosine
FT                   kinase(I) subunit"
FT                   /EC_number="2.7.1.113"
FT                   /note="Best Blastp hit = dbj|BAB16044.1| (AB030884) similar
FT                   to Lactobacillus acidophilus dA/dG-kinase [Streptococcus
FT                   zooepidemicus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33233"
FT                   /db_xref="GOA:Q9A1S5"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S5"
FT                   /protein_id="AAK33233.1"
FT                   /translation="MLIVLAGTIGAGKSSLAAALGEHLGTDVFYEAVDNNPVLDLYYQD
FT                   PKKYAFLLQIYFLNKRFKSIKEAYQADNNILDRSIFEDELFLKLNYKNGNVTKTELDIY
FT                   QELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIERRGRSFEQVDGNPSLEQYYHQV
FT                   HGEYPTWYEDYEVSPKMKIDGNSLDFVQNPQDLATVLKMIDTKLKELHLL"
FT   gene            complement(113054..114031)
FT                   /locus_tag="SPy_0122"
FT                   /old_locus_tag="SPy0122"
FT   CDS_pept        complement(113054..114031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0122"
FT                   /old_locus_tag="SPy0122"
FT                   /product="possible transcriptional regulator"
FT                   /note="Best Blastp hit = gb|AAC97155.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33234"
FT                   /db_xref="GOA:Q7DAN3"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAN3"
FT                   /protein_id="AAK33234.1"
FT                   /translation="MIKLNSSFRIGDVEIPHRTVLAPMAGVTNSAFRTIAKEFGAGLVV
FT                   MEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFGGDAEGLKRAADFIQTNTKADIVDI
FT                   NMGCPVNKVVKNEAGAKWLRDPDKIYHIVKEVTSVLDIPLTVKMRTGWADSSLAVENAL
FT                   AAESAGVSALAMHGRTREQMYTGTCDHETLARVSKAITKIPFIGNGDVRSVQDAKFMIE
FT                   EIGVDAVMIGRAAMNNPYLFTQINHFFETGQELPDLPFAKKLDIAKDHLKRLINLKGET
FT                   IAVREFRGLAPHYLRGTAGAAKVRGAVSRAETLAEVEAIFETVR"
FT   gene            complement(114018..114890)
FT                   /locus_tag="SPy_0123"
FT                   /old_locus_tag="SPy0123"
FT   CDS_pept        complement(114018..114890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0123"
FT                   /old_locus_tag="SPy0123"
FT                   /product="putative heat shock protein HSP33"
FT                   /note="Best Blastp hit = dbj|BAB03806.1| (AP001507) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33235"
FT                   /db_xref="GOA:P0C0C3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0C3"
FT                   /protein_id="AAK33235.1"
FT                   /translation="MDKIIKSIAQSGAFRAYVLDSTETVALAQEKHNTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLLD
FT                   ENDKVKVAGGFMVQVLPGASEEEIARYEKRLQEMPAISHLLASKNHVDALLEAIYGDEP
FT                   YKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESD
FT                   LEAIISDKA"
FT   gene            complement(115037..116530)
FT                   /gene="rofA"
FT                   /locus_tag="SPy_0124"
FT                   /old_locus_tag="SPy0124"
FT   CDS_pept        complement(115037..116530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rofA"
FT                   /locus_tag="SPy_0124"
FT                   /old_locus_tag="SPy0124"
FT                   /product="regulatory protein"
FT                   /note="Best Blastp hit = gb|AAC43219.1| (U01312) RofA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33236"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S4"
FT                   /protein_id="AAK33236.1"
FT                   /translation="MIEKYLESSIESKCQLIVLFFKTSYLPITEVAEKTGLTFLQLNHY
FT                   CEELNAFFPGSLSMTIQKRMISCQFTHPFKETYLYQLYASSNVLQLLAFLIKNGSHSRP
FT                   LTDFARSHFLSNSSAYRMREALIPLLRNFELKLSKNKIVGEEYRIRYLIALLYSKFGIK
FT                   VYDLTQQDKNTIHSFLSHSSTHLKTSPWLSESFSFYDILLALSWKRHQFSVTIPQTRIF
FT                   QQLKKLFVYDSLKKSSHDIIETYCQLNFSAGDLDYLYLIYITANNSFASLQWTPEHIRQ
FT                   YCQLFEENDTFRLLLNPIITLLPNLKEQKASLVKALMFFSKSFLFNLQHFIPETNLFVS
FT                   PYYKGNQKLYTSLKLIVEEWMAKLPGKRDLNHKHFHLFCHYVEQSLRNIQPPLVVVFVA
FT                   SNFINAHLLTDSFPRYFSDKSIDFHSYYLLQDNVYQIPDLKPDLVITHSQLIPFVHHEL
FT                   TKGIAVAEISFDESILSIQELMYQVKEEKFQADLTKQLT"
FT   gene            119221..119616
FT                   /locus_tag="SPy_0127"
FT                   /old_locus_tag="SPy0127"
FT   CDS_pept        119221..119616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0127"
FT                   /old_locus_tag="SPy0127"
FT                   /product="putative signal peptidase I"
FT                   /note="Best Blastp hit = gb|AAC97149.1| (U49397) LepA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33237"
FT                   /db_xref="GOA:Q9A1S3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S3"
FT                   /protein_id="AAK33237.1"
FT                   /translation="MIIKRNDMAPSVKAGDAILFYRLSQTYKVEEAVVYEDSKTSITKV
FT                   GRIIAQAGDEVDLTEQGELKINGHIQNEGLTFIKSREANYPYRIADNSYLILNDYYSQE
FT                   SENYLQDAIAKDAIKGTINTLIRLRNH"
FT   gene            119649..120671
FT                   /locus_tag="SPy_0128"
FT                   /old_locus_tag="SPy0128"
FT   CDS_pept        119649..120671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0128"
FT                   /old_locus_tag="SPy0128"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC97152.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33238"
FT                   /db_xref="GOA:Q9A1S2"
FT                   /db_xref="InterPro:IPR017503"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="PDB:3B2M"
FT                   /db_xref="PDB:3GLD"
FT                   /db_xref="PDB:3GLE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1S2"
FT                   /protein_id="AAK33238.1"
FT                   /translation="MKLRHLLLTGAALTSFAATTVHGETVVNGAKLTVTKNLDLVNSNA
FT                   LIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSEVT
FT                   FEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGSKVP
FT                   IQFKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAP
FT                   VQTEASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKN
FT                   IAGNSTEQETSTDKDMTITFTNKKDFEVPTGVAMTVAPYIALGIVAVGGALYFVKKKNA
FT                   "
FT   gene            120681..121394
FT                   /locus_tag="SPy_0129"
FT                   /old_locus_tag="SPy0129"
FT   CDS_pept        120681..121394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0129"
FT                   /old_locus_tag="SPy0129"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC97152.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33239"
FT                   /db_xref="GOA:Q9A1S1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR015986"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="PDB:3PSQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S1"
FT                   /protein_id="AAK33239.1"
FT                   /translation="MIVRLIKLLDKLINVIVLCFFFLCLLIAALGIYDALTVYQGANAT
FT                   NYQQYKKKGVQFDDLLAINSDVMAWLTVKGTHIDYPIVQGENNLEYINKSVEGEYSLSG
FT                   SVFLDYRNKVTFEDKYSLIYAHHMAGNVMFGELPNFRKKSFFNKHKEFSIETKTKQKLK
FT                   INIFACIQTDAFDSLLFNPIDVDISSKNEFLNHIKQKSVQYREILTTNESRFVALSTCE
FT                   DMTTDGRIIVIGQIE"
FT   gene            121416..122063
FT                   /locus_tag="SPy_0130"
FT                   /old_locus_tag="SPy0130"
FT   CDS_pept        121416..122063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0130"
FT                   /old_locus_tag="SPy0130"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC97151.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33240"
FT                   /db_xref="GOA:Q9A1S0"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1S0"
FT                   /protein_id="AAK33240.1"
FT                   /translation="MKKSILRILAIGYLLMSFCLLDSVEAENLTASINIEVINQVDVAT
FT                   NKQSSDIDETFMFVIEALDKESPLPNSVTTSVKGNGKTSFEQLTFSEVGQYHYKIHQLL
FT                   GKNSQYHYDETVYEVVIYVLYNEQSGALETNLVSNKLGETEKSELIFKQEYSEKTPEPH
FT                   QPDTTEKEKPQKKRNGILPSTGEMVSYVSALGIVLVATITLYSIYKKLKTSK"
FT   gene            complement(122250..123602)
FT                   /locus_tag="SPy_0131"
FT                   /old_locus_tag="SPy0131"
FT   CDS_pept        complement(122250..123602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0131"
FT                   /old_locus_tag="SPy0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB54046.1| (AJ245436)
FT                   hypothetical protein, 57.8 kD [Pseudomonas putida]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33241"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R9"
FT                   /protein_id="AAK33241.1"
FT                   /translation="MTRTNYQKKRMTCPVETEDITYRRKKIKGRRQAILAQFEPELVHH
FT                   ELIGDSCTCPDCHGTLTEIGSVVQRQELVFIPAQLKRINHVQHAYKCQTCSDNSLSDKI
FT                   IKAPVPKAPLAHSLGSASIIAHTVHQKFTLKVPNYRQEEDWNKLGLSISRKEIANWHIK
FT                   SSQYYFEPLYDLLRDILLSQEVIHADETSYRVLESDTQLTYYWTFLSGKHEKKGITLYH
FT                   HDKRRSGLVTQEVLGDYSGYVHCDMHGAYRQLEHAKLVGCWAHVRRKFFEATPKQADKT
FT                   SLGRKGLVYCDKLFALEAEWCELPPQERLVKRKEILTPLMTTFFDWCREQVVLSGSKLG
FT                   LAIAYSLKHERTFRTVLEDGHIVLSNNMAERAIKSLVMGRKNWLFSQSFEGAKAAAIIM
FT                   SLLETAKRHGLNSEKYISYLLDRLPNEETLAKREVLEAYLPWAKKVQTNCQ"
FT   gene            complement(123813..124163)
FT                   /locus_tag="SPy_0133"
FT                   /old_locus_tag="SPy0133"
FT   CDS_pept        complement(123813..124163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0133"
FT                   /old_locus_tag="SPy0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10955400 orf50 [Escherichia
FT                   coli] >gi|6009426|dbj|BAA84885.1| (AB024946) orf50
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33242"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R8"
FT                   /protein_id="AAK33242.1"
FT                   /translation="MTIRLNDLGQVYLVCGKTDMRQGIDSLAYLVKSQHELDLFSGAVY
FT                   LFCGGRRDRFKALYWDGQGFWLLYKRFENGKLAWPRNRDEVKCLTAVQVDWLMKGFFIS
FT                   PNIKISKSHDFY"
FT   gene            124467..125222
FT                   /locus_tag="SPy_0135"
FT                   /old_locus_tag="SPy0135"
FT   CDS_pept        124467..125222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0135"
FT                   /old_locus_tag="SPy0135"
FT                   /product="putative fimbria-associated protein"
FT                   /note="Best Blastp hit = gb|AAC13546.1| (AF019629) putative
FT                   fimbria-associated protein [Actinomyces naeslundii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33243"
FT                   /db_xref="GOA:Q9A1R7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R7"
FT                   /protein_id="AAK33243.1"
FT                   /translation="MECYRDRQLLSTYHKQVTQKKPSEMEEVWQKAKAYNARLGIQPVP
FT                   DAFSFRDGIHDKNYESLLQIENNDIMGYVEVPSIKVTLPIYHYTTDEVLTKGAGHLFGS
FT                   ALPVGGDGTHTVISAHRGLPSAEMFTNLNLVKKGDTFYFRVLNKVLAYKVDQILTVEPD
FT                   QVTSLSGVMGKDYATLVTCTPYGVNTKRLLVRGHRIAYHYKKYQQAKKAMKLVDKSRMW
FT                   AEVVCAAFGVVIAIILVFMYSRVSAKKSK"
FT   gene            complement(125416..126081)
FT                   /locus_tag="SPy_0136"
FT                   /old_locus_tag="SPy0136"
FT   CDS_pept        complement(125416..126081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0136"
FT                   /old_locus_tag="SPy0136"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33244"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R6"
FT                   /protein_id="AAK33244.1"
FT                   /translation="MKRCNKYLFTSLLAASMLFSSYKSVHAHDNIDEKGKVHLYWQGNY
FT                   YVDNYVDYTKKLVDSDKNIEWTVTFNSAKEQWVYPDFSVFLPKGVKAPTEITYEHHYWD
FT                   GTVRSETRNNTQWHYDWKSQQTNFNQEFDKFPGYTGWSPSLDKFYKLKNDGKFSHVLVD
FT                   TYGRQSHTYFSHKMVWKFKTELEDNYKNKWDKLPFIAGIKQNNPLAASFPSYKGEFGE"
FT   gene            126460..127836
FT                   /gene="atoE"
FT                   /locus_tag="SPy_0137"
FT                   /old_locus_tag="SPy0137"
FT   CDS_pept        126460..127836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /locus_tag="SPy_0137"
FT                   /old_locus_tag="SPy0137"
FT                   /product="putative short-chain fatty acids transporter"
FT                   /note="Best Blastp hit = dbj|BAB04077.1| (AP001508)
FT                   short-chain fatty acids transporter [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33245"
FT                   /db_xref="GOA:Q9A1R5"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R5"
FT                   /protein_id="AAK33245.1"
FT                   /translation="MDRYIDGFMKWMPESLFICFILTFLVVTMSVLMTDSPFIGTEKTG
FT                   GIIYGWVNGFWGLLSFAMQMTILLATGNAVASSPPAHKMFKSLAKLPQTRTQIFIFSIV
FT                   VGSIFGFLHWGLGMMVAIVFGKELLVQARQKGIKVHTPLFVATLFFTFLPATSGLSGAA
FT                   VLYSATPDYLRNSVADAYKQVVPESVPLTESVLNLPFISLLVVCMLVPLCFALLAHPKD
FT                   ETKIMELDDEIYHHSLDTASHVVIARNTPAEKMNASRLVMYLVGGAIVSYSLYHFSVVG
FT                   LSGLDLNCFNFLFLGLGLLLCGQQGPEYYGSLFKDGVMSSWGLVLQFPFYAGIFGIIQS
FT                   TGLGLEISHFFVAISNGTTWPVFAYLYSALLNIAVPSGGSKFVIEAPYIVPATIEVGND
FT                   LGKILQAYQLGDATTNLIVPFWALSYLSNFKLKFNQIVAYTIPCVLVVTGIAIIYLFVF
FT                   "
FT   gene            complement(127904..128814)
FT                   /locus_tag="SPy_0139"
FT                   /old_locus_tag="SPy0139"
FT                   /note="*FRAME SHIFT* Best Blastp hit = sp|P39592|YWBI_BACSU
FT                   HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YWBI
FT                   >gi|629031|pir||S39679 transcription regulator homolog ywbI
FT                   - Bacillus subtilis >gi|413948|emb|CAA51580.1| (X73124)
FT                   ipa-24d [Bacillus subtilis] >gi|2636366|emb|CAB15857.1|
FT                   (Z99123) alternate gene name: ipa-24d; similar to
FT                   transcriptional regulator (LysR family) [Bacillus
FT                   subtilis]"
FT   gene            128935..130119
FT                   /locus_tag="SPy_0140"
FT                   /old_locus_tag="SPy0140"
FT   CDS_pept        128935..130119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0140"
FT                   /old_locus_tag="SPy0140"
FT                   /product="putative acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="Best Blastp hit = gb|AAG05389.1|AE004626_8
FT                   (AE004626) acetyl-CoA acetyltransferase [Pseudomonas
FT                   aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33246"
FT                   /db_xref="GOA:Q9A1R4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R4"
FT                   /protein_id="AAK33246.1"
FT                   /translation="MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLK
FT                   SDAIDEVIFGNVLHAGLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQ
FT                   TGNADIVLVGGTENMSQAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAE
FT                   NIVQQYGLTREEQDAFAADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPK
FT                   FGTTVDKLAKLRPAFIKDEGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSY
FT                   ASAGVDPSIMGCGPIPATKKALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKV
FT                   NVNGGAIALGHPIGASGARILVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR"
FT   gene            130131..130790
FT                   /gene="atoD.2"
FT                   /locus_tag="SPy_0141"
FT                   /old_locus_tag="SPy0141"
FT   CDS_pept        130131..130790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoD.2"
FT                   /locus_tag="SPy_0141"
FT                   /old_locus_tag="SPy0141"
FT                   /product="putative acetyl-CoA:acetoacetyl-CoA transferase
FT                   alpha subunit"
FT                   /EC_number="2.8.3.-"
FT                   /note="Best Blastp hit = sp|P76458|ATOD_ECOLI ACETATE
FT                   COA-TRANSFERASE ALPHA SUBUNIT (ACETYL-COA:ACETOACETATE COA
FT                   TRANSFERASE) >gi|7434985|pir||C64992 atoD protein -
FT                   Escherichia coli (strain K-12) >gi|1736876|dbj|BAA16017.1|
FT                   (D90851) Acetyl-CoA:acetoacetyl-CoA transferase a subunit
FT                   (EC 2.8.3.-). [Escherichia coli] >gi|1788551|gb|AAC75281.1|
FT                   (AE000311) acetyl-CoA:acetoacetyl-CoA transferase alpha
FT                   subunit [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33247"
FT                   /db_xref="GOA:Q9A1R3"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R3"
FT                   /protein_id="AAK33247.1"
FT                   /translation="MKENKRIAIAEAISHIKDGDTIMVGGFMANGTPEALIDALVDKGT
FT                   KDLTLICNDAGFVDRGVGKMVANHQFKTIYATHIGLNKEAGRQMTAGETTIELIPQGTF
FT                   AEKIRIGAYGIGGFYTPTGVGTLVAEGKETKTIKGKTYLLEYPFEADVALIFANQADEM
FT                   GNLQYSGSENNFNQLMAACAKTTIVQAREIVPVGTIQPECVHTPHIFVDYIVKEGV"
FT   gene            130793..131440
FT                   /locus_tag="SPy_0142"
FT                   /old_locus_tag="SPy0142"
FT   CDS_pept        130793..131440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0142"
FT                   /old_locus_tag="SPy0142"
FT                   /product="butyrate-acetoacetate CoA-transferase, beta
FT                   subunit"
FT                   /EC_number="2.8.3.9"
FT                   /note="Best Blastp hit = pir||E75600 butyrate-acetoacetate
FT                   CoA-transferase (EC 2.8.3.9) large chain homolog DRA0067
FT                   [similarity] - Deinococcus radiodurans (strain R1)
FT                   >gi|6460542|gb|AAF12248.1|AE001862_74 (AE001862) CoA
FT                   transferase, subunit B [Deinococcus radiodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33248"
FT                   /db_xref="GOA:Q9A1R2"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R2"
FT                   /protein_id="AAK33248.1"
FT                   /translation="MAVALSKEEIQNRIAKRVAKELEDGTLVNLGIGLPTKVANFVPEE
FT                   MTVYFQSENGFIGLGPKSDDPNSTIVNAGGQPVTVYPGAAFFNSADSFGIIRGGHVDLT
FT                   VLGALEIAENGDIANYLIPGKMVPGMGGAMDLLVGAKKVIVAMEHTNKGKHKLLKECTL
FT                   PLTAKGVVDLIITEMGVFKVTPDGIQVIEISEGFTFDEVQAATGVPLSIAEG"
FT   gene            complement(131562..132242)
FT                   /locus_tag="SPy_0144"
FT                   /old_locus_tag="SPy0144"
FT   CDS_pept        complement(131562..132242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0144"
FT                   /old_locus_tag="SPy0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P44761|YHEO_HAEIN HYPOTHETICAL
FT                   PROTEIN HI0575 >gi|1074447|pir||B64155 hypothetical protein
FT                   HI0575 - Haemophilus influenzae (strain Rd KW20)
FT                   >gi|1573564|gb|AAC22233.1| (U32739) conserved hypothetical
FT                   protein [Haemophilus influenzae Rd]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33249"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R1"
FT                   /protein_id="AAK33249.1"
FT                   /translation="MDKETLNYWKTVITFLHDVLGDNYEIILHVIDKNDIYIGELVNSH
FT                   ISGRSKQSPLTTFALDLITNKVYKEKDFVTNYKAIVSPQHKEVRGSTFFIKDKKGNLEG
FT                   MLCINLDISAYQGVARDLLKLVNLNLEHFIPTAKEPKTVTPQPEEAVEILTSNIQDIIG
FT                   QIIDPSLLRHNVHLSQDVKIDIVAKLYEKGVFQLKGAVSKVADILCISEPSVYRYLKKI
FT                   EADQ"
FT   gene            132416..132781
FT                   /locus_tag="SPy_0145"
FT                   /old_locus_tag="SPy0145"
FT   CDS_pept        132416..132781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0145"
FT                   /old_locus_tag="SPy0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||F72630 hypothetical protein
FT                   APE1501 - Aeropyrum pernix (strain K1)
FT                   >gi|5105186|dbj|BAA80500.1| (AP000061) 123aa long
FT                   hypothetical protein [Aeropyrum pernix]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33250"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1R0"
FT                   /protein_id="AAK33250.1"
FT                   /translation="MKSYPEPMGPYSTYTIEGHFLYTAGQLPLNPVTGQLSDGFEAQCR
FT                   QVFVNLQSILAEQKLDLNHIYKLNVYLTDVTNVEILNHVMTDLFEEPYPVRTAVQVSAL
FT                   PLQALIEVEAVARVKQL"
FT   gene            132818..133837
FT                   /locus_tag="SPy_0146"
FT                   /old_locus_tag="SPy0146"
FT   CDS_pept        132818..133837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0146"
FT                   /old_locus_tag="SPy0146"
FT                   /product="putative regulatory protein"
FT                   /note="Best Blastp hit = pir||A43577 regulatory protein
FT                   pfoR - Clostridium perfringens"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33251"
FT                   /db_xref="GOA:Q9A1Q9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Q9"
FT                   /protein_id="AAK33251.1"
FT                   /translation="MDIIIGTSLLILVLAIFSLFNYKAPHGAKAMGALASAACASFLVE
FT                   AFQDSFFGKVLGFQFLSEVGGANGSLSGVAAAILVAIAIGVSPGYAVLIGLSVSGTGII
FT                   PGFVAGYVVSFLIKWMEKNIPGGLDLISIIIVGAPLTRFLAQLITPVINSTLLTIGDIL
FT                   TSSANSNPIIMGMILGGTIVVVATAPLSSMALTAMLGLTGIPMAIGALSVFGSSFMNGV
FT                   LFYRLKLGERKDNIAFAIEPLTQADVTSANPIPIYVTNFVGGAACGVLIALMKLVNDTP
FT                   GTATPIAGFAVMFAYNPVAKVLITALGCIIISLIVGYIGGSVFKNYRLVTKQELQARN"
FT   gene            134292..134612
FT                   /locus_tag="SPy_0147"
FT                   /old_locus_tag="SPy0147"
FT   CDS_pept        134292..134612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0147"
FT                   /old_locus_tag="SPy0147"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33252"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Q8"
FT                   /protein_id="AAK33252.1"
FT                   /translation="MNTLLSLMNSIEQEARTIYDSYDAKKKALADKKEEELKQLFLEYE
FT                   QETQLLLEAKREVFFEANRQEQKASKKRLATQQLALHAILEEHKLTVVRELVDKVVETY
FT                   GH"
FT   gene            134602..136602
FT                   /gene="ntpI"
FT                   /locus_tag="SPy_0148"
FT                   /old_locus_tag="SPy0148"
FT   CDS_pept        134602..136602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpI"
FT                   /locus_tag="SPy_0148"
FT                   /old_locus_tag="SPy0148"
FT                   /product="V-type Na+-ATPase subunit I"
FT                   /EC_number="3.6.3.14"
FT                   /note="Best Blastp hit = sp|P43439|NTPI_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT I (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   I) >gi|1075715|pir||B53610 ntpI protein - Enterococcus
FT                   hirae >gi|487273|dbj|BAA04270.1| (D17462) Na+ -ATPase
FT                   subunit I [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33253"
FT                   /db_xref="GOA:Q9A1Q7"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Q7"
FT                   /protein_id="AAK33253.1"
FT                   /translation="MAISQMKKLAMVFEKDYLDLVLKTLQQSQLVEVRDMKQLKHWQDA
FT                   FNKGNVKLPQIVQYDLTHQKPLLDDEALQYLLQSQQELENGLASLSAFLPPIGKLTALR
FT                   QKTPSLSFKQFEERHRQQAAQTALKMMSQKIERLEQLQSKIDQLTEYCQELEKWRSLTV
FT                   LPQDLAQFHFLSARVGTIPSTANNHFYHQLKQHKGLFIEEVYHTEFEYGLVLFWQAQDT
FT                   IHLQKYQFKPLLYKEQLLPSEQLRINKELLTNWLAEKDSLLKELRQSQKILAQLQVEID
FT                   YVLSQYQRQQTKKQLLGTRHLIALEGWIEADSVNQLKGLMTKTLGDMFYLDSYDVTPDD
FT                   WEDVPIKLRNHRYIAPFELVTEMYALPKYQEKDPTPFLAPLYLTFFGMMVADLGYGLLL
FT                   YAVTLAALVFFNLQKTSKRLVTFFNILAISVAIWGLIYGSFFGFDLPVALLSTKTDVIT
FT                   ILVVSLLFGFVTLIFGLLLGAWQQVRMKAYATAYTSSLAWTFILLGLLLFILGKNVSGL
FT                   AYLSVIGKWLALGNAFGILVVSLLKSKSLLGLGSGLYNLYGISSYLSDLVSFTRLMALG
FT                   LSGASIGAAFNMIVGIFPPVTRFTVGIFIFILLHAINIFLSMLSGYVHGARLIFVEFFG
FT                   KFYEGGGKAFNPLKLADNYVNVNEETDLEDN"
FT   gene            136604..137083
FT                   /gene="ntpK"
FT                   /locus_tag="SPy_0149"
FT                   /old_locus_tag="SPy0149"
FT   CDS_pept        136604..137083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpK"
FT                   /locus_tag="SPy_0149"
FT                   /old_locus_tag="SPy0149"
FT                   /product="V-type Na+-ATPase subunit K"
FT                   /EC_number="3.6.3.14"
FT                   /note="Best Blastp hit = sp|P43457|NTPK_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT K (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   K) (SODIUM ATPASE PROTEOLIPID COMPONENT)
FT                   >gi|1075719|pir||C54392 Na+-ATPase complex 16K proteolipid
FT                   chain - Enterococcus hirae >gi|416405|dbj|BAA03841.1|
FT                   (D16334) Na+-ATPase K subunit [Enterococcus hirae]
FT                   >gi|472919|emb|CAA54237.1| (X76913) v-type Na-ATPase
FT                   [Enterococcus hirae] >gi|487274|dbj|BAA04271.1| (D17462)
FT                   Na+ -ATPase subunit K [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33254"
FT                   /db_xref="GOA:Q9A1Q6"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Q6"
FT                   /protein_id="AAK33254.1"
FT                   /translation="MEHLAHYFTAHGGVFFAALGIVLAVALSGMGSAYGVGKGGQAAAA
FT                   LLKEEPEKFTSALILQLLPGSQGIYGFAIGILIWMKLTPELSVNQGLAYFLVSLPIAIV
FT                   GYFSAKHQGNVSVAGMQILAKRPKDFMKGVILAAMVETYAILAFVVSFILLNKIG"
FT   gene            137151..137735
FT                   /gene="ntpE"
FT                   /locus_tag="SPy_0150"
FT                   /old_locus_tag="SPy0150"
FT   CDS_pept        137151..137735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpE"
FT                   /locus_tag="SPy_0150"
FT                   /old_locus_tag="SPy0150"
FT                   /product="putative V-type Na+-ATPase subunit E"
FT                   /note="Best Blastp hit = sp|P43436|NTPE_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT E (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   E) >gi|487275|dbj|BAA04272.1| (D17462) Na+ -ATPase subunit
FT                   E [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33255"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Q5"
FT                   /protein_id="AAK33255.1"
FT                   /translation="MNDITQLRQNVLEKAHQEGQQCLKIATDSLDTDFKERQQQGLHDL
FT                   KAKRQKELKALEQQFQVAQQQLKNQERQALLALKQDSIKELFEASLEKMTNFSKEEELA
FT                   FLKQVLSKYPEQPLQVTFGEKTGQKFSSYDCAELRLAFPQLSYNQELIPQEAGFLVSLD
FT                   QVDDNYLYRYLLESVLKEESSRIIDMLFSEI"
FT   gene            137751..138749
FT                   /gene="ntpC"
FT                   /locus_tag="SPy_0151"
FT                   /old_locus_tag="SPy0151"
FT   CDS_pept        137751..138749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpC"
FT                   /locus_tag="SPy_0151"
FT                   /old_locus_tag="SPy0151"
FT                   /product="putative V-type Na+-ATPase subunit C"
FT                   /note="Best Blastp hit = sp|P43456|NTPC_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT C (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   C) >gi|1075721|pir||E54392 ntpP protein - Enterococcus
FT                   hirae >gi|472921|emb|CAA54239.1| (X76913) v-type Na-ATPase
FT                   [Enterococcus hirae] >gi|487276|dbj|BAA04273.1| (D17462)
FT                   Na+ -ATPase subunit C [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33256"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Q4"
FT                   /protein_id="AAK33256.1"
FT                   /translation="MPTFLELNTTISVKEKELLTKEQFDKLLQAPNTTTLARLLHQSVY
FT                   HLTVDDLNDLDRLESILMAELTKTYRWAFAETPQPDIVQLFTLRYTYHNVKVLLKAKAS
FT                   QADLSHLLLPIGDKPLVALEHLIRTMTSDEFPKEVVTEIQSIWAEYQDYQDIRVLEIGT
FT                   DLAYFKALKQIAQRLEDPVFQQAVLIVIDLYNLITVRRAKSQNKPISFMMQLLSDEASR
FT                   PSKTFITLEDDKDLMTWFENVTPDSYMTALKPYSEKLRQGTLQTTELEYLVDECLYHLF
FT                   AKAKYQVDGPYVLARFLLAKSFEVKNLRLLAAALANDLPKERVIERMRPIA"
FT   gene            139267..141042
FT                   /gene="ntpA"
FT                   /locus_tag="SPy_0154"
FT                   /old_locus_tag="SPy0154"
FT   CDS_pept        139267..141042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpA"
FT                   /locus_tag="SPy_0154"
FT                   /old_locus_tag="SPy0154"
FT                   /product="putative V-type Na+-ATPase alpha subunit"
FT                   /EC_number="3.6.3.6"
FT                   /note="Best Blastp hit = sp|Q08636|NTPA_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT A (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   A) >gi|421413|pir||A46733 Na+-transporting ATPase (EC
FT                   3.6.1.-) chain A - Enterococcus hirae
FT                   >gi|868004|dbj|BAA04275.1| (D17462) Na+ -ATPase subunit A
FT                   [Enterococcus hirae] >gi|912449|dbj|BAA02969.1| (D13816)
FT                   Na+ -ATPase alpha subunit [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33257"
FT                   /db_xref="GOA:Q9A1Q3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1Q3"
FT                   /protein_id="AAK33257.1"
FT                   /translation="MNQGKIITVSGPLVVASGMQEANIQDICRVGHLGLVGEIIEMRRD
FT                   QASIQVYEETSGIGPGEPVVTTGCPLSVELGPGLISEMFDGIQRPLDRFQKATDSDFLI
FT                   RGVAIPSLDRKAKWAFIPKLSVGQEVVAGDILGTVQETAVIEHRIMVPYKVSGTLVAIH
FT                   AGDFTVTDTVYEIKQEDGSIYQGSLMQTWPVRQSRPVAQKLIPVEPLVTGQRVIDTFFP
FT                   VTKGGAAAVPGPFGAGKTVVQHQIAKFANVDIVIYVGCGERGNEMTDVLNEFPELIDPN
FT                   TGQSIMERTVLIANTSNMPVAAREASIYTGITIAEYFRDMGYSVAIMADSTSRWAEALR
FT                   EMSGRLQEMPGDEGYPAYLGSRIAEYYERAGRVRTLGSQEREGTITAIGAVSPPGGDIS
FT                   EPVTQNTLRIVKVFWGLDAPLAQRRHFPAINWLTSYSLYQDDVGSYIDRKQQSNWSNKV
FT                   TRAMAILQREASLEEIVRLVGLDSLSEQDRLTMAVARQIREDYLQQNAFDSVDTFTSFP
FT                   KQEAMLTNILTFNEEASKALSLGAYFNEIMEGTAQVRDRIARSKFIPEENLEQIKGLTQ
FT                   KVTKEIHHVLAKGGI"
FT   gene            141043..142458
FT                   /gene="ntpB"
FT                   /locus_tag="SPy_0155"
FT                   /old_locus_tag="SPy0155"
FT   CDS_pept        141043..142458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpB"
FT                   /locus_tag="SPy_0155"
FT                   /old_locus_tag="SPy0155"
FT                   /product="putative V-type Na+-ATPase subunit B"
FT                   /EC_number="3.6.1.-"
FT                   /note="Best Blastp hit = sp|Q08637|NTPB_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT B (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   B) >gi|421414|pir||B46733 Na+-transporting ATPase (EC
FT                   3.6.1.-) chain B - Enterococcus hirae
FT                   >gi|391682|dbj|BAA02970.1| (D13816) Na+ -ATPase beta
FT                   subunit [Enterococcus hirae] >gi|487279|dbj|BAA04276.1|
FT                   (D17462) Na+ -ATPase subunit B [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33258"
FT                   /db_xref="GOA:Q9A1Q2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1Q2"
FT                   /protein_id="AAK33258.1"
FT                   /translation="MSVLKEYRTVSEVVGPLMIVDQVAGVHYNELVDITLHNGERRKGQ
FT                   VLEVQGDKAMVQLFEGSTGINLAKTKVRFTGHPLELAVSEDMVGRIFDGMGQPIDGGPE
FT                   LIPEKYLDIDGQAINPVARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHNELA
FT                   AQIARQATVLNSDDNFAVVFAAMGITFEEAEFFMNDLRETGAIDRSVLFINLANDPAIE
FT                   RIATPRIALTTAEYLAYEKGMHVLVIMTDMTNYCEALREVSAARREVPGRRGYPGYLYT
FT                   NLSTLYERAGRLIGKKGSVTQIPILTMPEDDITHPIPDLTGYITEGQIILSQELYKNGF
FT                   RPPINVLPSLSRLKDKGSGEGKTRQDHAATMNQLFAAYAQGKQAKELAVVLGESALSET
FT                   DKLYVAFTNRFEEEYINQGFYTNRSIEESLDLGWELLSILPRTELKRIKDDMLDRYLPK
FT                   ADTTMTKVFVAND"
FT   gene            142503..143129
FT                   /gene="ntpD"
FT                   /locus_tag="SPy_0157"
FT                   /old_locus_tag="SPy0157"
FT   CDS_pept        142503..143129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpD"
FT                   /locus_tag="SPy_0157"
FT                   /old_locus_tag="SPy0157"
FT                   /product="putative V-type Na+-ATPase subunit D"
FT                   /EC_number="3.6.3.14"
FT                   /note="Best Blastp hit = sp|P43435|NTPD_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT D (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   D) >gi|1075711|pir||F53610 H+-transporting ATP synthase (EC
FT                   3.6.1.34) chain D - Enterococcus hirae
FT                   >gi|487280|dbj|BAA04277.1| (D17462) Na+ -ATPase subunit D
FT                   [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33259"
FT                   /db_xref="GOA:Q9A1Q1"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1Q1"
FT                   /protein_id="AAK33259.1"
FT                   /translation="MARLNVKPTRMELSNLKNRLKTATRGHKLLKDKRDELMRRFVDLI
FT                   RENNELRQTIEKELAANMKEFVLAKASENSLMVEELFAVPVHEVTLWIDIENIMSVNVP
FT                   KFHVQSNTAREQEQGEFAYSYLSSNSEMDNTIQKTKELLEKLLRLAEVEKTCQLMADDI
FT                   EKTRRRVNGLEYSIIPQLKETIHYIELKLEEAERASLVRIMKITS"
FT   gene            complement(143249..144511)
FT                   /locus_tag="SPy_0158"
FT                   /old_locus_tag="SPy0158"
FT   CDS_pept        complement(143249..144511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0158"
FT                   /old_locus_tag="SPy0158"
FT                   /product="putative toxic anion resistance protein"
FT                   /note="Best Blastp hit = pir||B69757 toxic anion resistance
FT                   protein homolog yceH - Bacillus subtilis
FT                   >gi|2415745|dbj|BAA22255.1| (AB000617) YceH [Bacillus
FT                   subtilis] >gi|2632580|emb|CAB12088.1| (Z99105) similar to
FT                   toxic anion resistance protein [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33260"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1Q0"
FT                   /protein_id="AAK33260.1"
FT                   /translation="MADFNFDIDQIADNAVIKTDKTTDIISDLPTDTNGQISFFEKLSA
FT                   DQQTAITAKAPALVDTFLADQNALLDFGQSAVEGVNATVNHILAEQKKLQIPQVDDLLK
FT                   STNRELNGFIAKYKDATPVDLDKKPNFLQKLFKQSRDTLQEFYFDSQNIEQKMDSMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIEHLVGVIAFIEASQKEASQRAAALQKDLKTKDS
FT                   ATPDYQIKADLLARTTEVINTLEQQHTEYLSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGMMQQSVKSGMTADAIINANNAALQMLAETSKEAIPALEQSAQ
FT                   NPTLSMKSVTSLAESLVAQNNGIIAAIDHGRKERAQLESAIIRSAETINDSVKLRDQNI
FT                   VQALLSEGKETQKTIDKITRA"
FT   gene            complement(144524..145402)
FT                   /locus_tag="SPy_0159"
FT                   /old_locus_tag="SPy0159"
FT   CDS_pept        complement(144524..145402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0159"
FT                   /old_locus_tag="SPy0159"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAB02852.1| (U59243)
FT                   apolipophorin-III precursor [Bombyx mori]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33261"
FT                   /db_xref="GOA:Q9A1P9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1P9"
FT                   /protein_id="AAK33261.1"
FT                   /translation="MIRKYDRTSTKKKSLNWIWLIIAFFMISSFIGGSSFTESLLDILP
FT                   AIAIGGTGYAIFRVRSHQKRLAKAKIAKQLEDLKAKIQLADRKVRLLDTYLADHDDFQY
FT                   NVLAQQLLPQLSDIKAKAITLKDQLDPQIYRRITKKANDVESDITLQLETLQIATTLNP
FT                   QPLKTPSPNLINKAPELKPYYDNIQTDHQAILAKIQGADNQEELLALHDANMRRFEDIL
FT                   TGYLKIKEEPKNYYNAAARLEQAKQAIQQFDEDLDETLRRLNESDLKDFDISLRIMQGA
FT                   TQRRTTHHQKD"
FT   gene            145840..147132
FT                   /gene="purA"
FT                   /locus_tag="SPy_0160"
FT                   /old_locus_tag="SPy0160"
FT   CDS_pept        145840..147132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SPy_0160"
FT                   /old_locus_tag="SPy0160"
FT                   /product="putative adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Best Blastp hit = pir||A42280 adenylosuccinate
FT                   synthase (EC 6.3.4.4) purA - Bacillus subtilis
FT                   >gi|467328|dbj|BAA05174.1| (D26185) adenylosuccinate
FT                   synthetase [Bacillus subtilis] >gi|2636589|emb|CAB16079.1|
FT                   (Z99124) adenylosuccinate synthetase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33262"
FT                   /db_xref="GOA:Q9A1P8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1P8"
FT                   /protein_id="AAK33262.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPQKISVIGNGVVVNPKSLVKELAYLHDEGVTTDNLRISDRAHV
FT                   ILPYHIQLDQLQEDAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRIN
FT                   LAEKNRLFEKMYDSTPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPNKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDGKRIDYYPANLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRR
FT                   VGELVGVRISTFSVGPGREQTNILESVWASI"
FT   gene            147474..148502
FT                   /locus_tag="SPy_0163"
FT                   /old_locus_tag="SPy0163"
FT   CDS_pept        147474..148502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0163"
FT                   /old_locus_tag="SPy0163"
FT                   /product="putative ABC transporter (lipoprotein)"
FT                   /note="Best Blastp hit = sp|O05252|YUFN_BACSU HYPOTHETICAL
FT                   LIPOPROTEIN YUFN PRECURSOR >gi|7429430|pir||C70009 ABC
FT                   transporter (lipoprotein) homolog yufN - Bacillus subtilis
FT                   >gi|1934811|emb|CAB07936.1| (Z93937) unknown [Bacillus
FT                   subtilis] >gi|2635650|emb|CAB15143.1| (Z99120) similar to
FT                   ABC transporter (lipoprotein) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33263"
FT                   /db_xref="GOA:Q9A1P7"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1P7"
FT                   /protein_id="AAK33263.1"
FT                   /translation="MSLGLVSTALFTLGGCTNNSAKQTTDNSLKIAMITNQTGIDDKSF
FT                   NQSAWEGLQAWGKENKLEKGKGYDYFQSANESEFTTNLESAVTNGYNLVFGIGFPLHDA
FT                   VEKVAANNPDNHFAIVDDVIKGQKNVASITFSDHEAAYLAGVAAAKTTKTKQVGFVGGM
FT                   EGDVVKRFEKGFEAGVKSVDDTIKVRVAYAGSFADAAKGKTIAAAQYAEGADVIYHAAG
FT                   GTGAGVFSEAKSINEKRKEEDKVWVIGVDRDQSEDGKYTTKDGKSANFVLTSSIKEVGK
FT                   ALVKVAVKTSEDQFPGGQITTFGLKEGGVSLTTDALTQDTKKAIEAAKKAIIEGTITVP
FT                   EN"
FT   gene            148675..149214
FT                   /gene="nusG"
FT                   /locus_tag="SPy_0164"
FT                   /old_locus_tag="SPy0164"
FT   CDS_pept        148675..149214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="SPy_0164"
FT                   /old_locus_tag="SPy0164"
FT                   /product="putative transcription antitermination factor"
FT                   /note="Best Blastp hit = sp|P36264|NUSG_STACA TRANSCRIPTION
FT                   ANTITERMINATION PROTEIN NUSG >gi|487095|pir||S38870
FT                   transcription antitermination factor nusG - Staphylococcus
FT                   carnosus >gi|426473|emb|CAA53738.1| (X76134) nusG
FT                   [Staphylococcus carnosus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33264"
FT                   /db_xref="GOA:P68893"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68893"
FT                   /protein_id="AAK33264.1"
FT                   /translation="MLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIP
FT                   TQTVNVEKNGQTKEIEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTP
FT                   LLEEEIRAILLSMGQTIDVFDTNIKEGDVVQIIDGAFMGQEGRVVEIENNKVKLMLNMF
FT                   GSETVAEVELYQIAEL"
FT   gene            149586..150929
FT                   /gene="nga"
FT                   /locus_tag="SPy_0165"
FT                   /old_locus_tag="SPy0165"
FT   CDS_pept        149586..150929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nga"
FT                   /locus_tag="SPy_0165"
FT                   /old_locus_tag="SPy0165"
FT                   /product="nicotine adenine dinucleotide glycohydrolase
FT                   precursor"
FT                   /note="Best Blastp hit = gb|AAF19837.1|AF203371_1
FT                   (AF203371) nicotine adenine dinucleotide glycohydrolase
FT                   precursor [Streptococcus pyogenes]
FT                   >gi|6635479|gb|AAF19838.1|AF203372_1 (AF203372) nicotine
FT                   adenine dinucleotide glycohydrolase precursor
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33265"
FT                   /db_xref="GOA:Q7DAN2"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010900"
FT                   /db_xref="InterPro:IPR041934"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAN2"
FT                   /protein_id="AAK33265.1"
FT                   /translation="MRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKENKK
FT                   SDVKYETTKVMEANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFASPMHI
FT                   GRILIVNGDTSSKENYYKKNRIAKADVKYYNRNKLVLFQKIELGDTYTKKPHHIEIDKK
FT                   LDVDRIDIEVTEVHQGQNKDILALSEVTFGNIERDIFEKKFKEIKDKWVTDKQADEFIE
FT                   TADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDVM
FT                   LAFDDAKKKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKDVDSGKYSDGV
FT                   YQYEYDSELTKNIDKLGYIRTASGDTPGANSLNVPGCQTWSGKHIENSESELIFPSISV
FT                   KDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDRK"
FT   gene            151063..151419
FT                   /locus_tag="SPy_0166"
FT                   /old_locus_tag="SPy0166"
FT   CDS_pept        151063..151419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0166"
FT                   /old_locus_tag="SPy0166"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAB37625.1| (U80437) C43E11.11
FT                   gene product [Caenorhabditis elegans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33266"
FT                   /db_xref="InterPro:IPR032002"
FT                   /db_xref="InterPro:IPR038509"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1P6"
FT                   /protein_id="AAK33266.1"
FT                   /translation="MEDISDPEVILEYGVYPAFIKGYTQLKANIEEALLEMSNSGQALD
FT                   IYQAVQTLNAENMLLNYYESLPFYLNRQSILANMTKALKDAHIREAMAHYKLGEFAHYQ
FT                   DTMLDMVERTIKTF"
FT   gene            151443..153158
FT                   /gene="slo"
FT                   /locus_tag="SPy_0167"
FT                   /old_locus_tag="SPy0167"
FT   CDS_pept        151443..153158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slo"
FT                   /locus_tag="SPy_0167"
FT                   /old_locus_tag="SPy0167"
FT                   /product="streptolysin O precursor"
FT                   /note="Best Blastp hit = sp|P21131|TACY_STRPY STREPTOLYSIN
FT                   O PRECURSOR (THIOL-ACTIVATED CYTOLYSIN)
FT                   >gi|98069|pir||A43507 streptolysin O precursor -
FT                   Streptococcus pyogenes >gi|153811|gb|AAA26975.1| (M18638)
FT                   streptolysin O precursor (put.; start may be at 190);
FT                   putative [Plasmid pMK157]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33267"
FT                   /db_xref="GOA:P0C0I3"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0I3"
FT                   /protein_id="AAK33267.1"
FT                   /translation="MSNKKTFKKYSRVAGLLTAALIIGNLVTANAESNKQNTASTETTT
FT                   TNEQPKPESSELTTEKAGQKTDDMLNSNDMIKLAPKEMPLESAEKEEKKSEDKKKSEED
FT                   HTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTPVDI
FT                   SIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGDKATVEVNDPTY
FT                   ANVSTAIDNLVNQWHDNYSGGNTLPARTQYTESMVYSKSQIEAALNVNSKILDGTLGID
FT                   FKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKELQRKGVSNEAPPLFVS
FT                   NVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGGDAA
FT                   EHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRTEYVETTST
FT                   EYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVIPLG
FT                   ANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITYK"
FT   gene            153408..153836
FT                   /locus_tag="SPy_0168"
FT                   /old_locus_tag="SPy0168"
FT   CDS_pept        153408..153836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0168"
FT                   /old_locus_tag="SPy0168"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF63946.1|AF157531_1
FT                   (AF157531) IceA1 [Helicobacter pylori]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33268"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1P5"
FT                   /protein_id="AAK33268.2"
FT                   /translation="MKQQSYQPLRFVYLLVALFAALLLIARPVMADEGTNSADAAYYKG
FT                   QSAGEEAGKKAGKEATWTDLTPTVPTNPETPSDIGETTNKQLYKEGYKDGYKEGYNEGW
FT                   KSQYPVLTPVKVIWDLISYWLQRLFPNNQSSTAAQSMS"
FT   gene            complement(154038..154238)
FT                   /locus_tag="SPy_0169"
FT                   /old_locus_tag="SPy0169"
FT   CDS_pept        complement(154038..154238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0169"
FT                   /old_locus_tag="SPy0169"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33269"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1P4"
FT                   /protein_id="AAK33269.1"
FT                   /translation="MKKKLSLFMIATAAVVSLSLATPENQTVSAYEVTATRDASVCWTC
FT                   CPLTCLKYNVEDWYKAVTSFF"
FT   gene            complement(154650..154817)
FT                   /locus_tag="SPy_0170"
FT                   /old_locus_tag="SPy0170"
FT   CDS_pept        complement(154650..154817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0170"
FT                   /old_locus_tag="SPy0170"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33270"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1P3"
FT                   /protein_id="AAK33270.1"
FT                   /translation="MKKKLSLFMIATAAVAGLSLATLGDHQTVSANDASYSNGFYGHTG
FT                   PDSWLLYTVW"
FT   gene            complement(155002..155328)
FT                   /locus_tag="SPy_0171"
FT                   /old_locus_tag="SPy0171"
FT   CDS_pept        complement(155002..155328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0171"
FT                   /old_locus_tag="SPy0171"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = sp|Q90827|NEL_CHICK NEL PROTEIN
FT                   PRECURSOR (93 KD PROTEIN) >gi|1483184|dbj|BAA13167.1|
FT                   (D86747) Mr 93 K protein [Gallus gallus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1P2"
FT                   /protein_id="AAK33271.1"
FT                   /translation="MKNKLFLVALATVTVLGPSLATPHHQTVHASDVTLTETCDKNGTV
FT                   CFGYENVDGEVCKLTADGKGTICVGYENRDIKESETSSTKNDCSNWFWCFLNYLWTTIK
FT                   SWVS"
FT   gene            155812..156951
FT                   /gene="metB"
FT                   /locus_tag="SPy_0172"
FT                   /old_locus_tag="SPy0172"
FT   CDS_pept        155812..156951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="SPy_0172"
FT                   /old_locus_tag="SPy0172"
FT                   /product="putative cystathionine beta-lyase"
FT                   /note="Best Blastp hit = dbj|BAB05347.1| (AP001512)
FT                   cystathionine beta-lyase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33272"
FT                   /db_xref="GOA:Q9A1P1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1P1"
FT                   /protein_id="AAK33272.1"
FT                   /translation="MRENTTLLHGYTVIDEFTGAASVPIYQTSTFHNSELYCPSQKHLY
FT                   TRFSNPTTEALEDGLACLEKATYAVAYASGMAAISTVLMLLKAGDHVIFPLEVYGGTCQ
FT                   FATAILPNYQIETSFVDMADLATVKASIRPNTRMIYLETPSNPLLKICDISELVQLAKA
FT                   YGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKFINGHSDVVAGLAATNNEAIYNQLKL
FT                   FQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKNAQQLANYLAKHPKVLKVHYPGLDSH
FT                   PNHDTHLQQAKNGGAVLSFELASKEELMTFTHRIQLPILAVSLGGVESILSHPATMSHA
FT                   CLSPQARLEQGVVDGLLRLSCGVENIEDLLADFEQALAF"
FT   gene            157126..159627
FT                   /gene="leuS"
FT                   /locus_tag="SPy_0173"
FT                   /old_locus_tag="SPy0173"
FT   CDS_pept        157126..159627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SPy_0173"
FT                   /old_locus_tag="SPy0173"
FT                   /product="putative leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="Best Blastp hit = sp|P36430|SYL_BACSU LEUCYL-TRNA
FT                   SYNTHETASE (LEUCINE-TRNA LIGASE) (LEURS)
FT                   >gi|7437539|pir||D69650 leucine-tRNA ligase (EC 6.1.1.4) -
FT                   Bacillus subtilis >gi|2293181|gb|AAC00259.1| (AF008220)
FT                   leucine tRNA synthetase [Bacillus subtilis]
FT                   >gi|2635516|emb|CAB15010.1| (Z99119) leucyl-tRNA synthetase
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33273"
FT                   /db_xref="GOA:Q9A1P0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1P0"
FT                   /protein_id="AAK33273.1"
FT                   /translation="MTFYDHTAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRFKRAQGHNILHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKDMQRN
FT                   WIGKSTGANVTFKVKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDAITTADQAEAVA
FT                   KYKRQASLKSDLARTDLAKEKTGVWTGAYAINPVNGNEMPVWIADYVLASYGTGAIMAV
FT                   PAHDERDWEFAKQFKLDIIPVLEGGNVEEAAFTEDGLHINSGFLDGLDKASAIAKMVEW
FT                   LEAEGVGNEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIR
FT                   PSGTGESPLANVTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEE
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DSRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITTKEITEENSGALDKVYNETVKAVTE
FT                   QVDQMKFNTAIAQLMVFVNAANKEDKLFSDYAKGFVQLIAPFAPHLGEELWQALTASGE
FT                   SISYVPWPSYDESKLVENDVEIVVQIKGKVKAKLVVAKDLSREELQEVALANEKVQAEI
FT                   AGKDIIKVIAVPNKLVNIVIK"
FT   gene            159940..161367
FT                   /locus_tag="SPy_0174"
FT                   /old_locus_tag="SPy0174"
FT   CDS_pept        159940..161367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0174"
FT                   /old_locus_tag="SPy0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P39301|SGAT_ECOLI PUTATIVE
FT                   TRANSPORT PROTEIN SGAT >gi|7466018|pir||D65230 hypothetical
FT                   52.9 kD protein in aidB-rpsF intergenic region -
FT                   Escherichia coli (strain K-12) >gi|2367358|gb|AAC77150.1|
FT                   (AE000491) orf, hypothetical protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33274"
FT                   /db_xref="GOA:Q9A1N9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N9"
FT                   /protein_id="AAK33274.1"
FT                   /translation="MLLAPLNWFSQNILQNPAFFVGLLVLIGYLLLKKPIYEVFAGFVK
FT                   ATVGYLILNVGAGGLVTTFRPILVALAKKFELKAAVIDPYFGLAAANTKLEEMGFISVA
FT                   TTALLIGFGVNILLVALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQFQNAFGAWA
FT                   VGIICGLYWAISSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLDNL
FT                   KLPTFLNIFHDTVVASATLMLVFFGAILAVLGPDIMSDVDLIGPGAFNPAKQAFFMYIL
FT                   QTSLTFSVYLFILMQGVRMFVSELTNAFQGISSKLLPGSFPAVDVAASYGFGSSNAVLS
FT                   GFAFGLIGQLITIALLVIFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSFIS
FT                   GILQVALGAVAVGLLGLTGGYHGNIDLVLPWLPFGYLFKFLGIAGYVLVCIFLLAIPQL
FT                   QFAKAKDKEAYYRGEAQ"
FT   gene            161438..161716
FT                   /locus_tag="SPy_0175"
FT                   /old_locus_tag="SPy0175"
FT   CDS_pept        161438..161716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0175"
FT                   /old_locus_tag="SPy0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P39302|PTXB_ECOLI UNKNOWN
FT                   PENTITOL PHOSPHOTRANSFERASE ENZYME II, B COMPONENT
FT                   >gi|1361123|pir||S56419 hypothetical 10.9K protein
FT                   (aidB-rpsF intergenic region) - Escherichia coli
FT                   >gi|537035|gb|AAA97090.1| (U14003) ORF_o101 [Escherichia
FT                   coli] >gi|1790638|gb|AAC77151.1| (AE000491) orf,
FT                   hypothetical protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33275"
FT                   /db_xref="GOA:Q9A1N8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N8"
FT                   /protein_id="AAK33275.1"
FT                   /translation="MVKVLTACGNGMGSSMVIKMKVENALRQLGVTDIQSASCSVGEAK
FT                   GLASGYDIVVASNHLIHELDGRTKGHLVGLDNLMDDNEIKTKLQEVL"
FT   gene            161838..162323
FT                   /locus_tag="SPy_0176"
FT                   /old_locus_tag="SPy0176"
FT   CDS_pept        161838..162323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0176"
FT                   /old_locus_tag="SPy0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||S56420 hypothetical protein
FT                   o158 - Escherichia coli >gi|537036|gb|AAA97091.1| (U14003)
FT                   ORF_o158 [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33276"
FT                   /db_xref="GOA:Q9A1N7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="PDB:2OQT"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N7"
FT                   /protein_id="AAK33276.1"
FT                   /translation="MNLKQAFIDNNSIRLGLSADTWQEAVRLAVQPLIDSKAVTSAYYD
FT                   AIIASTEKYGPYYVLMPGMAMPHAEAGLGVNRNAFALITLTKPVTFSDGKEVSVLLTLA
FT                   ATDPSIHTTVAIPQIVALFELDNAIERLVACQSPKEVLEMVEESKDSPYLEGMDLNA"
FT   gene            162414..163076
FT                   /locus_tag="SPy_0177"
FT                   /old_locus_tag="SPy0177"
FT   CDS_pept        162414..163076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0177"
FT                   /old_locus_tag="SPy0177"
FT                   /product="putative hexulose-6-phosphate synthase"
FT                   /note="Best Blastp hit = sp|P39304|SGAH_ECOLI PROBABLE
FT                   HEXULOSE-6-PHOSPHATE SYNTHASE (HUMPS) (D-ARABINO 3-HEXULOSE
FT                   6-PHOSPHATE FORMALDEHYDE LYASE) >gi|1361156|pir||S56421
FT                   hypothetical 23.6K protein (aidB-rpsF intergenic region) -
FT                   Escherichia coli >gi|537037|gb|AAA97092.1| (U14003)
FT                   ORF_o216 [Escherichia coli] >gi|1790640|gb|AAC77153.1|
FT                   (AE000491) probable hexulose-6-phosphate synthase
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33277"
FT                   /db_xref="GOA:Q9A1N6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N6"
FT                   /protein_id="AAK33277.1"
FT                   /translation="MTHIPNLQVALDHSDLQGAVKAAVAVGHEVDVIEAGTVCLLQVGS
FT                   ELVEVLRSLFPEKIIVADTKCADAGGTVAKNNAKRGADWMTCICCATIPTMEAALKAIK
FT                   EERGDRGEIQIELYGDWTYEQAQLWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKTL
FT                   IDMGFRVSVTGGLDVDTLRLFEGVDVFTFIAGRGITEAEDPAAAARAFKDEIKRIWG"
FT   gene            163081..163944
FT                   /locus_tag="SPy_0178"
FT                   /old_locus_tag="SPy0178"
FT   CDS_pept        163081..163944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0178"
FT                   /old_locus_tag="SPy0178"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /note="Best Blastp hit = sp|P44990|SGBU_HAEIN PUTATIVE
FT                   HEXULOSE-6-PHOSPHATE ISOMERASE (HUMPI)
FT                   >gi|1074611|pir||G64164 hypothetical protein HI1026 -
FT                   Haemophilus influenzae (strain Rd KW20)
FT                   >gi|1574058|gb|AAC22686.1| (U32783) hexulose-6-phosphate
FT                   isomerase, putative [Haemophilus influenzae Rd]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33278"
FT                   /db_xref="GOA:Q9A1N5"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N5"
FT                   /protein_id="AAK33278.1"
FT                   /translation="MARPIGIYEKATPKQFTWRERLQFAKDLGFDFVEMSVDESDARLA
FT                   RLEWTKEERLDLVKAIYETGIRIPTICFSGHRRYPLGSNDPAIEAKSLKLMKQCIELAQ
FT                   DLGVRTIQLAGYDVYYEKKSPETRARFIKNLRQSCDWAEEAQVMLSIEIMDDPFINSIE
FT                   KYLAVEKEIDSPYLFVYPDAGNVSAWHNDLWSEFYNGHKSIAALHLKDTYAVTETSKGQ
FT                   FRDVPFGQGCVDWQELFAVLKKTNYNGPFLIEMWSENCDTVEETKAAIKEAQDFLYPLI
FT                   EKAGLT"
FT   gene            163946..164650
FT                   /gene="araD"
FT                   /locus_tag="SPy_0179"
FT                   /old_locus_tag="SPy0179"
FT   CDS_pept        163946..164650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="SPy_0179"
FT                   /old_locus_tag="SPy0179"
FT                   /product="putative L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="Best Blastp hit = gb|AAD45716.1|AF160811_4
FT                   (AF160811) L-ribulose 5-phosphate 4-epimerase [Bacillus
FT                   stearothermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33279"
FT                   /db_xref="GOA:Q9A1N4"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N4"
FT                   /protein_id="AAK33279.1"
FT                   /translation="MAKNLQEMRERVCAANKSLPQHGLVKFTWGNVSEVCRELGRIVIK
FT                   PSGVDYDLLTPENMVVTDLDGNVVEGDLNPSSDLPTHVELYKAWPEVGGIVHTHSTEAV
FT                   GWAQAGRDIPFYGTTHADYFYGPVPCARSLTKAEVDGAYEQETGNVILEEFSKRGLDPM
FT                   AVPGIVVRNHGPFTWGKTPEQAVYHSVVLEEVARMNRLTEQINPRVEPAPRYIMDKHYL
FT                   RKHGPNAYYGQK"
FT   gene            164708..164854
FT                   /locus_tag="SPy_0180"
FT                   /old_locus_tag="SPy0180"
FT   CDS_pept        164708..164854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0180"
FT                   /old_locus_tag="SPy0180"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33280"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N3"
FT                   /protein_id="AAK33280.1"
FT                   /translation="MLIIVWASPFDLSFSMNCLNANEHKLDEPYVVEFLETRYKVLVLD
FT                   QLR"
FT   gene            164978..166621
FT                   /locus_tag="SPy_0181"
FT                   /old_locus_tag="SPy0181"
FT   CDS_pept        164978..166621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0181"
FT                   /old_locus_tag="SPy0181"
FT                   /product="putative transcriptional regulator"
FT                   /note="Best Blastp hit = dbj|BAB03939.1| (AP001507) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33281"
FT                   /db_xref="GOA:Q9A1N2"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N2"
FT                   /protein_id="AAK33281.1"
FT                   /translation="MILDKKSYDLLSYLLKLETPETVMAISHALNQSRRKVYYQLDKIN
FT                   QALPKGVDQIISYPRLGILLTADQKAACRLLLEEVTDYNYVMKSDERRRLSSIYIAVST
FT                   ERVTIDKLMQINDVSRNTILNDLTELREELEDKQYKIQLHATKARGYYFGCHPMALIQY
FT                   LYKLLVDVYQGGNTSFIDIFNRKLSEIQGLSVYFSKDILTYFHEYLFLSQASLGKTINT
FT                   QDSQFMLQILPFMLLSYRNMRLDSETKSALKQEFHLIWKRKEYHIAQDLARELYHNFKL
FT                   HLDDIEVSMVAMLMLSFRKDQDHHVESQDYDDMRATISHFIDQLESRYQLHFTHKQDLL
FT                   KRLTTHCKALVYRKAYGIFLVNPLTDHVKEKYEELFAMTQSCATILEQDWTISLTDDDI
FT                   AYLTIHLGGELRHNNTEQEKTKLVIVSDDGIGIQKLLFKQCQRYLANGQIEAVFTTEQY
FT                   QSVYDLLAVDMIVATTDTLKTKIPMLIVNPILSDDDIIKLIRFSKQGRLSEHSRFSTEL
FT                   TKAIEAVVKDESDRYALVSKIEKLIHRELL"
FT   gene            166874..167965
FT                   /locus_tag="SPy_0182"
FT                   /old_locus_tag="SPy0182"
FT   CDS_pept        166874..167965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0182"
FT                   /old_locus_tag="SPy0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P39300|YJFR_ECOLI HYPOTHETICAL
FT                   40.1 KD PROTEIN IN AIDB-SGAT INTERGENIC REGION"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33282"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N1"
FT                   /protein_id="AAK33282.1"
FT                   /translation="MTKVQDITRESWILNTFPEWGTWLNEEIEQEVVPADNFAMWWLGN
FT                   CGIWIKTPGGANVVMDLWSNRGKATKQVKDMVRGHQMANMAGARKLQPNLRAQPMVIDP
FT                   FMINELDYYLVSHYHSDHIDINTAAAIINNPKLNHVKFVGPYECGEVWKNWGVPKDRIM
FT                   ILKPGDSFEFKDIKITAVESFDRTCLVTLPIQGADAQDGDLAGLAITDDDMARKAVNYI
FT                   FETPGGTIYHGADSHFSNYFAKHGRDYDIDVVLNNYGENPIGIQDKMTSVDLLRMAENL
FT                   RAKVVIPVHYDIWSNFMASTDEILELWKMRKERLQYDFHPFIWEVGGKYTYPQDQNRIE
FT                   YHHPRGFDDCFLEDSNIQFKALL"
FT   gene            168453..169649
FT                   /gene="opuAA"
FT                   /locus_tag="SPy_0183"
FT                   /old_locus_tag="SPy0183"
FT   CDS_pept        168453..169649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="SPy_0183"
FT                   /old_locus_tag="SPy0183"
FT                   /product="putative glycine betaine/proline ABC transporter
FT                   (ATP-binding protein)"
FT                   /note="Best Blastp hit = gb|AAF37878.1|AF234619_1
FT                   (AF234619) OpuAA [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33283"
FT                   /db_xref="GOA:Q9A1N0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1N0"
FT                   /protein_id="AAK33283.1"
FT                   /translation="METILEVKHLSKIFGKKQKAALEMVKTGKNKSEIFKKTGATVGVY
FT                   DASFEVKKGEIFVIMGLSGSGKSTLVRMLNRLIEPSAGSILLEGKDISTMSADQLREVR
FT                   RHDINMVFQSFALFPHKTILENTEFGLELRGVPKEERQRLAEKALDNSGLLDFKDQYPN
FT                   QLSGGMQQRVGLARALANSPKILLMDEAFSALDPLIRREMQDELLDLQDSMKQTIIFIS
FT                   HDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANDFVREFVEDVDRSKVLTAQNIMI
FT                   KPLTTTVELDGPQVALNRMHNEEVSMLMATNRRRQLVGSLTADAAIEARKKGLPLSEVI
FT                   DRDVRTVSKDTIITDILPLIYDSSAPIAVTDDNNRLLGVIIRGRVIEALANISDEDLN"
FT   gene            169665..171392
FT                   /gene="opuABC"
FT                   /locus_tag="SPy_0184"
FT                   /old_locus_tag="SPy0184"
FT   CDS_pept        169665..171392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuABC"
FT                   /locus_tag="SPy_0184"
FT                   /old_locus_tag="SPy0184"
FT                   /product="putative glycine-betaine binding permease
FT                   protein"
FT                   /note="Best Blastp hit = gb|AAF37879.1|AF234619_2
FT                   (AF234619) OpuABC [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33284"
FT                   /db_xref="GOA:Q9A1M9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M9"
FT                   /protein_id="AAK33284.1"
FT                   /translation="METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMT
FT                   KTLLFIHPLLFIVLVTAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVA
FT                   SLISVLIGIPLGIWMAKNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFAS
FT                   VIFALPPTVRFTNLAIRDIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMM
FT                   LALSMVVTGSMIGAPGLGREVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSKPQ
FT                   EKAKAGKTNKWIGLAALAVFLIAALGRGIMAMTSGMADKGETVNIAYVQWDSEVASTHV
FT                   IAEVLKNEGYHVTLTPLDNAVMWQTVANGNADFSTSAWLPVTHGQQYQKYKSKLDDLGP
FT                   NLKGTKLGLAVPKYMTDVNSIEDLSKQADQKITGIEPGAGIMAAAQKTLKEYHNLSSWE
FT                   LVAASTGAMTTSLDQAIKKKDPIVVTAWSPHWMFAKYDLKYLKDPKEIFGSTENINTIA
FT                   RKGLKKELPNVYKIIDKFHWTQKDMEAVMLDINKGMSPEAAAKKWVEANKSKVSSWTK"
FT   gene            171523..174165
FT                   /gene="polA"
FT                   /locus_tag="SPy_0185"
FT                   /old_locus_tag="SPy0185"
FT   CDS_pept        171523..174165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="SPy_0185"
FT                   /old_locus_tag="SPy0185"
FT                   /product="DNA-directed DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="Best Blastp hit = sp|P13252|DPO1_STRPN DNA
FT                   POLYMERASE I (POL I) >gi|98023|pir||A32949 DNA-directed DNA
FT                   polymerase (EC 2.7.7.7) - Streptococcus pneumoniae
FT                   >gi|153765|gb|AAA26954.1| (J04479) DNA polymerase I
FT                   [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33285"
FT                   /db_xref="GOA:Q9A1M8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M8"
FT                   /protein_id="AAK33285.1"
FT                   /translation="MENKNKLLLIDGSSVAFRAFFALYNQIDRFKNHSGLHTNAIYGFH
FT                   LMLDHMMKRVQPTHVLVAFDAGKTTFRTEMYADYKAGRAKTPEEFREQFPYIREMLTAL
FT                   GIAYYELEHYEADDIIGTLDKMAERTEVPFDVTIVSGDKDLIQLTDENTVVEISKKGVA
FT                   EFEEFTPAYLMEKMGLTPNQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLHEFGSLEGI
FT                   YEHIDGFKTSKMKENLINDRDQAFLSKTLATINTASPITIGLDDIVYNGPDVASLSQFY
FT                   DEMDFVQLKKGLASQMPQEPVAVISYQEVTNVSADLFSAEDIFYFETLRDNYHREAIIG
FT                   FAWGHGEQIYASTDLGLLATDSFKQVFQKPIATYDFKRSKVLLSHLGIELVAPSYDARL
FT                   ANYLLSTVEDNELSTIARIFTDISLEEDDTVYGKGAKRAVPDKDVLLEHLARKVKVLLD
FT                   SKSQMLDKLTAHEQLDLYQNIELPLANVLAKMEIEGIKVNRATLQDMAEQNKVIIEALT
FT                   QEIYDMAGQEFNINSPKQLGSILFEKMQLPLEMTKKTKTGYSTAVNVLERLAPIAPIVA
FT                   KILDYRQITKLQSTYVIGLQDYILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPIRLEQ
FT                   GRLIRKAFTPSHEDAVLLSSDYSQIELRVLAHISGDEHLIAAFNEGADIHTSTAMRVFG
FT                   IDRAADVTANDRRNAKAVNFGIVYGISDFGLSNNLGITRKQAKSYIDTYFERYPGIKAY
FT                   MENVVREAKDKGYVETLFKRRRELPDINSRNFNVRSFAERTAINSPIQGSAADILKIAM
FT                   INLDKALQAGGFRAKMLLQVHDEIVLEVPNDELTAIKKLVKDTMEAAVDLAVPLCVDES
FT                   TGHSWYEAK"
FT   gene            174352..174807
FT                   /locus_tag="SPy_0186"
FT                   /old_locus_tag="SPy0186"
FT   CDS_pept        174352..174807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0186"
FT                   /old_locus_tag="SPy0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB05860.1| (AP001514) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33286"
FT                   /db_xref="GOA:Q9A1M7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M7"
FT                   /protein_id="AAK33286.1"
FT                   /translation="MIYSFQNPSEDVLKAYLESAKTIAVVGLSDRKDTAAYGVAKFMQA
FT                   MDYRIIPVNPKLAGQLILGEKVYASIKAIPFEVDIVDVFRRSEFLPEVARDFLAGQAKV
FT                   FWAQLGLENQEAQTILRSAGKEAIVMNRCLKIDYLQLVAKPECITNH"
FT   gene            174859..175326
FT                   /gene="spf"
FT                   /locus_tag="SPy_0187"
FT                   /old_locus_tag="SPy0187"
FT   CDS_pept        174859..175326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spf"
FT                   /locus_tag="SPy_0187"
FT                   /old_locus_tag="SPy0187"
FT                   /product="Ferric transport regulator protein"
FT                   /note="Best Blastp hit = gb|AAB18795.1| (U76538) Fur-like
FT                   protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33287"
FT                   /db_xref="GOA:Q9A1M6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M6"
FT                   /protein_id="AAK33287.1"
FT                   /translation="MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHP
FT                   SADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVC
FT                   EICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQAKDQPDF"
FT   gene            175482..175781
FT                   /gene="vlg"
FT                   /locus_tag="SPy_0188"
FT                   /old_locus_tag="SPy0188"
FT   CDS_pept        175482..175781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vlg"
FT                   /locus_tag="SPy_0188"
FT                   /old_locus_tag="SPy0188"
FT                   /product="regulatory protein"
FT                   /note="Best Blastp hit = gb|AAB18796.1| (U76538) VirR-like
FT                   protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33288"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M5"
FT                   /protein_id="AAK33288.1"
FT                   /translation="MFLTWENLFLTNQSRRRLKLLVVERSYNNVGNFLKEYFGGFFEIV
FT                   NFDDLRLTMVDMVSLSSEYDVIVTDMILEQTTDSEILFFNQMAPSVVANRLTDM"
FT   gene            176003..177337
FT                   /locus_tag="SPy_0189"
FT                   /old_locus_tag="SPy0189"
FT   CDS_pept        176003..177337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0189"
FT                   /old_locus_tag="SPy0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAG05515.1|AE004640_4
FT                   (AE004640) conserved hypothetical protein [Pseudomonas
FT                   aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33289"
FT                   /db_xref="GOA:Q9A1M4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M4"
FT                   /protein_id="AAK33289.1"
FT                   /translation="MKKYLNQNVYDALIERLHFLFNDFPIVYISFSGGKDSGLLLNILL
FT                   DFRDKYYPDREIGVFHQDFEAQYSLTTKYVQETFTSLEGRKKVSLYWVCLPMATRTALS
FT                   SYEMFWYPWDDKTEDIWVRPMPSQDYVINLENNSITTYRYKMNQEDLAKQFGRWYKQIH
FT                   GNQKTVCILGNRASESLHRYSGFINKKYGYQKECWITKQFKDVWTASPLYDWSVEDIWH
FT                   AYYKFSYSYNELYDLFYKAGLKPSQMRVASPFQDYAVDSLNLYRIIDQETWVKLLGRVQ
FT                   GVNFSNIYGRTKAMGYKSIALPKGHSWKSYTQFLLSTLPVRLRNNYVRKFNKSIDFWHK
FT                   TGGGLAEETINELIEKGYRIARNGISNYTSFKHSRVIFLDQIPDDTDDIVTTKDIPSWK
FT                   RMCFCILKNDHICRTMGFGLTREQQKIVAFLKEKYKTSLKELESE"
FT   gene            177330..177860
FT                   /locus_tag="SPy_0190"
FT                   /old_locus_tag="SPy0190"
FT   CDS_pept        177330..177860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0190"
FT                   /old_locus_tag="SPy0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAA35231.1| (D90701)
FT                   ORF_ID:o166#4 [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33290"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M3"
FT                   /protein_id="AAK33290.1"
FT                   /translation="MSNFISPVYEIKSIPIEKISPNDYNPNSVAPPEMKLLYDSIKSDG
FT                   YTMPIVCYYDKEEDRYSIVDGFHRYRIMLDYSDIYERESGRLPVSVIDKSLDYRMASTI
FT                   RHNRARGSHDVDLMSQIVKDLHECGRSDNWIAKHLGMDKDEILRLKQITGLASLFKDHE
FT                   FNQSWEPEELLNE"
FT   gene            177853..178062
FT                   /locus_tag="SPy_0191a"
FT                   /old_locus_tag="SPy0191a"
FT   CDS_pept        177853..178062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0191a"
FT                   /old_locus_tag="SPy0191a"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAA59773.1| (X85787) tasA
FT                   [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0191a"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M2"
FT                   /protein_id="AAK33291.1"
FT                   /translation="MSKQEVRDSLSTVVGDLSLTTRENQIGSLFLDVQSDEDFGFKVVK
FT                   VLKSKGIVLNALDESVCGFKFVVE"
FT   gene            complement(178259..179338)
FT                   /locus_tag="SPy_0191b"
FT                   /old_locus_tag="SPy0191b"
FT                   /note="putative transposase - IS1076-like; there are
FT                   several frame shifts within this gene. The transposase may
FT                   be translated through a frameshift motif"
FT   gene            complement(179045..179338)
FT                   /locus_tag="SPy_0195"
FT                   /old_locus_tag="SPy0195"
FT   CDS_pept        complement(179045..179338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0195"
FT                   /old_locus_tag="SPy0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF27305.1|AF154674_6
FT                   (AF154674) unknown [Lactococcus lactis subsp. lactis]
FT                   >gi|6739596|gb|AAF27329.1| (AF178424) unknown [Lactococcus
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33292"
FT                   /db_xref="GOA:Q9A1M1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M1"
FT                   /protein_id="AAK33292.1"
FT                   /translation="MPRKTFDKAFKLSAVKLILEEEQSVKMVSSTLEIHPNSLYQWIQE
FT                   YEKYGESAFPGHGSALRHAQFETKKLEKEHKLLQEELALLKKFQVFLKPNRK"
FT   gene            complement(179416..180726)
FT                   /locus_tag="SPy_0196"
FT                   /old_locus_tag="SPy0196"
FT   CDS_pept        complement(179416..180726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0196"
FT                   /old_locus_tag="SPy0196"
FT                   /product="putative integral membrane protein"
FT                   /note="Best Blastp hit = gb|AAC97122.1| (U66846) orf5
FT                   [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33293"
FT                   /db_xref="GOA:Q9A1M0"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1M0"
FT                   /protein_id="AAK33293.1"
FT                   /translation="MIHLIIISAIALAIGIGYRTKINIGLLAIAFSYLIATTLMGLSPK
FT                   ELLHFWPTSLFFTIFSVSLFYNVATTNGTLDVLAQHILYRTRTHPNALYMILYLIATLL
FT                   SALGAGFFTTMAVCCPLAITLCQKADKHPLIGAQAVNWGASGGANLITSGSGIVFQGLF
FT                   KQMGWEEQAFSLGNHIFIVSIIYPLIVLLLLSCYIRYSKGRTNSSLTIDQPPVLSKVQR
FT                   QTTLLMISSMVLVWLFPLLLLIFPNIAWIATYRQTFDIGFVSILMVCLALRLKLGKQEA
FT                   ILAKVPWAIIIMLCGMSLLMSLAVKSGLVTLIGHLITTTIPHFWLPLFFCVIAGVMSLF
FT                   SSTLSVVAPTLFPIIATISAQSPHIDIRLLTTATIIGALSTNISPFSSAGSLIQLSLPH
FT                   IEERSLAFKKQILLGVPISLSLALLTIWILMLLASLS"
FT   gene            180950..181822
FT                   /gene="nadC"
FT                   /locus_tag="SPy_0197"
FT                   /old_locus_tag="SPy0197"
FT   CDS_pept        180950..181822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="SPy_0197"
FT                   /old_locus_tag="SPy0197"
FT                   /product="putative nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="Best Blastp hit = sp|P77938|NADC_RHORU PROBABLE
FT                   NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE [CARBOXYLATING]
FT                   (QUINOLINATE PHOSPHORIBOSYLTRANSFERASE [DECARBOXYLATING])
FT                   (QAPRTASE) >gi|11280012|pir||T51326 nicotinate-nucleotide
FT                   pyrophosphorylase (carboxylating) (EC 2.4.2.19) [imported]
FT                   - Rhodospirillum rubrum >gi|1498753|gb|AAC45128.1| (U65510)
FT                   nicotinate-nucleotide pyrophosphorylase [Rhodospirillum
FT                   rubrum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33294"
FT                   /db_xref="GOA:Q9A1L9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1L9"
FT                   /protein_id="AAK33294.1"
FT                   /translation="MSIISTDLTPFQIDDTLKAALREDVHSEDYSTNAIFDHHGQAKVS
FT                   LFAKEAGVLAGLTVFQRVFTLFDTEVTFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTC
FT                   ERVALNFLQHLSGIASMTAAYVEALGDDRIKVFDTRKTTPNLRLFEKYAVRVGGGYNHR
FT                   FNLSDAIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEAAAAGVDIIM
FT                   LDNMSLEQIEQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYVSSGSLTHSAKSLDFS
FT                   MKGLTYLDV"
FT   gene            complement(182122..182928)
FT                   /locus_tag="SPy_0198"
FT                   /old_locus_tag="SPy0198"
FT   CDS_pept        complement(182122..182928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0198"
FT                   /old_locus_tag="SPy0198"
FT                   /product="putative transposase, IS861"
FT                   /note="Best Blastp hit = gb|AAF73806.1|AF154034_3
FT                   (AF154034) IS3-Spn1 putative transposase [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33295"
FT                   /db_xref="GOA:Q9A1L8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1L8"
FT                   /protein_id="AAK33295.1"
FT                   /translation="MLLEILDLSRSTYYYQVKRLAQGDKDIELKHVIREIYDEHKGNYG
FT                   YRRIHMELRNRGFVVNHKKVQRLMKVMGLAARIRRKRKYSSYKGEVGKKADNLIKRHFE
FT                   GSKPYEKCYTDVTELALPEGKLYLSPVLDGYNSEIIDFTLSRSPNLKQVQTMLEKTFPA
FT                   DSYSGTILHSDQGWQYQHQSYHDFLESKGILASMSRKGNSPDNGMMESFFGILKSEMFY
FT                   GLETTYQSLDKLEEAITDYIFYYNNKRIKAKLKGFSPVQYRTKSFQ"
FT   gene            complement(182949..183464)
FT                   /locus_tag="SPy_0199"
FT                   /old_locus_tag="SPy0199"
FT   CDS_pept        complement(182949..183464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0199"
FT                   /old_locus_tag="SPy0199"
FT                   /product="conserved hypothetical protein, IS861 associated"
FT                   /note="Best Blastp hit =gb|AAF73805.1|AF154034_2 (AF154034)
FT                   hypothetical protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33296"
FT                   /db_xref="GOA:Q99Q48"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q99Q48"
FT                   /protein_id="AAK33296.1"
FT                   /translation="MKFNQETKVKIYELRQMGESIKSISKKFDMAESDLKYMIRLIDRY
FT                   GVTIVQKCKNHYYSPELKQEIINKVLIDGQSQKQTSLDYALPTSSMLSRWIAQYKKNGY
FT                   TILEKPRGRPSKMGRKRKKNLEEMTEVERLQKELEYPRAENAVLKKLREYRLRDEAKLK
FT                   EQQKSFKH"
FT   gene            complement(183550..184413)
FT                   /locus_tag="SPy_0201"
FT                   /old_locus_tag="SPy0201"
FT   CDS_pept        complement(183550..184413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0201"
FT                   /old_locus_tag="SPy0201"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||S32215 hypothetical protein 1
FT                   - Bacillus megaterium >gi|288299|emb|CAA79984.1| (Z21972)
FT                   ORF1 [Bacillus megaterium]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33297"
FT                   /db_xref="GOA:Q9A1L7"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1L7"
FT                   /protein_id="AAK33297.1"
FT                   /translation="MSIKAIKGQARDTLKNLSGKYLLFLIPTLLFMFHFGIEIHQGYVL
FT                   SSGIEVSLAASYFPLLLGLILSLFILSASFTMIDVVRHFRQKVSFAESTTAFSKEFFGN
FT                   LLVLAITKWLFFLIWSLIWFFGLFIFLSGLSAFLVNAKSGSSTVISLIFLLFGAVLSLI
FT                   GFGIYINRYYAYSLSEYLLYDEVKEGTYLGAIAVIETSVAMMKGYKWKLFFLQLSFTGW
FT                   FLLNIVTFGLLNIYLLPYFTTANVIFYDQLKKRFKDKDDPIEGEHLSLHQLNKNPTPMM
FT                   YDDQKD"
FT   gene            184632..185774
FT                   /gene="tgt"
FT                   /locus_tag="SPy_0203"
FT                   /old_locus_tag="SPy0203"
FT   CDS_pept        184632..185774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SPy_0203"
FT                   /old_locus_tag="SPy0203"
FT                   /product="putative tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="Best Blastp hit = sp|O32053|TGT_BACSU QUEUINE
FT                   TRNA-RIBOSYLTRANSFERASE (TRNA-GUANINE TRANSGLYCOSYLASE)
FT                   (GUANINE INSERTION ENZYME) >gi|7448762|pir||B69722 queuine
FT                   tRNA-ribosyltransferase (EC 2.4.2.29) - Bacillus subtilis
FT                   >gi|2635236|emb|CAB14731.1| (Z99118) tRNA-guanine
FT                   transglycosylase [Bacillus subtilis]
FT                   >gi|6977808|emb|CAB75333.1| (Y15896) tRNA-guanine
FT                   transglycosylase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33298"
FT                   /db_xref="GOA:Q9A1L6"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1L6"
FT                   /protein_id="AAK33298.1"
FT                   /translation="MTDYPIKYRLIKAEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLA
FT                   VGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNG
FT                   TCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHN
FT                   LYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF"
FT   gene            185991..186302
FT                   /locus_tag="SPy_0205"
FT                   /old_locus_tag="SPy0205"
FT   CDS_pept        185991..186302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0205"
FT                   /old_locus_tag="SPy0205"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||T38499 hypothetical protein
FT                   SPAC29B12.12 - fission yeast (Schizosaccharomyces pombe)
FT                   >gi|2408053|emb|CAB16256.1| (Z99164) hypothetical protein
FT                   [Schizosaccharomyces pombe]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33299"
FT                   /db_xref="GOA:Q9A1L5"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1L5"
FT                   /protein_id="AAK33299.1"
FT                   /translation="MTDCFGIDLDQEYRCLHYHTPLDIVGLKCASCQTYYACYHCHDQL
FT                   TDHAFVPTGHQETSPVICGHCRKLLSRAEYGCGCCPYCQSPFNPACHRHKDIYFLKES"
FT   gene            186306..186845
FT                   /locus_tag="SPy_0207"
FT                   /old_locus_tag="SPy0207"
FT   CDS_pept        186306..186845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0207"
FT                   /old_locus_tag="SPy0207"
FT                   /product="putative biotin synthase"
FT                   /note="Best Blastp hit = pir||C75270 probable biotin
FT                   synthase - Deinococcus radiodurans (strain R1)
FT                   >gi|6460290|gb|AAF12013.1|AE002076_5 (AE002076) biotin
FT                   synthase, putative [Deinococcus radiodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33300"
FT                   /db_xref="GOA:Q9A1L4"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1L4"
FT                   /protein_id="AAK33300.1"
FT                   /translation="MFTTKELVKVAMMTTLIIILGFIPAIPLGFIPVPIVLQNLGVMLA
FT                   GLMLGGKKGTLSVFLFLVIGLFLPVFSGSRTTIPVLMGPSAGYVIAYLLVPIVFSLLYR
FT                   NWFSKSTPLAFLALLISGVVLVDVLGAIWLSAYTGMSLVTSLLSNLVFIPGDTIKAIIA
FT                   TIIAVKYKDSFLNTKQ"
FT   gene            186985..187764
FT                   /locus_tag="SPy_0208"
FT                   /old_locus_tag="SPy0208"
FT   CDS_pept        186985..187764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0208"
FT                   /old_locus_tag="SPy0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||F69830 conserved hypothetical
FT                   protein yhfI - Bacillus subtilis
FT                   >gi|2226242|emb|CAA74530.1| (Y14083) hypothetical protein
FT                   [Bacillus subtilis] >gi|2633360|emb|CAB12864.1| (Z99109)
FT                   similar to hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33301"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1L3"
FT                   /protein_id="AAK33301.1"
FT                   /translation="MKLTTLGSWGAYPYQDAGTTSYLVTGHDGFQLLMDAGSRALNELE
FT                   KEISPLDLDAVIISHYHPDHVADLGVLRHYFQLYPKHLWQPKVLPIYGHDEDRNEFAKL
FT                   SIPDVSEGRAYDVTGVEQIGSFDITFLKTVHPVVCYAFRIVERATGQVLVFTGDSGYFE
FT                   GLADFAKEADLFLADVYLYEGNENHMAHLTSKEAGLMASQAGVKKLVLTHMPPVPPDGI
FT                   NSKNHLEVLRQETQAYAGNIPVDLALPHKSWNLGSLS"
FT   gene            complement(188893..190125)
FT                   /locus_tag="SPy_0210"
FT                   /old_locus_tag="SPy0210"
FT   CDS_pept        complement(188893..190125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0210"
FT                   /old_locus_tag="SPy0210"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAC12744.1| (AJ293727) Ky
FT                   protein [Mus musculus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33302"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1L2"
FT                   /protein_id="AAK33302.1"
FT                   /translation="MGVMMKQKIKILTVIGLMTVGMSACHNTSKPSNTDSVFSLTGKKR
FT                   QQIVKQVRQRYYFQQLSKTEQENYLTLYDSLAQFREIISLTPASKKSLIKTIDAFVMDN
FT                   PEFYWITSADYRFEFSDQTVFVTFPIPEDAKNIYQDLQAIGNDIVANTPSKDRYEQVKY
FT                   FYEVIIRDTDYNKKAFEAYQSGSQAQVASNQDIKSVFIDHLSVCNGYAQAFQFLCQKAG
FT                   IPVAYIRGTGTSQQPQQSFAHAWNAVQINNTYYGVDVTWGDPVFDNHLSHQKQGTINYS
FT                   FLCLPDYLMALSHQPSKDIAFNTKERFENVWTIPSCTDDSLLYSKRHQSYISTFDSDAI
FT                   LASLENQLLNRQEPLSLQFAHQDDYQQMVTDLTTNQTGYHNLFNQYWNNYTGFTYGLLP
FT                   ETLSISFASRN"
FT   gene            190525..191229
FT                   /gene="speG"
FT                   /locus_tag="SPy_0212"
FT                   /old_locus_tag="SPy0212"
FT   CDS_pept        190525..191229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="SPy_0212"
FT                   /old_locus_tag="SPy0212"
FT                   /product="exotoxin G precursor"
FT                   /note="Best Blastp hit = gb|AAD30988.1|AF124499_1
FT                   (AF124499) exotoxin G precursor [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33303"
FT                   /db_xref="GOA:Q9X5C7"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X5C7"
FT                   /protein_id="AAK33303.1"
FT                   /translation="MKTNILTIIILSCVFSYGSQLAYADENLKDLKRSLRFAYNITPCD
FT                   YENVEIAFVTTNSIHINTKQKRSECILYVDSIVSLGITDQFIKGDKVDVFGLPYNFSPP
FT                   YVDNIYGGIVKHSNQGNKSLQFVGILNQDGKETYLPSEAVRIKKKQFTLQEFDFKIRKF
FT                   LMEKYNIYDSESRYTSGSLFLATKDSKHYEVDLFNKDDKLLSRDSFFKRYKDNKIFNSE
FT                   EISHFDIYLKTH"
FT   gene            191685..193034
FT                   /gene="pgi"
FT                   /locus_tag="SPy_0215"
FT                   /old_locus_tag="SPy0215"
FT   CDS_pept        191685..193034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="SPy_0215"
FT                   /old_locus_tag="SPy0215"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="Best Blastp hit = gb|AAD33517.1|AF132127_2
FT                   (AF132127) glucose-6-phosphate isomerase [Streptococcus
FT                   mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33304"
FT                   /db_xref="GOA:Q9A1L1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1L1"
FT                   /protein_id="AAK33304.1"
FT                   /translation="MSHITFDYSKVLESFAGQHEIDFLQGQVTEADKLLREGTGPGSDF
FT                   LGWLDLPENYDKDEFARILTAAEKIKADSEVLVVIGIGGSYLGAKAAIDFLNHHFANLQ
FT                   TAKERKAPQILYAGNSISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFKELL
FT                   VKKYGQEEANKRIYATTDKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLPIAA
FT                   SGADITALMEGANAARKDLSSDKISENIAYQYAAVRNVLYRKGYITEILANYEPSLQYF
FT                   GEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVIRVDNPRKNVI
FT                   IPELAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFVTLPAQDEFTLGYTIY
FT                   FFELAIAVSGYMNAVNPFDQPGVEAYKRNMFALLGKPGFEALSAELNARL"
FT   gene            complement(193383..194891)
FT                   /locus_tag="SPy_0216"
FT                   /old_locus_tag="SPy0216"
FT   CDS_pept        complement(193383..194891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0216"
FT                   /old_locus_tag="SPy0216"
FT                   /product="putative regulatory protein-RofA related"
FT                   /note="Best Blastp hit = >gb|AAB81298.1| (U53825) RofA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33305"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1L0"
FT                   /protein_id="AAK33305.1"
FT                   /translation="MLDYYLESDIIDQKILLAILLTEKELTMAAACSQTTLTALKIKQY
FT                   LRQFNALFKGYLRIELIKSRIYCEVLNDKREAFFYDIFALSDTLKMLTFLLLDNPKHKS
FT                   IAVYTRKQGISQSKAYRLIHKLKHYLQDIGLNIVDNTVIGDELKIRYLIALLHKEYGII
FT                   LYDIQPADIETIHAFIFAAQKNLQPSAFLDRRFLFFDVLLMLTWKRHRYPVHLPHLALF
FT                   EHLKSLPIFDNIKTIAVDELAPRTRVTFSSDDFDYLFLIYLTTDNSFLSGYWTSHQRQQ
FT                   LYHLITKDPDYHLLIHRLQALVGKYSDIHEHIPNLIPFFKRTLYNLQTLITFDGYYFDQ
FT                   YQGNMLLLDKLETVIKDWLYDTGRQGSISSGHLHLMCLYLEQILESSIAPINITVIESQ
FT                   ETVGNVIANFITSTIPSYKVKLSRVNILSDNIYPYDKPVDLVVTSQKLLPFLKELGVFP
FT                   KETRLFGLSLDCIQQQREDLIKTILALHQNHYQKRLEELWRVPS"
FT   gene            195446..196565
FT                   /locus_tag="SPy_0217"
FT                   /old_locus_tag="SPy0217"
FT                   /note="IS1548 transposase; There is a 10bp deletion
FT                   confirmed by sequence analysis that results in a frame
FT                   shift mutation located near the center of this gene."
FT   gene            196573..196677
FT                   /locus_tag="SPy_0219"
FT                   /old_locus_tag="SPy0219"
FT   CDS_pept        196573..196677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0219"
FT                   /old_locus_tag="SPy0219"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33306"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1K9"
FT                   /protein_id="AAK33306.1"
FT                   /translation="MIDLKRNLFKIDVRAQKDEEKVFMRTAWLVSCQP"
FT   gene            196893..197564
FT                   /locus_tag="SPy_0223"
FT                   /old_locus_tag="SPy0223"
FT   CDS_pept        196893..197564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0223"
FT                   /old_locus_tag="SPy0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB90755.1| (AJ400707)
FT                   hypothetical protein [Streptococcus uberis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33307"
FT                   /db_xref="GOA:Q9A1K8"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1K8"
FT                   /protein_id="AAK33307.2"
FT                   /translation="MTQLLKRYPITIFLLGLTGLIFIAMQVVYGHLATGAQAIYQVGGM
FT                   FGLLVKAMPDQLWRLVTPIFIHIGFGHFFVNGLTLYFVGQIVEDLWGSRRFLLLYVLSG
FT                   VMGNAFTFWLTPETVAAGASTSLFGLFAAIVVLSFLGKNQALKDLGKSYQTLIVVNLLM
FT                   NLFMPNVSMAGHIGGVVGGALLSIVFPTKMRVITVKKTKRMLALVSYGIILVGVLVLGF
FT                   L"
FT   gene            complement(197663..198562)
FT                   /gene="hasC.2"
FT                   /locus_tag="SPy_0224"
FT                   /old_locus_tag="SPy0224"
FT   CDS_pept        complement(197663..198562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasC.2"
FT                   /locus_tag="SPy_0224"
FT                   /old_locus_tag="SPy0224"
FT                   /product="putative UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="Best Blastp hit = emb|CAB90754.1| (AJ400707)
FT                   putative UDP-glucose pyrophosphorylase [Streptococcus
FT                   uberis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33308"
FT                   /db_xref="GOA:P67068"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67068"
FT                   /protein_id="AAK33308.1"
FT                   /translation="MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEA
FT                   LKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQS
FT                   HPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVM
FT                   RVPHEDVSNYGIIAPQAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILE
FT                   KQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKD
FT                   DLKAYIIQLGKALEKTKP"
FT   gene            complement(198595..199611)
FT                   /gene="gpsA"
FT                   /locus_tag="SPy_0226"
FT                   /old_locus_tag="SPy0226"
FT   CDS_pept        complement(198595..199611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="SPy_0226"
FT                   /old_locus_tag="SPy0226"
FT                   /product="putative NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.8"
FT                   /note="Best Blastp hit = pir||H69636 glycerol-3-phosphate
FT                   dehydrogenase (NAD+) (EC 1.1.1.8) gpsA - Bacillus subtilis
FT                   >gi|1146220|gb|AAC83967.1| (L47648) NAD+ dependent
FT                   glycerol-3-phosphate dehydrogenase [Bacillus subtilis]
FT                   >gi|2634701|emb|CAB14199.1| (Z99115) NAD(P)H-dependent
FT                   glycerol-3-phosphate dehydrogenase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33309"
FT                   /db_xref="GOA:P68887"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68887"
FT                   /protein_id="AAK33309.1"
FT                   /translation="MTKQKVAILGPGSWGTALSQVLNDNGHDVRLWGNIPDQIEEINTK
FT                   HTNRHYFKDIVLDKNITATLDLGQALSDVDAVLFVVPTKVTRLVARQVAAILDHKVVVM
FT                   HASKGLEPETHERLSTILEEEIPAHFRSEVVVVSGPSHAEETIVRDITLITAASKDIEA
FT                   AKYVQSLFSNHYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGYGDNAKAAVITRGL
FT                   AEITRLGVKLGADPLTYSGLSGVGDLIVTGTSVHSRNWRAGAALGRGEKLEDIERNMGM
FT                   VIEGIATTKVAYEIAQDLGVYMPITTAIYKSIYEGADIKESILGMMSNEFRSENEWH"
FT   gene            199909..200358
FT                   /locus_tag="SPy_0228"
FT                   /old_locus_tag="SPy0228"
FT   CDS_pept        199909..200358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0228"
FT                   /old_locus_tag="SPy0228"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = sp|P37503|YYBA_BACSU HYPOTHETICAL
FT                   TRANSCRIPTIONAL REGULATOR IN COTF-TETB INTERGENIC REGION
FT                   >gi|2127004|pir||S65996 transcription regulator homolog
FT                   yybA - Bacillus subtilis >gi|467356|dbj|BAA05202.1|
FT                   (D26185) unknown [Bacillus subtilis]
FT                   >gi|2636618|emb|CAB16108.1| (Z99124) similar to
FT                   transcriptional regulator (MarR family) [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33311"
FT                   /db_xref="GOA:Q9A1K6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1K6"
FT                   /protein_id="AAK33311.2"
FT                   /translation="MSQVIGDLRELIHQIEQISDEIAKKYDVEHLAGPQGYVLVFLAKH
FT                   QNQEIFVKDIEKQLRISKSVASHLVKRMVKNGFINVMPSQVDKRYKQVVLAQVGRDKLP
FT                   LLRECRKDIEHYFLKEITKEELLTAKKVIEQLKQNMLTYKGDNDA"
FT   gene            200351..202057
FT                   /locus_tag="SPy_0229"
FT                   /old_locus_tag="SPy0229"
FT   CDS_pept        200351..202057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0229"
FT                   /old_locus_tag="SPy0229"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="Best Blastp hit = pir||E72396 ABC transporter,
FT                   ATP-binding protein - Thermotoga maritima (strain MSB8)
FT                   >gi|4980785|gb|AAD35375.1|AE001710_10 (AE001710) ABC
FT                   transporter, ATP-binding protein [Thermotoga maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33312"
FT                   /db_xref="GOA:Q9A1K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1K5"
FT                   /protein_id="AAK33312.1"
FT                   /translation="MLKDAILRYKWYALGSFFMVIGVVASSLLQPHYLKSVLSAVIQNN
FT                   QEKIYEVGKPLLIIALLGLMSGAINTVLAAKIAQGVSADMREKTFRKIQDFSYANIEAF
FT                   NAGNLVVRLTNDINQIQSLVMMMFQILFRLPILFIGAFIMAVQTFPQLWWVIVVMVILI
FT                   ALIMGLVMRQMGPRFGKFQRLMDKINRIAKENLRGVRVVKSFVQEQQQYTKFKETSNDL
FT                   LALNLSIGYGFSLMQPALMLVSYLAVYVSINVVSTMVETDPTVIGNIASFMTYMMQIMF
FT                   SIIVVGSMGMQVSRAFVSMARIRQILSTEPAMTFENEKEETISGSIVFDDVSFTYPNDD
FT                   EPTLKHISFAIEPGQMVGIVGATGSGKSTLAQLIPRLFDPQDGQILLGGKPIKTLSQTT
FT                   LRQSVSIVLQKAILFSGTIADNLRQGSAKADIDAMQKAAQIAQAKEFIDRMDSRYESQV
FT                   EERGSNLSGGQKQRLSIARGVINHPKILILDDSTSALDAKSEKRVQEALSHKLEGTTTV
FT                   IVAQKISSVVKADKILVLDQGQLIGEGTHAELVANNAIYREIYETQKGREE"
FT   gene            202060..203844
FT                   /locus_tag="SPy_0230"
FT                   /old_locus_tag="SPy0230"
FT   CDS_pept        202060..203844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0230"
FT                   /old_locus_tag="SPy0230"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="Best Blastp hit = gb|AAD01950.1| (AF033015) ABC
FT                   transporter homolog Z [Listeria monocytogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33313"
FT                   /db_xref="GOA:Q9A1K4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1K4"
FT                   /protein_id="AAK33313.1"
FT                   /translation="MKTARFFWFYFKRYRFSFTVIAVAVILATYLQVKAPVFLGESLTE
FT                   LGKIGQAYYVAKMSGQTHFSPDLSAFNAVMFKLLMTYFFTVLANLIYSFLLTRVVSHST
FT                   NRMRKGLFGKLERLTVAFFDRHKDGEILSRFTSDLDNIQNSLNQSLIQVVTNIALYIGL
FT                   VWMMFRQDSRLALLTIASTPVALIFLVINIRLARKYTNIQQQEVSALNAFMDETISGQK
FT                   AIIVQGVQEDTMTAFLKHNERVRQATFKRRLFSGQLFPVMNGMSLINTAIVIFVGSTIV
FT                   LSDKSMPAAAALGLVVTFVQYSQQYYQPMMQIASSWGELQLAFTGAHRIQEMFDETEEV
FT                   RPQNAPAFTSLKEAVAINHVDFGYLPGQKVLSDVSIVAPKGKMIAVVGPTGSGKTTIMN
FT                   LINRFYDVDAGSITFDGRDIRDYDLDSLRQKVGIVLQESVLFSGTITDNIRFGDQTISQ
FT                   DMVETAARATHIHDFIMSLPKGYNTYVSDDDNVFSTGQKQLISIARTLLTDPEVLILDE
FT                   ATSNVDTVTESKIQRAMEAIVAGRTSFVIAHRLKTILNADHIIVLKDGKVIEQGNHHEL
FT                   LHQKGFYAELYHNQFVFE"
FT   gene            203962..204729
FT                   /locus_tag="SPy_0233"
FT                   /old_locus_tag="SPy0233"
FT   CDS_pept        203962..204729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0233"
FT                   /old_locus_tag="SPy0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||C70361 conserved hypothetical
FT                   protein aq_701 - Aquifex aeolicus
FT                   >gi|2983299|gb|AAC06891.1| (AE000703) hypothetical protein
FT                   [Aquifex aeolicus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33314"
FT                   /db_xref="GOA:Q9A1K3"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1K3"
FT                   /protein_id="AAK33314.1"
FT                   /translation="MIDLQEILANMNPNQKINYDRVMQQMAKVWEKESVRPSILMHVCC
FT                   APCSTYTLEYLTQFADITVYFANSNIHPKDEYHRRAYVTQQFVSEFNAKTGNTVQFLEA
FT                   DYVPNEYVRQVRGLEEEPEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNS
FT                   QTINDVGIDVQKVYTTKYLPSDFKKNNGYRRSVEMCEEYDIYRQCYCGCVYAAKMQGID
FT                   LVQVKKDAKAFMADKDLDNDFTHIRFSYRGDEM"
FT   gene            204839..205285
FT                   /locus_tag="SPy_0235"
FT                   /old_locus_tag="SPy0235"
FT   CDS_pept        204839..205285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0235"
FT                   /old_locus_tag="SPy0235"
FT                   /product="putative dUTPase, phage associated"
FT                   /note="Best Blastp hit = emb|CAA72644.1| (Y11901) dUTPase
FT                   [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33315"
FT                   /db_xref="GOA:Q9A1K2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1K2"
FT                   /protein_id="AAK33315.1"
FT                   /translation="MTKIRGFELVSSFTNPDLLPKRETTHAAGYDLSVAEAVTIAPGEI
FT                   KLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQ
FT                   NITDHPVTLAVGERIVQGVFMPFLIADGDQARGERTGGFGSTGQ"
FT   gene            205366..206727
FT                   /gene="sms"
FT                   /locus_tag="SPy_0236"
FT                   /old_locus_tag="SPy0236"
FT   CDS_pept        205366..206727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sms"
FT                   /locus_tag="SPy_0236"
FT                   /old_locus_tag="SPy0236"
FT                   /product="putative DNA repair protein"
FT                   /note="Best Blastp hit = sp|P37572|RADA_BACSU DNA REPAIR
FT                   PROTEIN RADA HOMOLOG (DNA REPAIR PROTEIN SMS HOMOLOG)
FT                   >gi|2127055|pir||S66116 DNA repair protein sms - Bacillus
FT                   subtilis >gi|467475|dbj|BAA05321.1| (D26185) unknown
FT                   [Bacillus subtilis] >gi|2632354|emb|CAB11863.1| (Z99104)
FT                   DNA repair protein homolog [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33316"
FT                   /db_xref="GOA:Q9A1K1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1K1"
FT                   /protein_id="AAK33316.1"
FT                   /translation="MAKKKATFICQECGYQSPKYLGRCPNCSAWSSFVEEVEVKEVKNA
FT                   RVSLAGEKSRPVKLKDVDNISYHRTQTDMSEFNRVLGGGVVPGSLILIGGDPGIGKSTL
FT                   LLQVSTQLANKGTVLYVSGEESAEQIKLRSERLGDIDNEFYLYAETNMQAIRTEIENIK
FT                   PDFLIIDSIQTIMSPDITGVQGSVSQVREVTAELMQLAKTNNIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAVVVTMEGSRPILAEVQSLVTPTVFGNARRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTSPQEAFLGEIGLTGEI
FT                   RRVTRIEQRINEAAKLGFTKVYAPKNALQGIDIPQGIEVVGVTTVGQVLNAVFS"
FT   gene            206916..207413
FT                   /locus_tag="SPy_0237"
FT                   /old_locus_tag="SPy0237"
FT   CDS_pept        206916..207413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0237"
FT                   /old_locus_tag="SPy0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|Q10612|YC84_MYCTU HYPOTHETICAL
FT                   18.2 KDA PROTEIN RV1284 >gi|7450690|pir||H70771
FT                   hypothetical protein Rv1284 - Mycobacterium tuberculosis
FT                   (strain H37RV) >gi|1322408|emb|CAA97750.1| (Z73419)
FT                   hypothetical protein Rv1284 [Mycobacterium tuberculosis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33317"
FT                   /db_xref="GOA:Q9A1K0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1K0"
FT                   /protein_id="AAK33317.1"
FT                   /translation="MSYFEHFMAANQAYVALHGTAHLPLKPKTKVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFTNEGFAK
FT                   HIHEHLGVDVSGQDFLPFQDVEDSVREDMAKIRASSLISDDVVINGAVYDVDTGKMTQV
FT                   ME"
FT   gene            207559..208254
FT                   /locus_tag="SPy_0238"
FT                   /old_locus_tag="SPy0238"
FT   CDS_pept        207559..208254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0238"
FT                   /old_locus_tag="SPy0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||H75211 hypothetical protein
FT                   PAB2205 - Pyrococcus abyssi (strain Orsay)
FT                   >gi|5457652|emb|CAB49143.1| (AJ248283) hypothetical protein
FT                   [Pyrococcus abyssi]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33318"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1J9"
FT                   /protein_id="AAK33318.1"
FT                   /translation="MRFTIDQNMQFPLVEIDLEHGGSVYLQQGSMVYHTENVTLNTKLN
FT                   GKGSGLGKLVGAIGRSMVSGESMFITQAMSNGDGKLALAPNTPGQIVALELGEKQYRLN
FT                   DGAFLALDGSAQYKMERQNIGKALFGGQGGLFVMTTEGLGTLLANSFGSIKKITLDGGT
FT                   MTIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVVNTFRGHGEIYIQSLNLEQFAGTL
FT                   KRYLPTSSN"
FT   gene            208436..209881
FT                   /gene="gltX"
FT                   /locus_tag="SPy_0239"
FT                   /old_locus_tag="SPy0239"
FT   CDS_pept        208436..209881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="SPy_0239"
FT                   /old_locus_tag="SPy0239"
FT                   /product="putative glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="Best Blastp hit = sp|P22250|SYE_BACSU GLUTAMYL-TRNA
FT                   SYNTHETASE (GLUTAMATE-TRNA LIGASE) (GLURS)
FT                   >gi|68552|pir||SYBSET glutamate-tRNA ligase (EC 6.1.1.17)
FT                   gltX - Bacillus subtilis >gi|143006|gb|AAA22495.1| (M55073)
FT                   transfer RNA-Gln synthetase [Bacillus subtilis]
FT                   >gi|289282|gb|AAA21796.1| (L14580) glutamyl-tRNA synthetase
FT                   [Bacillus subtilis] >gi|467480|dbj|BAA05326.1| (D26185)
FT                   glutamyl-tRNA synthetase [Bacillus subtilis]
FT                   >gi|2632359|emb|CAB11868.1| (Z99104) glutamyl-tRNA
FT                   synthetase [Bacillus subtilis] >gi|2653659|gb|AAC31971.1|
FT                   (U49789) glutamyl-tRNA synthetase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33319"
FT                   /db_xref="GOA:P67023"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67023"
FT                   /protein_id="AAK33319.1"
FT                   /translation="MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIED
FT                   TDRKRHVEDGERSQLENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYK
FT                   SYVTEEELAAERERQEAAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNES
FT                   GIYKWTDMVKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIA
FT                   NTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVF
FT                   NFIALLGWNPGGEEEIFSREQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETV
FT                   YALCKPFLEEAGRLTEKAEKLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAG
FT                   ETVSTVLQAFKAKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHG
FT                   PELPNTIYLLGRDKSIEHIKNML"
FT   gene            210276..211622
FT                   /locus_tag="SPy_0242"
FT                   /old_locus_tag="SPy0242"
FT   CDS_pept        210276..211622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0242"
FT                   /old_locus_tag="SPy0242"
FT                   /product="putative histidine kinase, possibly involved in
FT                   competence"
FT                   /note="Best Blastp hit = emb|CAC10171.1| (AJ278301)
FT                   histidine kinase [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33320"
FT                   /db_xref="GOA:Q9A1J7"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1J7"
FT                   /protein_id="AAK33320.2"
FT                   /translation="MANSEYMFLLLSIIVYYMTKIYIFSFLSDITLPVWKQLTILALAL
FT                   FFNQFPYLSPLLIDPLLFLVVLRQETKQLFSLKALFLAVAPSVLVDLLSRFMGTIVIPY
FT                   LFLSSGIYLGHIIFDLLAYLLIFPSFAIINYMIGKDYKMICQSGYSKRSHNFYQTLLIF
FT                   VLVYYVDIFVILGFTDPFLHFHHSLFVPTPYKLLFLMFILLLVYLLSYFNHSSKEYLKN
FT                   ELRREQQAYMTNLEIYGKHLEKLYRDVRAFQSDYLSRIERLGQAIKSESITQIQDIYAQ
FT                   TVHEANDYWDDKHYNISKLRKINISSIKSLLSAKIISAEKSGIDLNVEVPDNIKETYIP
FT                   ELDLLLLMSIFCDNAIEAALEAQQPHMSIAYFLLGDYQMFVVTNTTKKKVDINKIFEEG
FT                   YSSKGSERGIGLSNAQRILKKYPYLSLRTKSFDKEFSQTLTMPKEEVDR"
FT   gene            211619..212902
FT                   /locus_tag="SPy_0244"
FT                   /old_locus_tag="SPy0244"
FT   CDS_pept        211619..212902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0244"
FT                   /old_locus_tag="SPy0244"
FT                   /product="putative histidine kinase"
FT                   /note="Best Blastp hit = emb|CAC10175.1| (AJ278302)
FT                   histidine kinase [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33321"
FT                   /db_xref="GOA:Q9A1J6"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1J6"
FT                   /protein_id="AAK33321.1"
FT                   /translation="MMVIYSMALFYATIFINSWVIFAKVSAIKLSWKRVSIIGISFVIA
FT                   NMIFDKVILIDQLFFIIVSLLSAPKKKLFEHMFNGFFTILIVELLFRVIGSFFLPAVLG
FT                   FSIGQINNNLKLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKMKKWVFWMNTAMFS
FT                   YYFFAHFLVTVQSGFLALYFQYRSILVFIYLAIFIWVIVKLDRFAKDQLSQKLTQAQNE
FT                   RIAYLENYNQSIEQLYREIRTVKHDSENILISLKDSIDSGDIDLITRVYDTVIQQSATS
FT                   MMRTNYEISSLDNIKEAVIRSIMNSKLLEAQYLGIELYIEIPDVIDHLPIKLIDLIVLF
FT                   TGLVDNAIETAKGSRRPFLSIAYFKQDNKQLFIIENSTKTNRVDIAKRFDAQQQNSAHF
FT                   LTVLDSYPQITLSTKSDHYRLRQLLEMR"
FT   gene            212906..213646
FT                   /locus_tag="SPy_0245"
FT                   /old_locus_tag="SPy0245"
FT   CDS_pept        212906..213646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0245"
FT                   /old_locus_tag="SPy0245"
FT                   /product="putative response regulator"
FT                   /note="Best Blastp hit = emb|CAC10174.1| (AJ278302)
FT                   response regulator [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33322"
FT                   /db_xref="GOA:Q9A1J5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1J5"
FT                   /protein_id="AAK33322.1"
FT                   /translation="MMNIFILEDDFIQQTRIESIVVGILKETRIPCNQLEVFSTPQKLF
FT                   ESIQERGDHQLYFLDIEIGEYTRCGLELAAAIRQKDPNAVIVFVTTHSEFAPISFKYKV
FT                   SALDFIDKAGGQKQFKEQIEECIRYTYDMMSSRESKDMFLFETPQTRLKLPYKDILYFA
FT                   TATTPHKVCLWTQTERLEFYGNLSEIQAVAPKLFLCHRSYLVNLDKVVRIDKSKQLLYF
FT                   ENGDSCMVSRLKMKCLFERWEALR"
FT   gene            214186..214545
FT                   /gene="rnpA"
FT                   /locus_tag="SPy_0246"
FT                   /old_locus_tag="SPy0246"
FT   CDS_pept        214186..214545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="SPy_0246"
FT                   /old_locus_tag="SPy0246"
FT                   /product="putative ribonuclease P protein component"
FT                   /note="Best Blastp hit = pdb|1A6F| Rnase P Protein From
FT                   Bacillus Subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33323"
FT                   /db_xref="GOA:Q9A1J4"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1J4"
FT                   /protein_id="AAK33323.2"
FT                   /translation="MKKTYRVKREKDFQAIFKDGKSTANRKFVIYHLNRGQDHFRVGIS
FT                   VGKKIGNAVTRNAVKRKIRHVIMALGHQLKSEDFVVIARKGVESLEYQELQQNLHHVLK
FT                   LAQLLEKGFESEEKH"
FT   gene            214511..215338
FT                   /locus_tag="SPy_0247"
FT                   /old_locus_tag="SPy0247"
FT   CDS_pept        214511..215338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0247"
FT                   /old_locus_tag="SPy0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|Q01625|SP3J_BACSU STAGE III
FT                   SPORULATION PROTEIN J PRECURSOR >gi|2127241|pir||I40437
FT                   stage III sporulation protein spoIIIJ - Bacillus subtilis
FT                   >gi|40023|emb|CAA44401.1| (X62539) unnamed protein product
FT                   [Bacillus subtilis] >gi|467388|dbj|BAA05234.1| (D26185)
FT                   stage III sporulation [Bacillus subtilis]
FT                   >gi|2636651|emb|CAB16141.1| (Z99124) alternate gene name:
FT                   spo0J87 [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33324"
FT                   /db_xref="GOA:P65631"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65631"
FT                   /protein_id="AAK33324.1"
FT                   /translation="MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYL
FT                   FARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQRKYAG
FT                   KDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWV
FT                   ELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGV
FT                   VLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK"
FT   gene            215350..216264
FT                   /locus_tag="SPy_0248"
FT                   /old_locus_tag="SPy0248"
FT   CDS_pept        215350..216264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0248"
FT                   /old_locus_tag="SPy0248"
FT                   /product="hypothetical protein"
FT                   /note="The N-terminal amino acid sequence of this ORF has
FT                   been determined from a spot isolated by 2-D gel
FT                   electrophoresis from another strain of S. pyogenes. Hogan,
FT                   D. A., Whitton, M. M., Rogers, J. and R. A. VanBogelen.
FT                   2000. Two-dimensional gel electrophoresis map of
FT                   Streptococcus pyogenes proteins. Unpublished data.; Best
FT                   Blastp hit = pir||E72251 hypothetical protein TM1460 -
FT                   Thermotoga maritima (strain MSB8)
FT                   >gi|4982025|gb|AAD36528.1|AE001797_8 (AE001797) jag
FT                   protein, putative [Thermotoga maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33325"
FT                   /db_xref="GOA:Q9A1J2"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1J2"
FT                   /protein_id="AAK33325.1"
FT                   /translation="MVLFTGKTVEEAIETGLQELGLSRLKAHIKVISKEKKGFLGFGKK
FT                   PAQVDIEGISDKTVYKADKKATRGVPEDINRQNTPAVNSADVEPEEIKATQRLEAEDTK
FT                   VVPLMSEDSPAQTPSNLAETVTETKAQQPSIPVEESEVPQDAGNDGFSKDIEKAAQEVS
FT                   DYVTKIIYEMDIEATVETSNNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDR
FT                   YSKNFSVSLNVHDYVEHRTETLIDFTQKVAKRVLESGQDYTMDPMSNSERKIVHKTVSS
FT                   IEGVDSYSEGNDPNRYVVVSLQR"
FT   gene            216579..216713
FT                   /gene="rpmH"
FT                   /locus_tag="SPy_0250"
FT                   /old_locus_tag="SPy0250"
FT   CDS_pept        216579..216713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SPy_0250"
FT                   /old_locus_tag="SPy0250"
FT                   /product="50S ribosomal protein L34"
FT                   /note="Best Blastp hit = sp|P45647|RL34_COXBU 50S RIBOSOMAL
FT                   PROTEIN L34 >gi|2119151|pir||I40651 ribosomal protein L34 -
FT                   Coxiella burnetii >gi|511456|gb|AAA56916.1| (U10529)
FT                   ribosomal protein L34 [Coxiella burnetii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33326"
FT                   /db_xref="GOA:P66258"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66258"
FT                   /protein_id="AAK33326.1"
FT                   /translation="MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLAARRRKGRKVLSA"
FT   gene            216987..217691
FT                   /locus_tag="SPy_0251"
FT                   /old_locus_tag="SPy0251"
FT   CDS_pept        216987..217691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0251"
FT                   /old_locus_tag="SPy0251"
FT                   /product="putative N-acetylmannosamine-6-P epimerase"
FT                   /note="Best Blastp hit = gb|AAD28762.1|AF130859_1
FT                   (AF130859) putative N-acetylmannosamine-6-P epimerase
FT                   [Clostridium perfringens]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33327"
FT                   /db_xref="GOA:P65522"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:1YXY"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65522"
FT                   /protein_id="AAK33327.1"
FT                   /translation="MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLMAKAA
FT                   QEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAV
FT                   IAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSG
FT                   YTPYSRQEAGPDVALIEALCKAGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPK
FT                   EIAERFIEALKS"
FT   gene            217740..219059
FT                   /locus_tag="SPy_0252"
FT                   /old_locus_tag="SPy0252"
FT   CDS_pept        217740..219059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0252"
FT                   /old_locus_tag="SPy0252"
FT                   /product="putative sugar transporter sugar binding
FT                   lipoprotein"
FT                   /note="Best Blastp hit = pir||F69796 sugar-binding protein
FT                   homolog yesO - Bacillus subtilis
FT                   >gi|2633010|emb|CAB12516.1| (Z99107) similar to
FT                   sugar-binding protein [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33328"
FT                   /db_xref="GOA:Q9A1I9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I9"
FT                   /protein_id="AAK33328.1"
FT                   /translation="MNMKKLASLAMLGASVLGLAACGGKSQKEAGASKSDTAKTEITWW
FT                   AFPVFTQEKAEDGVGTYEKKLIAAFEKANPEIKVKLETIDFTSGPEKITTAIEAGTAPD
FT                   VLFDAPGRIIQYGKNGKLADLNDLFTEEFTKDVNNDKLIQASKAGDTAYMYPISSAPFY
FT                   MALNKKMLKDAGVLDLVKEGWTTDDFEKVLKALKDKGYNPGSFFANGQGGDQGPRAFFA
FT                   NLYSSHITDDKVTKYTTDDANSIKAMTKISNWIKDGLMMNGSQYDGSADIQNFANGQTS
FT                   FTILWAPAQPGIQAKLLEASKVDYLEIPFPSDDGKPELEYLVNGFAVFNNKDEQKVAAS
FT                   KTFIQFIADDKEWGPKNVVRTGAFPVRTSYGDLYKDKRMEKIAEWTKFYSPYYNTIDGF
FT                   AEMRTLWFPMVQAVSNGDEKPEDALKAFTEKANKTIKKTQ"
FT   gene            219087..220049
FT                   /locus_tag="SPy_0254"
FT                   /old_locus_tag="SPy0254"
FT   CDS_pept        219087..220049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0254"
FT                   /old_locus_tag="SPy0254"
FT                   /product="sugar transport system (permease)"
FT                   /note="Best Blastp hit = dbj|BAB05584.1| (AP001513) sugar
FT                   transport system (permease) (binding protein dependent
FT                   transporter) [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33329"
FT                   /db_xref="GOA:Q9A1I8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I8"
FT                   /protein_id="AAK33329.1"
FT                   /translation="MHMSNGHWKEAFLFRKVEQKKEVFQVNVNKLKMRETLISYAFLAP
FT                   VLVFFVIFVLIPMIMGFVTSFFNYSMTEFTFVGFANYARMFQDPIFMKSLINTLIIVIG
FT                   SVPVVVFFSLFVAAKTYDKNVVARSFYRAVFFLPVVTGSVAVTVVWKWIYDPMSGILNY
FT                   VLKYAHVIEQNISWLGDKHWALLAIIVILLTTSVGQPIILYIAAMGNIDNSLVEAARVD
FT                   GATEFQVFWNIKWPSLLPTTLYIAVITTINSFQCFALIQLLTSGGPNYSTSTLMYYLYE
FT                   KAFKLSEYGYANTMGVFLAVMIAIISFAQFKILGNDVEY"
FT   gene            220062..220892
FT                   /locus_tag="SPy_0255"
FT                   /old_locus_tag="SPy0255"
FT   CDS_pept        220062..220892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0255"
FT                   /old_locus_tag="SPy0255"
FT                   /product="probable sugar transport protein (permease)"
FT                   /note="Best Blastp hit = emb|CAB59597.1| (AL132662)
FT                   probable sugar transport inner membrane protein
FT                   [Streptomyces coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33330"
FT                   /db_xref="GOA:Q9A1I7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I7"
FT                   /protein_id="AAK33330.1"
FT                   /translation="MTKKKLTASDILTTVMLCVLTILFIFPFYWIMTGAFKAQADTIMI
FT                   PPQWWPKAPTIENFKALVVQNPALKWLWNSVFISVATMFLVCGTSSLAGYALAKKRFYG
FT                   QRLLFSIFIAAMALPKQVVLVPLVRIVNFMGIHDTLAAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFFNVAFPIVKPGFAALAIFTFINTWNDYFMQLVMLTSREN
FT                   LTISLGVATMQAEMATNYGLIMAGAAMAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   gene            221049..221711
FT                   /locus_tag="SPy_0256"
FT                   /old_locus_tag="SPy0256"
FT   CDS_pept        221049..221711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0256"
FT                   /old_locus_tag="SPy0256"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB05582.1| (AP001513) unknown
FT                   conserved protein in bacilli [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33331"
FT                   /db_xref="GOA:Q9A1I6"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I6"
FT                   /protein_id="AAK33331.1"
FT                   /translation="MTSKKQGLLHSLFKLDSKWMRASAALFDLLVFNLLFVLSCLPLLT
FT                   IGVAKMALYASLLDWREGQVSQLVTTYSSHFKYYFKSGLRLGLIELGIMTICLLDLFLI
FT                   RNQSGLVFQGFKVLCVAVLFLVVILFLYAYPQAVKRDLSLSTLFKRSFLLAGLFFPWSF
FT                   AFLAFICLTIFSLQLSLLTLFGGVSLLAIIGISSLTYLYLIIMESLLRRFPLNNDIE"
FT   gene            221723..222637
FT                   /gene="nanH"
FT                   /locus_tag="SPy_0257"
FT                   /old_locus_tag="SPy0257"
FT   CDS_pept        221723..222637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanH"
FT                   /locus_tag="SPy_0257"
FT                   /old_locus_tag="SPy0257"
FT                   /product="putative acylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /note="Best Blastp hit = emb|CAA69950.1| (Y08695) putative
FT                   acylneuraminate lyase [Clostridium tertium]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33332"
FT                   /db_xref="GOA:Q9A1I5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I5"
FT                   /protein_id="AAK33332.1"
FT                   /translation="MTDLTKYQGIIPAFYACYDDQGNISPERVRALTQYYIDKGVQGLY
FT                   INGSSGECIYQSVFDRQLVLENVMAVAKGKLTIINHVACNNTKDSIELAAHSERLGVDA
FT                   IAAIPPIYFRLPEYAVADYWNAISSAAPHTDFIIYNIPQLAGVALTPSLYKTMLANKRV
FT                   IGVKNSSMPVQDIQTFCAIGGDDHIVFNGPDEQFLGGRLMGAAAGIGGTYGAMPELFLR
FT                   LNQLIADKDLEKAKALQYTINEIIGVLVSAHGNMYGVIKEVLRINEGLDIGSVRSPLAE
FT                   LVEEDRVICQRAAALINQAKETF"
FT   gene            222659..223597
FT                   /locus_tag="SPy_0258"
FT                   /old_locus_tag="SPy0258"
FT   CDS_pept        222659..223597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0258"
FT                   /old_locus_tag="SPy0258"
FT                   /product="putative glucose kinase"
FT                   /note="Best Blastp hit = dbj|BAB04516.1| (AP001509) glucose
FT                   kinase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33333"
FT                   /db_xref="GOA:Q9A1I4"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I4"
FT                   /protein_id="AAK33333.1"
FT                   /translation="MKHYLAIDIGGTAIKYGLISETGDLLEKEEMATEAYKGGPSILEK
FT                   VKGLVKTYQDQMDLAGVAISSAGMVNPDEGEIFYAGPQIPNYAGTQFKKEIEETFGLPC
FT                   EVENDVNCAGLAEAISGSAKDYPVALCLTIGTGIGGCLLFNSQVFHGSSHSACEVGYLH
FT                   LSDGQFQDLASTTALVQEVVLAYGDDISQWDGRRIFEQAKAGDAICIAAISKQVDYLGQ
FT                   GIANICYVVNPNVVVLGGGIMAQKDYLADKLKTALDSYLVSSLAKKTQLKFASHGNNAG
FT                   ILGAYYHFKQKNERSCSFITLEKIENNLASS"
FT   gene            complement(223708..224538)
FT                   /locus_tag="SPy_0259"
FT                   /old_locus_tag="SPy0259"
FT   CDS_pept        complement(223708..224538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0259"
FT                   /old_locus_tag="SPy0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P44540|Y143_HAEIN HYPOTHETICAL
FT                   PROTEIN HI0143 >gi|1573099|gb|AAC21815.1| (U32700)
FT                   conserved hypothetical protein [Haemophilus influenzae Rd]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33334"
FT                   /db_xref="GOA:Q9A1I3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I3"
FT                   /protein_id="AAK33334.1"
FT                   /translation="MPKNHRLITKIEASLEHMTSLEKGIAHFFITTDLTPQELTASEIV
FT                   KRLHISQAALTRFAKKCGFTGYRAFAFDYLHSLQESQETFQSIHLELTKRVLMDYDALI
FT                   NKTYELVNEEKLLNLAKLIDSSERVYFFGKGSSGLVAREMKLRFMRLGLICDAYSDTDG
FT                   FTWANSLVNENCLVFGFSLSGKTNSVITALHQASQRGAKTVLLTTDNQTEFDDSLDIIP
FT                   VSSTHQLHYGNRVSPQFPLLIMMDIIYAYVLAIDKPHKEKIFKNTIIDKENNDL"
FT   gene            224790..225614
FT                   /locus_tag="SPy_0260"
FT                   /old_locus_tag="SPy0260"
FT   CDS_pept        224790..225614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0260"
FT                   /old_locus_tag="SPy0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P37545|YABD_BACSU PUTATIVE
FT                   DEOXYRIBONUCLEASE YABD >gi|2127033|pir||S66068 conserved
FT                   hypothetical protein yabD - Bacillus subtilis
FT                   >gi|467428|dbj|BAA05274.1| (D26185) unknown [Bacillus
FT                   subtilis] >gi|2632306|emb|CAB11815.1| (Z99104) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33335"
FT                   /db_xref="GOA:Q9A1I2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I2"
FT                   /protein_id="AAK33335.1"
FT                   /translation="MWLRSLCYNNIMTNKVEKLTIFDTHTHLNVAEFQGHETEELTLAQ
FT                   EMGVAYHNVVGFDQATISGALTLANKYANIYATIGWHPTEAGSYSEAVEEAIVSQLSHS
FT                   KVIALGEIGLDYYWMEDPKEVQIEVFKRQMQLAKDHDLPFVVHTRDALEDTYEVIKAAG
FT                   VGPRGGIMHSYSGSLEMAERFIELGMMISFSGVVTFKKALDIQEAAQHLPLDKILVETD
FT                   APYLTPVPKRGKQNHTAYTRYVVDKIAELRGMTVEEVAKATTANAKRVFKLD"
FT   gene            225607..226176
FT                   /locus_tag="SPy_0261"
FT                   /old_locus_tag="SPy0261"
FT   CDS_pept        225607..226176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0261"
FT                   /old_locus_tag="SPy0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P37547|YABF_BACSU HYPOTHETICAL
FT                   20.7 KD PROTEIN IN METS-KSGA INTERGENIC REGION
FT                   >gi|2127035|pir||S66070 conserved hypothetical protein yabF
FT                   - Bacillus subtilis >gi|467430|dbj|BAA05276.1| (D26185)
FT                   unknown [Bacillus subtilis] >gi|2632308|emb|CAB11817.1|
FT                   (Z99104) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33336"
FT                   /db_xref="GOA:Q9A1I1"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1I1"
FT                   /protein_id="AAK33336.1"
FT                   /translation="MTEKINIQEVLVVEGKDDTANLRRFYEVDTYETRGSAITEEDLER
FT                   INRLNDLRGVIVLTDPDYNGERIRKLIMAAVPTARHAFLNRNEAVPSSKSKGRSLGVEH
FT                   ANFEDLQKALAHVTQQYDDESYFDIRQTDLIRLGLLMASDSRKRREYLGEKLRIGYANG
FT                   KQLLKRLELFGITLAEVEEVMETYEE"
FT   gene            226290..227162
FT                   /gene="ksgA"
FT                   /locus_tag="SPy_0262"
FT                   /old_locus_tag="SPy0262"
FT   CDS_pept        226290..227162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SPy_0262"
FT                   /old_locus_tag="SPy0262"
FT                   /product="putative dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Best Blastp hit = sp|P37468|KSGA_BACSU
FT                   DIMETHYLADENOSINE TRANSFERASE (S-ADENOSYLMETHIONINE-6-N',
FT                   N'-ADENOSYL(RRNA) DIMETHYLTRANSFERASE) (16S RRNA
FT                   DIMETHYLASE) (HIGH LEVEL KASUGAMYCIN RESISTANCE PROTEIN
FT                   KSGA) (KASUGAMYCIN DIMETHYLTRANSFERASE)
FT                   >gi|2126951|pir||S66071 probable
FT                   (adenine-N6,N6-)-dimethyltransferase (EC 2.1.1.-) ksgA -
FT                   Bacillus subtilis >gi|467431|dbj|BAA05277.1| (D26185) high
FT                   level kasgamycin resistance [Bacillus subtilis]
FT                   >gi|2632309|emb|CAB11818.1| (Z99104) dimethyladenosine
FT                   transferase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33337"
FT                   /db_xref="GOA:Q9A1I0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1I0"
FT                   /protein_id="AAK33337.1"
FT                   /translation="MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDTNILQKIVDTAEID
FT                   QNVNVIEIGPGIGALTEFLAENAAEVMAFEIDDRLVPILADTLRDFDNVQVVNQDILKA
FT                   DLQTQIKQFKNPDLPIKVVANLPYYITTPILMHLIESKIPFQEFVVMMQREVADRISAE
FT                   PNTKAYGSLSIAVQYYMTAKVAFIVPRTVFVPAPNVDSAILKMVRRDQPLIEVKDEDFF
FT                   FRVSRLSFVHRRKTLWNNLTSHFGKSEDIKAKLEKGLALADIKPSIRGEALSIQDFGKL
FT                   ADALKEVGL"
FT   gene            227586..228458
FT                   /locus_tag="SPy_0263"
FT                   /old_locus_tag="SPy0263"
FT   CDS_pept        227586..228458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0263"
FT                   /old_locus_tag="SPy0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||A69879 conserved hypothetical
FT                   protein yloQ - Bacillus subtilis
FT                   >gi|2337807|emb|CAA74251.1| (Y13937) YloQ protein [Bacillus
FT                   subtilis] >gi|2633950|emb|CAB13451.1| (Z99112) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33338"
FT                   /db_xref="GOA:Q9A1H9"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1H9"
FT                   /protein_id="AAK33338.1"
FT                   /translation="MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDF
FT                   SAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAI
FT                   HPVVYISKMDLLDSPEEIKAIGRQYQAIGYDFVTSLEELLPLLADKITVFMGQTGVGKS
FT                   TLLNRIAPELALEIGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAED
FT                   LNEAFPELRRLSHECKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRE
FT                   TYKKVIKRK"
FT   gene            228468..229130
FT                   /gene="rpe"
FT                   /locus_tag="SPy_0264"
FT                   /old_locus_tag="SPy0264"
FT   CDS_pept        228468..229130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="SPy_0264"
FT                   /old_locus_tag="SPy0264"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="Best Blastp hit = dbj|BAB06221.1| (AP001515) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33339"
FT                   /db_xref="GOA:Q9A1H8"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="PDB:2FLI"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1H8"
FT                   /protein_id="AAK33339.1"
FT                   /translation="MSTLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPN
FT                   ISFGADVVASMRKHSKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTRHIHGALQK
FT                   IKAAGMKAGVVINPGTPATALEPLLDLVDQVLIMTVNPGFGGQAFIPECLEKVATVAKW
FT                   RDEKGLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLFKASDLVSQVQTLRTALNV"
FT   gene            229123..229755
FT                   /locus_tag="SPy_0265"
FT                   /old_locus_tag="SPy0265"
FT   CDS_pept        229123..229755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0265"
FT                   /old_locus_tag="SPy0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||C69879 hypothetical protein
FT                   yloS - Bacillus subtilis >gi|2337809|emb|CAA74253.1|
FT                   (Y13937) YloS protein [Bacillus subtilis]
FT                   >gi|2633952|emb|CAB13453.1| (Z99112) yloS [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33340"
FT                   /db_xref="GOA:Q9A1H7"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1H7"
FT                   /protein_id="AAK33340.1"
FT                   /translation="MSKVALFAGGDLSYISRDFDYFVGIDRGSLFLLENGLPLNMAVGD
FT                   FDSVSQKAFTDIKEKAELFITAHPEKNDTDTELALKEVFARFPEAEVTIFGAFGGRMDH
FT                   LLSNIFLPSDPGIAPFMAQIALRDQQNMITYRPAGQHLIHQEEGMTYVAFMAEGEADLT
FT                   ITGAKFELTQDNFFKKKIYSSNAFIHQPITVSLPSGYLIIIQSKDWS"
FT   gene            229757..231028
FT                   /locus_tag="SPy_0266"
FT                   /old_locus_tag="SPy0266"
FT   CDS_pept        229757..231028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0266"
FT                   /old_locus_tag="SPy0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF83223.1|AE003892_8
FT                   (AE003892) conserved hypothetical protein [Xylella
FT                   fastidiosa]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33341"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1H6"
FT                   /protein_id="AAK33341.1"
FT                   /translation="MDLILFLLVLVLLGLGAYLLFKVNGLQHQLAQTLEGNADNLSDQM
FT                   TYQLDTANKQQLLELTQLMNRQQAGLYQQLTDIRDVLHRSLSDSRDRSDKRLEKINQQV
FT                   NQSLKNMQESNEKRLEKMRQIVEEKLEETLKNRLHASFDSVSKQLESVNKGLGEMRSVA
FT                   QDVGTLNKVLSNTKTRGILGELQLGQIIEDIMTSSQYEREFVTVSGSSERVEYAIKLPG
FT                   NGQGGYIYLPIDSKFPLEDYYRLEDAYEVGDKLAIEASRKALLAAIKRFAKDIHKKYLN
FT                   PPETTNFGVMFLPTEGLYSEVVRNASFFDSLRREENIVVAGPSTLSALLNSLSVGFKTL
FT                   NIQKNADDISKILGNVKLEFDKFGGLLAKAQKQMNTANNTLDQLISTRTNAIVRALNTV
FT                   ETYQDQATKSLLNMPLLEEENNEN"
FT   gene            231018..231956
FT                   /gene="cbf"
FT                   /locus_tag="SPy_0267"
FT                   /old_locus_tag="SPy0267"
FT   CDS_pept        231018..231956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbf"
FT                   /locus_tag="SPy_0267"
FT                   /old_locus_tag="SPy0267"
FT                   /product="putative CMP-binding factor"
FT                   /note="Best Blastp hit = pir||G69818 CMP-binding factor
FT                   homolog yhaM - Bacillus subtilis
FT                   >gi|2226127|emb|CAA74420.1| (Y14078) Hypothetical protein
FT                   [Bacillus subtilis] >gi|2633329|emb|CAB12833.1| (Z99109)
FT                   similar to CMP-binding factor [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33342"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1H5"
FT                   /protein_id="AAK33342.1"
FT                   /translation="MKINQMKKDQLFEGFYLIKSAEVRKTRAGKDFISLTFQDDTGEIS
FT                   GNLWDAQPYNVEEFTAGKVVFMKGRREVYNGTPQVNQITLRNVRPGEPNDPKDFKEKAP
FT                   VSVTEVRDYLEQMLFKIENATWQRIVRALYRKYDKEFYTYPAAKTNHHAFESGLAYHTA
FT                   TMVRLADSIGDIYPDLNKSLLFAGIMLHDLAKVIELTGPDNTEYTVRGNLIGHISLINE
FT                   EITKVISELQIDDTKEEVIVLRHVILSHHGQLEYGSPVRPRIMEAEIIHMIDNIDANMM
FT                   MMTTALSRVSEGEMTNRIFAMDNRSFYKPNY"
FT   gene            232223..233062
FT                   /gene="purR"
FT                   /locus_tag="SPy_0268"
FT                   /old_locus_tag="SPy0268"
FT   CDS_pept        232223..233062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="SPy_0268"
FT                   /old_locus_tag="SPy0268"
FT                   /product="putative purine operon repressor"
FT                   /note="Best Blastp hit = emb|CAA10902.1| (AJ222642) purR
FT                   [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33343"
FT                   /db_xref="GOA:Q9A1H4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1H4"
FT                   /protein_id="AAK33343.1"
FT                   /translation="MKLRRSERMVVISNYLINNPYKLTSLNTFATKYEAAKSSISEDIA
FT                   IIKKAFEEANIGDIDTLTGASGGVIFTPSISETEARTIVEDLCQRLSESDRILPGGYIY
FT                   LSDLLSTPKILQNIGRIIANAFKGEKIDAVMTVATKGVPLANAVANILSVPFVIVRRDL
FT                   KITEGSTVSVNYASASSDRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTITGMISLLTEF
FT                   DSTLVGVAVFAENAQSEREQMTFKSLLKVSEIDVKNNNVVVEVGNIFDKWKKEREWT"
FT   gene            233053..235674
FT                   /gene="prgA"
FT                   /locus_tag="SPy_0269"
FT                   /old_locus_tag="SPy0269"
FT   CDS_pept        233053..235674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prgA"
FT                   /locus_tag="SPy_0269"
FT                   /old_locus_tag="SPy0269"
FT                   /product="putative surface exclusion protein"
FT                   /note="Best Blastp hit = pir||G41662 130K surface exclusion
FT                   protein Sec10 precursor - Enterococcus faecalis plasmid
FT                   pCF10 >gi|150554|gb|AAA65847.1| (M64978) surface exclusion
FT                   protein [Plasmid pCF10]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33344"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1H3"
FT                   /protein_id="AAK33344.1"
FT                   /translation="MDLEQTKPNQVKQKIALTSTIALLSASVGVSHQVKADDRASGETK
FT                   ASNTHDDSLPKPETIQEAKATIDAVEKTLSQQKAELTELATALTKTTAEINHLKEQQDN
FT                   EQKALTSAQEIYTNTLASSEETLLAQGAEHQRELTATETELHNAQADQHSKETALSEQK
FT                   ASISAETTRAQDLVEQVKTSEQNIAKLNAMISNPDAITKAAQTANDNTKALSSELEKAK
FT                   ADLENQKAKVKKQLTEELAAQKAALAEKEAELSRLKSSAPSTQDSIVGNNTMKAPQGYP
FT                   LEELKKLEASGYIGSASYNNYYKEHADQIIAKASPGNQLNQYQDIPADRNRFVDPDNLT
FT                   PEVQNELAQFAAHMINSVRRQLGLPPVTVTAGSQEFARLLSTSYKKTHGNTRPSFVYGQ
FT                   PGVSGHYGVGPHDKTIIEDSAGASGLIRNDDNMYENIGAFNDVHTVNGIKRGIYDSIKY
FT                   MLFTDHLHGNTYGHAINFLRVDKHNPNAPVYLGFSTSNVGSLNEHFVMFPESNIANHQR
FT                   FNKTPIKAVGSTKDYAQRVGTVSDTIAAIKGKVSSLENRLSAIHQEADIMAAQAKVSQL
FT                   QGKLASTLKQSDSLNLQVRQLNDTKGSLRTELLAAKAKQAQLEATRDQSLAKLASLKAA
FT                   LHQTEALAEQAAARVTALVAKKAHLQYLRDFKLNPNRLQVIRERIDNTKQDLAKTTSSL
FT                   LNAQEALAALQAKQSSLEATIATTEHQLTLLKTLANEKEYRHLDEDIATVPDLQVAPPL
FT                   TGVKPLSYSKIDTTPLVQEMVKETKQLLEASARLAAENTSLVAEALVGQTSEMVASNAI
FT                   VSKITSSITQPSSKTSYGSGSSTTSNLISDVDESTQRALKAGVVMLAAVGLTGFRFRKE
FT                   SK"
FT   gene            235882..236295
FT                   /gene="rpsL"
FT                   /locus_tag="SPy_0271"
FT                   /old_locus_tag="SPy0271"
FT   CDS_pept        235882..236295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SPy_0271"
FT                   /old_locus_tag="SPy0271"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Best Blastp hit = sp|P30891|RS12_STRPN 30S RIBOSOMAL
FT                   PROTEIN S12 >gi|282336|pir||S26680 ribosomal protein S12 -
FT                   Streptococcus pneumoniae >gi|47453|emb|CAA78825.1| (Z15120)
FT                   ribosomal protein S12 [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33345"
FT                   /db_xref="GOA:P66376"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66376"
FT                   /protein_id="AAK33345.1"
FT                   /translation="MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG"
FT   gene            236316..236786
FT                   /gene="rpsG"
FT                   /locus_tag="SPy_0272"
FT                   /old_locus_tag="SPy0272"
FT   CDS_pept        236316..236786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SPy_0272"
FT                   /old_locus_tag="SPy0272"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Best Blastp hit = sp|P21469|RS7_BACSU 30S RIBOSOMAL
FT                   PROTEIN S7 (BS7) >gi|7440222|pir||F69699 ribosomal protein
FT                   S7 (rpsG) - Bacillus subtilis >gi|1644222|dbj|BAA11002.1|
FT                   (D64127) ribosomal protein S7 [Bacillus subtilis]
FT                   >gi|2632378|emb|CAB11887.1| (Z99104) ribosomal protein S7
FT                   (BS7) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33346"
FT                   /db_xref="GOA:P66619"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66619"
FT                   /protein_id="AAK33346.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYD
FT                   AFNAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW"
FT   gene            237153..239231
FT                   /gene="fus"
FT                   /locus_tag="SPy_0273"
FT                   /old_locus_tag="SPy0273"
FT   CDS_pept        237153..239231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="SPy_0273"
FT                   /old_locus_tag="SPy0273"
FT                   /product="translation elongation factor G, EF-G"
FT                   /note="The N-terminal amino acid sequence of this ORF has
FT                   been determined from a spot isolated by 2-D gel
FT                   electrophoresis from another strain of S. pyogenes. Hogan,
FT                   D. A., Whitton, M. M., Rogers, J. and R. A. VanBogelen.
FT                   2000. Two-dimensional gel electrophoresis map of
FT                   Streptococcus pyogenes proteins. Unpublished data.; Best
FT                   Blastp hit = emb|CAC09927.1| (AJ249559) translation
FT                   elongation factor G, EF-G [Bacillus stearothermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33347"
FT                   /db_xref="GOA:P69946"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69946"
FT                   /protein_id="AAK33347.1"
FT                   /translation="MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQ
FT                   LPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETD
FT                   EDLMMKYLEGEEITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSP
FT                   LDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   MNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILES
FT                   IEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLD
FT                   VLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE"
FT   gene            239579..240589
FT                   /gene="plr"
FT                   /locus_tag="SPy_0274"
FT                   /old_locus_tag="SPy0274"
FT   CDS_pept        239579..240589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plr"
FT                   /locus_tag="SPy_0274"
FT                   /old_locus_tag="SPy0274"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, plasmin
FT                   receptor"
FT                   /EC_number="1.2.1.12"
FT                   /note="The N-terminal amino acid sequence of this ORF has
FT                   been determined from a spot isolated by 2-D gel
FT                   electrophoresis from another strain of S. pyogenes. Hogan,
FT                   D. A., Whitton, M. M., Rogers, J. and R. A. VanBogelen.
FT                   2000. Two-dimensional gel electrophoresis map of
FT                   Streptococcus pyogenes proteins. Unpublished data.; Best
FT                   Blastp hit = sp|P50467|G3P_STRPY GLYCERALDEHYDE 3-PHOSPHATE
FT                   DEHYDROGENASE (GAPDH) (PLASMINOGEN-BINDING PROTEIN)
FT                   (PLASMIN RECEPTOR) >gi|285385|pir||A42963
FT                   glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12) -
FT                   Streptococcus sp >gi|153763|gb|AAA26953.1| (M95569) plasmin
FT                   receptor [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33348"
FT                   /db_xref="GOA:P0C0G7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0G7"
FT                   /protein_id="AAK33348.1"
FT                   /translation="MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLL
FT                   KYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKE
FT                   AAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKA
FT                   LHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVI
FT                   PELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSS
FT                   DIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK"
FT   gene            complement(241073..241813)
FT                   /locus_tag="SPy_0276"
FT                   /old_locus_tag="SPy0276"
FT   CDS_pept        complement(241073..241813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0276"
FT                   /old_locus_tag="SPy0276"
FT                   /product="putative amino acid ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="Best Blastp hit = pir||H69334 glutamine transport
FT                   protein glnQ - Archaeoglobus fulgidus
FT                   >gi|2649950|gb|AAB90561.1| (AE001058) glutamine ABC
FT                   transporter, ATP-binding protein (glnQ) [Archaeoglobus
FT                   fulgidus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33349"
FT                   /db_xref="GOA:Q9A1H1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1H1"
FT                   /protein_id="AAK33349.1"
FT                   /translation="MSNSIIEIKNLKKSYGSNEVLKDISLSVNKGEVISIIGSSGSGKS
FT                   TLLRSINLLEEPSAGQILFHGEDVLAEHYNLTHYREKLGMVFQSFNLFENLNVLENAIV
FT                   AQTTVLKRDRAQAEQIAKENLNAVGMTEQYWQAKPKQLSGGQKQRVAIARALSVNPEAM
FT                   LFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTHEMEFARDVSDRIIFMDKGLITEE
FT                   GSPQQIFENPTQDRTKEFLQRFLK"
FT   gene            complement(241806..243374)
FT                   /locus_tag="SPy_0277"
FT                   /old_locus_tag="SPy0277"
FT   CDS_pept        complement(241806..243374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0277"
FT                   /old_locus_tag="SPy0277"
FT                   /product="putative glutamine-binding periplasmic protein"
FT                   /note="Best Blastp hit = pir||S77250 hypothetical protein -
FT                   Synechocystis sp. (strain PCC 6803)
FT                   >gi|1652664|dbj|BAA17584.1| (D90907) glutamine-binding
FT                   periplasmic protein [Synechocystis sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33350"
FT                   /db_xref="GOA:Q9A1H0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1H0"
FT                   /protein_id="AAK33350.2"
FT                   /translation="MKKLILSCLVALALLFGGMSRAQANQYLRVGMEAAYAPFNWTQDD
FT                   ASNGAVPIEGTSQYANGYDVQVAKKVAKAMNKELLVVKTSWTGLIPALTSGKIDMIAAG
FT                   MSPTKERRNEISFSNSYYTSQPVLVVTANGKYADATSLKDFSGAKVTAQQGVWHVNLLT
FT                   QLKGAKLQTPMGDFSQMRQALTSGVIDAYISERPEAMTAEAADSRLKMITLKKGFAVAE
FT                   SDAAIAVGMKKNDDRMATVNQVLEGFSQTDRMALMDDMVTKQPVEKKAEDAKASFLGQM
FT                   WAIFKGNWKQFLRGTGMTLLISMVGTITGLFIGLLIGIFRTAPKAKHKVAALGQKLFGW
FT                   LLTIYIEIFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMSEIVRGGI
FT                   FAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVVE
FT                   LYFSGNTVATQTYQYFQTFTIIAIIYFVLTFTVTRILRYIERRFDADTYTTGANQMQIA
FT                   EVSNV"
FT   gene            243572..245470
FT                   /locus_tag="SPy_0278"
FT                   /old_locus_tag="SPy0278"
FT   CDS_pept        243572..245470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0278"
FT                   /old_locus_tag="SPy0278"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33351"
FT                   /db_xref="GOA:Q9A1G9"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1G9"
FT                   /protein_id="AAK33351.1"
FT                   /translation="MKKILMTLVLCFSLLGIRIKAADVDYSITNYEGQLLLSKENTARF
FT                   EQKVTYQFDTSYNGQYISLGRTGHLPAGFAIDQKPKVEVYQNGQQVPVSQEFSDLGDGY
FT                   RLKLYNAGQAGDKVDVKVIWQLHHLLTAYQDVAELNWTPISDWDKTLEKVSLTVTTPTD
FT                   IQDSNLWAHRGYYQKKPQVLKEGNSRYQINAKNVSGQLELHAYWDKKALLGKEPVDVST
FT                   SKKNKIVALETKISRRRTLLQLLFGKVIPLVEVGFLLWQLIQFTRLKKQFNRYHLANHT
FT                   DHSYEVPEDLSPLVLTQAIYGQSFAYLSPTASESQKLLIPKGVTFEALVQATLLDLIDQ
FT                   KVLLLTKEEGKAYLEISQLDRVTDEEAAFLDMAFGNKVTLPVDQLFSQYHYDADTIKQL
FT                   KKTYKGKKLEQEVRQSSEQVIKAMKKASAAITNNVLETIKKLNLPDTYRQMTPAEKRKS
FT                   NSVQGLGCLLLILNSGLLIYLAIKESGLALIYLALMVLTMCLGFYISLKLDQYKKLGIE
FT                   TPEGGVRLHQWQSFKNMIRDIDKFEDVAIEGLVVWNRVLVYATLFGYAKKVERYLKVHR
FT                   IALPEVYQAVRPGELSMVMYATTPTFVSSLSSATTSSNFSVSSGGGISGGGGGGAF"
FT   gene            245536..246375
FT                   /gene="bacA"
FT                   /locus_tag="SPy_0280"
FT                   /old_locus_tag="SPy0280"
FT   CDS_pept        245536..246375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SPy_0280"
FT                   /old_locus_tag="SPy0280"
FT                   /product="putative undecaprenol kinase (bacitracin
FT                   resistance protein)"
FT                   /note="Best Blastp hit = gb|AAD50462.1|AF169967_5
FT                   (AF169967) BacA [Flavobacterium johnsoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33352"
FT                   /db_xref="GOA:P67392"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67392"
FT                   /protein_id="AAK33352.1"
FT                   /translation="MLIIELLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLNQDKAF
FT                   IEMFNIVIQLGAIIAVMLIYFERLNPFQPGKTAREVQLTWQLWLKVVIACIPSILIAVP
FT                   LDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTELARMSYKTAFFIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRTVAADFTFFLAIPTMFGYSGLKAVKFFLDGHHLDF
FT                   AQVLILLVASLTAFVVSLLAIRFLTDYVKKHDFTIFGKYRIVLGSLLLIYSFFKFVF"
FT   gene            246521..247282
FT                   /gene="mecA"
FT                   /locus_tag="SPy_0281"
FT                   /old_locus_tag="SPy0281"
FT   CDS_pept        246521..247282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /locus_tag="SPy_0281"
FT                   /old_locus_tag="SPy0281"
FT                   /product="putative negative regulator of genetic
FT                   competence"
FT                   /note="Best Blastp hit = dbj|BAA82113.1| (AB022909)
FT                   negative regulator of genetic competence [Streptococcus
FT                   mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33353"
FT                   /db_xref="GOA:P60187"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60187"
FT                   /protein_id="AAK33353.1"
FT                   /translation="MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVM
FT                   DELDLPDNFKDSGMLSFRVTPRKDRLDVFVTKSEINKDINLEDLAEFGDMSQMTPEDFF
FT                   KSLEQSMREKGDVKAHEKLEKIEEIMEDVVEATLANQSEAADPSTNHESEPLDYVHYVL
FT                   DFSTITEAVAFAKTIDFSIEASELYKGSNCYHMTILLDVQQQPSYFANVMYARLIEHAN
FT                   PGSKTRAYLQEHGLQLMLDGAVEQLQKIELG"
FT   gene            247289..248458
FT                   /gene="rgpG"
FT                   /locus_tag="SPy_0282"
FT                   /old_locus_tag="SPy0282"
FT   CDS_pept        247289..248458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpG"
FT                   /locus_tag="SPy_0282"
FT                   /old_locus_tag="SPy0282"
FT                   /product="possibly involved in regulation of genetic
FT                   competence"
FT                   /note="Best Blastp hit = dbj|BAA82114.1| (AB022909) RgpG
FT                   [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33354"
FT                   /db_xref="GOA:Q9A1G6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1G6"
FT                   /protein_id="AAK33354.1"
FT                   /translation="MFSFTIDYVLVLIGALLMSLFLTPLVRFLAFRVGAVDNPNARRVN
FT                   KVPMPTSGGLAIFMSFLVASLGLIPIASKGAMFFGQTYFSYILPVVIGATVITLTGFLD
FT                   DLYELSPKLKMFGILIGAVIVWAFTDFKFDSFKIPFGGPLLVFGPFLTLFLTVLWIVSI
FT                   TNAINLIDGLDGLVSGVSIISLVTMAIVSYFFLPQKDFFLTLTILVLISAIAGFFPYNY
FT                   HPAMIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPVIILGVPIMDTIVAIIRRSLS
FT                   GQKFYEPDKMHLHHRLLSMGFTHRGAVLVVYGITMLFSLISLLLNVSSRIGGVLLMLGL
FT                   LFGLEVFIEGLEIWGEKRTPLFNLLKFIGNSDYRQAMLLKWKEKKDLKH"
FT   gene            248580..249350
FT                   /locus_tag="SPy_0285"
FT                   /old_locus_tag="SPy0285"
FT   CDS_pept        248580..249350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0285"
FT                   /old_locus_tag="SPy0285"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="Best Blastp hit = sp|P80866|V296_BACSU VEGETATIVE
FT                   PROTEIN 296 (VEG296) >gi|7445790|pir||H70019 ABC
FT                   transporter (ATP-binding protein) homolog yurY - Bacillus
FT                   subtilis >gi|2635767|emb|CAB15260.1| (Z99120) similar to
FT                   ABC transporter (ATP-binding protein) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33355"
FT                   /db_xref="GOA:Q9A1G5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1G5"
FT                   /protein_id="AAK33355.1"
FT                   /translation="MSILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTQGQILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNAGKADEDKISVRDFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDAALATRLEKEGYAGIAQDLGIEYKEES"
FT   gene            249445..250707
FT                   /locus_tag="SPy_0287"
FT                   /old_locus_tag="SPy0287"
FT   CDS_pept        249445..250707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0287"
FT                   /old_locus_tag="SPy0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||G70019 conserved hypothetical
FT                   protein yurX - Bacillus subtilis
FT                   >gi|2635766|emb|CAB15259.1| (Z99120) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33356"
FT                   /db_xref="GOA:Q9A1G4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1G4"
FT                   /protein_id="AAK33356.1"
FT                   /translation="MTKEKLVAFSQAHAEPAWLQERRLAALEAIPNLELPTIERVKFHR
FT                   WNLGDGTLTENESLASVPDFIAIGDNPKLVQVGTQTVLEQLPMALIDKGVVFSDFYTAL
FT                   EEIPEVIEAHFGQALAFDEDKLAAYHTAYFNSAAVLYVPDHLEITTPIEAIFLQDSDSD
FT                   VPFNKHVLVIAGKESKFTYLERFESIGNATQKISANISVEVIAQAGSQIKFSAIDRLGP
FT                   SVTTYISRRGRLEKDANIDWALAVMNEGNVIADFDSDLIGQGSQADLKVVAASSGRQVQ
FT                   GIDTRVTNYGQRTVGHILQHGVILERGTLTFNGIGHILKDAKGADAQQESRVLMLSDQA
FT                   RADANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDQETAERLVIRGFLGAVIAE
FT                   IPIPSVRQEIIKVLDEKLLNR"
FT   gene            250738..251964
FT                   /locus_tag="SPy_0288"
FT                   /old_locus_tag="SPy0288"
FT   CDS_pept        250738..251964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0288"
FT                   /old_locus_tag="SPy0288"
FT                   /product="putative aminotransferase"
FT                   /note="Best Blastp hit = pir||F70019 nifS protein homolog
FT                   yurW - Bacillus subtilis >gi|2635765|emb|CAB15258.1|
FT                   (Z99120) similar to NifS protein homolog [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33357"
FT                   /db_xref="GOA:Q9A1G3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1G3"
FT                   /protein_id="AAK33357.1"
FT                   /translation="MLDAKDIKQDFQILNQQVNDEPLVYLDNAATTQKPALVLEALQSY
FT                   YQEDNANVHRGVHTLAERATLKYEASRQQVADFIHAKSSKEVLFTRGTTTSLNWVARFA
FT                   EQVLTPEDEVLISIMEHHANIIPWQQACQKTGARLVYVYLKDGQLDMDDLANKLTTKTR
FT                   FVSLVHVSNVLGCINPIKEIAKLAHAKGAYLVVDGAQSVPHLAIDVQDLDCDFFAFSAH
FT                   KMLGPTGLGVLYGKEELLNQVEPLEFGGEMIDFVYEQEATWKELPWKFEAGTPHIAGAI
FT                   GLSAAISYLQRLGMADIHAHEAELIAYVLPKLEAIEGLTIYGPSQPSARSGLISFNLDD
FT                   LHPHDLATALDYEGVAVRAGHHCAQPLLSYLGVPATVRASFYIYNTKADCDRLVEAILK
FT                   AKEFFNGTL"
FT   gene            251951..252430
FT                   /locus_tag="SPy_0289"
FT                   /old_locus_tag="SPy0289"
FT   CDS_pept        251951..252430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0289"
FT                   /old_locus_tag="SPy0289"
FT                   /product="NifU-like protein"
FT                   /note="Best Blastp hit = sp|O32163|NIFU_BACSU NIFU-LIKE
FT                   PROTEIN >gi|7427865|pir||E70019 nitrogen fixation protein
FT                   nifU homolog yurV - Bacillus subtilis
FT                   >gi|2635764|emb|CAB15257.1| (Z99120) similar to NifU
FT                   protein homolog [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33358"
FT                   /db_xref="GOA:Q9A1G2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="PDB:1SU0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1G2"
FT                   /protein_id="AAK33358.1"
FT                   /translation="MALSKLNHLYMAVVADHSKRPHHHGQLDGVEAVQLNNPTCGDVIS
FT                   LTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKEEALALADIFSEMVQGQENP
FT                   AQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKRSANAQHLTDQNVKEGKNV"
FT   gene            252423..253841
FT                   /locus_tag="SPy_0290"
FT                   /old_locus_tag="SPy0290"
FT   CDS_pept        252423..253841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0290"
FT                   /old_locus_tag="SPy0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||D70019 conserved hypothetical
FT                   protein yurU - Bacillus subtilis
FT                   >gi|2635763|emb|CAB15256.1| (Z99120) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33359"
FT                   /db_xref="GOA:Q9A1G1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1G1"
FT                   /protein_id="AAK33359.1"
FT                   /translation="MSDINEKVEPKPIDLGDYQFGFHDDVEPIYSTGKGLSEAVVRELS
FT                   AAKNEPEWMLEFRLKSLETFNKMPMQTWGADLSDINFDDIIYYQKASDKPARSWDDVPE
FT                   KIKETFDRIGIPEAERAYLAGASAQYESEVVYHNMKGEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAAWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALTDATVEWIDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKSGGKVDYRGQVTFNKQSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   gene            complement(255342..256574)
FT                   /gene="dacA"
FT                   /locus_tag="SPy_0292"
FT                   /old_locus_tag="SPy0292"
FT   CDS_pept        complement(255342..256574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="SPy_0292"
FT                   /old_locus_tag="SPy0292"
FT                   /product="penicillin-binding protein (D-alanyl-D-alanine
FT                   carboxypeptidase)"
FT                   /note="Best Blastp hit = emb|CAA67776.1| (X99400)
FT                   D,D-carboxypeptidase [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33360"
FT                   /db_xref="GOA:Q9A1G0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1G0"
FT                   /protein_id="AAK33360.1"
FT                   /translation="MIKRLISLVVIALFFAASTVSGEEYSVTAKHAIAVDLESGKVLYE
FT                   KDAKEVVPVASVSKLLTTYLVYKEVSKGKLNWDSPVTISNYPYELTTNYTISNVPLDKR
FT                   KYTVKELLSALVVNNANSPAIALAEKIGGTEPKFVDKMKKQLRQWGISDAKVVNSTGLT
FT                   NHFLGANTYPNTEPDDENCFCATDLAIIARHLLLEFPEVLKLSSKSSTIFAGQTIYSYN
FT                   YMLKGMPCYREGVDGLFVGYSKKAGASFVATSVENQMRVITVVLNADQSHEDDLAIFKT
FT                   TNQLLQYLLINFQKVQLIENNKPVKTLYVLDSPEKTVKLVAQNSLFFIKPIHTKTKNTV
FT                   HITKKSSTMIAPLSKGQVLGRATLQDKHLIGQGYLDTPPSINLILQKNISKSFFLKVWW
FT                   NRFVRYVNTSL"
FT   gene            258940..260442
FT                   /gene="oppB"
FT                   /locus_tag="SPy_0294"
FT                   /old_locus_tag="SPy0294"
FT   CDS_pept        258940..260442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="SPy_0294"
FT                   /old_locus_tag="SPy0294"
FT                   /product="oligopeptidepermease"
FT                   /note="Best Blastp hit = emb|CAA61523.1| (X89237)
FT                   oligopeptidepermease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33361"
FT                   /db_xref="GOA:Q9A1F9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F9"
FT                   /protein_id="AAK33361.1"
FT                   /translation="MKKYILNRIMRSLVSVVLVTALTYTIVYTLVPTSLIFKQDPNYNK
FT                   MTTTPDKKVAYENLTFQRMGYVNYFSSKELKDNASKVDSSVTTEATSANKAIYEKYIDS
FT                   LGNGWQLKRFPTSKQFYAIRNIPIYERVWNFFSNLVVIDHPWKIQDKDNPKLARYIRLE
FT                   KDKSVGWSLVGSGTKHKYLLYTNGKFPYLHQNFVTLNLGTSYPTYSNIPVLQVISQGQG
FT                   RTALQDVTFPSGVTKKSSVDIYSRSYKNPKSLDDITKVNYGKGDSYTKTINNYVDPSMI
FT                   HNSFVIGFFGVMFSYIVGLPLGLFMARFKNTYFDSFSTATMTFMLALPSIAVIYVVRFL
FT                   GGMVGLPDSFPMLGASDPKSYILPALILGILNIPTTVIWFRRYLVDLQASDWVRFARSK
FT                   GLSESEIYRGHLFKNAMVPIVSGVPASIILAIGGATLTETVFAFPGMGKMLIDSIKSAN
FT                   NSMIVGLTFIFTVLSIVSLLLGDIVMTLVDPRIKLSTKKGGK"
FT   gene            260442..261368
FT                   /gene="oppC"
FT                   /locus_tag="SPy_0295"
FT                   /old_locus_tag="SPy0295"
FT   CDS_pept        260442..261368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="SPy_0295"
FT                   /old_locus_tag="SPy0295"
FT                   /product="oligopeptidepermease"
FT                   /note="Best Blastp hit = emb|CAA61524.1| (X89237)
FT                   oligopeptidepermease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33362"
FT                   /db_xref="GOA:Q9A1F8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F8"
FT                   /protein_id="AAK33362.1"
FT                   /translation="MESIDKSKFRFVERDSEASEVIDTPAYSYWKSVFRQFFSKKSTVF
FT                   MLVILVTVLMMSFIYPMFANYDFNDVSNINDFSKRYIWPNAEYWFGTDKNGQSLFDGVW
FT                   YGARNSILISVIATLINITIGVVLGAIWGVSKAFDKVMIEIYNIISNIPSMLIIIVLTY
FT                   SLGAGFWNLILAFCITGWIGVAYSIRVQILRYRDLEYNLASQTLGTPMYKIAVKNLLPQ
FT                   LVSVIMTMLSQMLPVYVSSEAFLSFFGIGLPTTTPSLGRFIANYSSNLTTNAYLFWIPL
FT                   VTLILVSLPLYIVGQNLADASDPRSHR"
FT   gene            261377..262447
FT                   /gene="oppD"
FT                   /locus_tag="SPy_0296"
FT                   /old_locus_tag="SPy0296"
FT   CDS_pept        261377..262447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="SPy_0296"
FT                   /old_locus_tag="SPy0296"
FT                   /product="oligopeptidepermease (ATP-binding protein)"
FT                   /note="Best Blastp hit = emb|CAA61525.1| (X89237)
FT                   oligopeptidepermease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33363"
FT                   /db_xref="GOA:Q9A1F7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F7"
FT                   /protein_id="AAK33363.1"
FT                   /translation="MTKENNVILTAKDVVVEFDVRDRVLTAIRNVSLELVEGEVLAFVG
FT                   ESGSGKSVLTKTFTGMLESNGRIANGSIVYRGQELTDLKTNKEWAKIRGSKIATIFQDP
FT                   MTSLSPIKTIGSQITEVIIKHQKVSHAKAKEMALDYMNKVGIPNAKKRFEDYPFEYSGG
FT                   MRQRIVIAIALACRPDILICDEPTTALDVTIQAQIVELLKSLQREYHFTIIFITHDLGV
FT                   VASIADKVAVMYAGEIVEFGTVEEIFYDPRHPYTWSLLSSLPQLADESGELYAIPGTPP
FT                   SLYSPIIGDAFALRSEYAMVLDFEKAPPAINVSETHWAKTWLLHPEAPKVQKPEVIQDL
FT                   HQKILRKMSQQEEGNV"
FT   gene            262440..263363
FT                   /gene="oppF"
FT                   /locus_tag="SPy_0297"
FT                   /old_locus_tag="SPy0297"
FT   CDS_pept        262440..263363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="SPy_0297"
FT                   /old_locus_tag="SPy0297"
FT                   /product="oligopeptidepermease"
FT                   /note="Best Blastp hit = gb|AAG32327.1| (AF305548)
FT                   oligopeptidepermease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33364"
FT                   /db_xref="GOA:P0A2V6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2V6"
FT                   /protein_id="AAK33364.1"
FT                   /translation="MSEKLVEVKDLEISFGEGKKKFVAVKNANFFIKKGETFSLVGESG
FT                   SGKTTIGRAIIGLNDTSSGQILYDGKVINGRKSKSEANELIRKIQMIFQDPAASLNERA
FT                   TVDYIISEGLYNFNLFKTEEERKEKIKNMMAEVGLLSEHLTRYPHEFSGGQRQRIGIAR
FT                   ALVMNPEFVIADEPISALDVSVRAQVLNLLKRMQAEKGLTYLFIAHDLSVVRFISDRIA
FT                   VIHKGVIVEVAETEELFNNPIHPYTQSLLSAVPIPDPILERQKELVVYHPDQHDYTLDK
FT                   PSMVEIKPNHFVWANQAEIEKYQKEL"
FT   gene            complement(263407..263484)
FT                   /locus_tag="SPy_0298"
FT                   /old_locus_tag="SPy0298"
FT   misc_feature    complement(263407..263484)
FT                   /locus_tag="SPy_0298"
FT                   /old_locus_tag="SPy0298"
FT                   /note="This sequence encodes the C-terminal portion of a
FT                   putative transposase"
FT   gene            complement(263550..263937)
FT                   /locus_tag="SPy_0299"
FT                   /old_locus_tag="SPy0299"
FT   misc_feature    complement(263550..263937)
FT                   /locus_tag="SPy_0299"
FT                   /old_locus_tag="SPy0299"
FT                   /note="This sequence contains a gene fragment encoding the
FT                   majority of a hypothetical protein associated with IS861.
FT                   The region contains several mutations and appears to be
FT                   truncated by several amino acids at the N-terminus"
FT   gene            264453..265788
FT                   /locus_tag="SPy_r07"
FT   rRNA            264453..265788
FT                   /locus_tag="SPy_r07"
FT                   /product="16S ribosomal RNA"
FT   gene            265950..266025
FT                   /locus_tag="SPy_t35"
FT   tRNA            265950..266025
FT                   /locus_tag="SPy_t35"
FT                   /product="tRNA-Ala"
FT   gene            266321..269224
FT                   /locus_tag="SPy_r08"
FT   rRNA            266321..269224
FT                   /locus_tag="SPy_r08"
FT                   /product="23S ribosomal RNA"
FT   gene            269433..269506
FT                   /locus_tag="SPy_t36"
FT   tRNA            269433..269506
FT                   /locus_tag="SPy_t36"
FT                   /product="tRNA-Asn"
FT   gene            269586..269659
FT                   /locus_tag="SPy_t37"
FT   tRNA            269586..269659
FT                   /locus_tag="SPy_t37"
FT                   /product="tRNA-Arg"
FT   gene            269685..270236
FT                   /gene="comX1.1"
FT                   /locus_tag="SPy_0300"
FT                   /old_locus_tag="SPy0300"
FT   CDS_pept        269685..270236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX1.1"
FT                   /locus_tag="SPy_0300"
FT                   /old_locus_tag="SPy0300"
FT                   /product="putative competence protein"
FT                   /note="Best Blastp hit = gb|AAD50427.1|AF161700_2
FT                   (AF161700) ComX1 [Streptococcus pneumoniae]
FT                   >gi|5739315|gb|AAD50429.1|AF161701_2 (AF161701) ComX2
FT                   [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33365"
FT                   /db_xref="UniProtKB/TrEMBL:Q99Q57"
FT                   /protein_id="AAK33365.1"
FT                   /translation="MSCCFFVVLFILGIVKKKRRLKMSIETRAAFEKVKPIILKLKRHY
FT                   YIQLWDRDDWLQEGHIILLQLLERYPELIEEEERLYRYFKTKFSSYLKDLLRRQESQKR
FT                   QFHKLAYEEIGEVAHAIPSRGLWLDDYVAYQEVIASLENQLNSQERMQFQALIRGERFK
FT                   GRRALLRKISPYFKEFAQQL"
FT   gene            270847..271980
FT                   /locus_tag="SPy_0303"
FT                   /old_locus_tag="SPy0303"
FT   CDS_pept        270847..271980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0303"
FT                   /old_locus_tag="SPy0303"
FT                   /product="putative transposase, IS1548"
FT                   /note="Best Blastp hit = emb|CAA74641.1| (Y14270) putative
FT                   transposase [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33366"
FT                   /db_xref="GOA:Q9A1F6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F6"
FT                   /protein_id="AAK33366.1"
FT                   /translation="MIDFIISIDDCAVELDSRQSWKIRSPLSTILFLVFVCQLAGIETW
FT                   KEMEDFIEMNEPLFATYVDLSEGCSSHDTLERVISLVNSDRLKELKVQFEQSLTSLDAV
FT                   HQLISVDGKTIRGNRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLRTID
FT                   IRKSIVTIDAMGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEELQEN
FT                   AQYYQTVEKSRGQIEVREYWVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQENR
FT                   YFIFSFKPDVLTFANCVRGHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKMCLY
FT                   FLKVMVFPKKDLSYRRKQRYISVHLEDYLVQLFGERG"
FT   gene            272086..272670
FT                   /locus_tag="SPy_0305"
FT                   /old_locus_tag="SPy0305"
FT   CDS_pept        272086..272670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0305"
FT                   /old_locus_tag="SPy0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P54452|YQEG_BACSU HYPOTHETICAL
FT                   20.1 KD PROTEIN IN NUCB-AROD INTERGENIC REGION
FT                   >gi|7474689|pir||C69951 conserved hypothetical protein yqeG
FT                   - Bacillus subtilis >gi|1303787|dbj|BAA12443.1| (D84432)
FT                   YqeG [Bacillus subtilis] >gi|2635014|emb|CAB14510.1|
FT                   (Z99117) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33367"
FT                   /db_xref="GOA:Q9A1F5"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F5"
FT                   /protein_id="AAK33367.1"
FT                   /translation="MLFQKKYDKIESTNYFGDDMSIDDYRPTYMVEAIYDLRANDLLRH
FT                   GITAVLVDLDNTLIAWNNPDGTPEVRAWLDEMTIADISVVVVSNNKHSRVERAVSRFGV
FT                   DFISRALKPFAYGIEKAIARYGFDRNEVIMVGDQLMTDIRASHRAGIKSVLVKPLVASD
FT                   AWNTKINRWRERRVMAKLEEKYGKLSYQKGI"
FT   gene            272670..273788
FT                   /locus_tag="SPy_0306"
FT                   /old_locus_tag="SPy0306"
FT   CDS_pept        272670..273788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0306"
FT                   /old_locus_tag="SPy0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P54453|YQEH_BACSU HYPOTHETICAL
FT                   41.0 KD PROTEIN IN NUCB-AROD INTERGENIC REGION
FT                   >gi|7474690|pir||D69951 conserved hypothetical protein yqeH
FT                   - Bacillus subtilis >gi|1303788|dbj|BAA12444.1| (D84432)
FT                   YqeH [Bacillus subtilis] >gi|2635013|emb|CAB14509.1|
FT                   (Z99117) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33368"
FT                   /db_xref="GOA:Q9A1F4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F4"
FT                   /protein_id="AAK33368.1"
FT                   /translation="MEELFCIGCGIQIQTEDKEKAGFTPAAALKKGMETGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLRLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFISGNDVLL
FT                   VGNKKDILPKSVKDGKVTQWLTERAHEEGLRPLDVMLTSAQNKYAIKDLIGRINELRNG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGNKDVITTSRFPGTTLDKIEIPLDDGTFIFDTPG
FT                   IIHRHQMAHYLSPKELKIVSPKKEIKPKTYQLNPEQTLFLGGLARFDFINGERQGFTAF
FT                   FDNQLELHRTKLAGADAFYDKHVGTLLTPPDKKELTAFPKLVRHEFTIDQKMDIVFSGL
FT                   GWIRVNGQKDSKAIVAAWAPEGVAVIVRKAII"
FT   gene            273813..274121
FT                   /locus_tag="SPy_0307"
FT                   /old_locus_tag="SPy0307"
FT   CDS_pept        273813..274121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0307"
FT                   /old_locus_tag="SPy0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P54454|YQEI_BACSU HYPOTHETICAL
FT                   10.8 KD PROTEIN IN AROD-COMER INTERGENIC REGION
FT                   >gi|7451070|pir||E69951 dihydrodipicolinate reductase
FT                   homolog yqeI - Bacillus subtilis
FT                   >gi|1303790|dbj|BAA12446.1| (D84432) YqeI [Bacillus
FT                   subtilis] >gi|2635011|emb|CAB14507.1| (Z99117) similar to
FT                   dihydrodipicolinate reductase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33369"
FT                   /db_xref="GOA:Q9A1F3"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F3"
FT                   /protein_id="AAK33369.1"
FT                   /translation="MLTSKQRAFLKSEAHSLKPIVQIGKNGLNDHIKTSIRQALDAREL
FT                   IKVTLLQNTDEDIHEVAEILEEEIGCDTVLKIGRILILYKVSAKKENRKLSPKVKAI"
FT   gene            274190..274822
FT                   /locus_tag="SPy_0308"
FT                   /old_locus_tag="SPy0308"
FT   CDS_pept        274190..274822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0308"
FT                   /old_locus_tag="SPy0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P54455|NADD_BACSU PROBABLE
FT                   NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE (DEAMIDO-NAD(+)
FT                   PYROPHOSPHORYLASE) (DEAMIDO-NAD(+) DIPHOSPHORYLASE)
FT                   (NICOTINATE MONONUCLEOTIDE ADENYLYLTRANSFERASE) (NAMN
FT                   ADENYLYLTRANSFERASE) >gi|7430069|pir||F69951 conserved
FT                   hypothetical protein yqeJ - Bacillus subtilis
FT                   >gi|1303791|dbj|BAA12447.1| (D84432) YqeJ [Bacillus
FT                   subtilis] >gi|2635010|emb|CAB14506.1| (Z99117) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33370"
FT                   /db_xref="GOA:Q9A1F2"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1F2"
FT                   /protein_id="AAK33370.1"
FT                   /translation="MALELLTPFTKVELEEEKKESNRKQIGILGGNFNPIHNAHLVVAD
FT                   QVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLRMLELAIEDVEGLAIETCELERQGI
FT                   SYTYDTMLYLTEQHPDVDFYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRPKYKAGTS
FT                   YPVIWVDLPLIDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ"
FT   gene            274819..275412
FT                   /locus_tag="SPy_0309"
FT                   /old_locus_tag="SPy0309"
FT   CDS_pept        274819..275412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0309"
FT                   /old_locus_tag="SPy0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P54456|YQEK_BACSU HYPOTHETICAL
FT                   21.3 KD PROTEIN IN AROD-COMER INTERGENIC REGION
FT                   >gi|7429525|pir||G69951 conserved hypothetical protein yqeK
FT                   - Bacillus subtilis >gi|1303792|dbj|BAA12448.1| (D84432)
FT                   YqeK [Bacillus subtilis] >gi|2635009|emb|CAB14505.1|
FT                   (Z99117) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33371"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F1"
FT                   /protein_id="AAK33371.1"
FT                   /translation="MTYEDYLPYSRTELLAKIAEQMSPKRFKHVLGVEKAALSLAECYG
FT                   CNPDKAGLAALLHDYAKECPDQVFLDLIDKYQLSPELAKWNNNVWHGMVGIYKIQEDLG
FT                   LKDKDILRAIEIHTVGAAEMTLLDKVLYVADYIEEGRIFPLVDDARKIAKLDLNQAVAY
FT                   ETVNTVAYLASKAQPIFPQTLDTYNAFCSYLKEY"
FT   gene            275412..275789
FT                   /locus_tag="SPy_0310"
FT                   /old_locus_tag="SPy0310"
FT   CDS_pept        275412..275789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0310"
FT                   /old_locus_tag="SPy0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P54457|YQEL_BACSU HYPOTHETICAL
FT                   13.3 KD PROTEIN IN AROD-COMER INTERGENIC REGION
FT                   >gi|7444652|pir||H69951 ybeB protein homolog yqeL -
FT                   Bacillus subtilis >gi|1303793|dbj|BAA12449.1| (D84432) YqeL
FT                   [Bacillus subtilis] >gi|2635008|emb|CAB14504.1| (Z99117)
FT                   similar to hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33372"
FT                   /db_xref="GOA:Q9A1F0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1F0"
FT                   /protein_id="AAK33372.1"
FT                   /translation="MDNDMRNKMKKEELLKIVVEATEEKRAKDILALDLEGLTSLTDYF
FT                   VIASATNSRQLEAIADNIREKVKEAGGDASHVEGNSQAGWVLLDLTDVVVHLFLEDERY
FT                   HYNLEKLWHEAPAVALDAYLA"
FT   gene            275789..276580
FT                   /locus_tag="SPy_0312"
FT                   /old_locus_tag="SPy0312"
FT   CDS_pept        275789..276580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0312"
FT                   /old_locus_tag="SPy0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P54458|YQEM_BACSU HYPOTHETICAL
FT                   28.3 KD PROTEIN IN AROD-COMER INTERGENIC REGION
FT                   >gi|7474691|pir||A69952 conserved hypothetical protein yqeM
FT                   - Bacillus subtilis >gi|1303794|dbj|BAA12450.1| (D84432)
FT                   YqeM [Bacillus subtilis] >gi|2635007|emb|CAB14503.1|
FT                   (Z99117) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33373"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1E9"
FT                   /protein_id="AAK33373.1"
FT                   /translation="MLQRDLVNTTGFLRMIMEHNYEKFASVYDAVMDDSLYDLWTDFSL
FT                   RHLPKSKGRNRLLELACGTGIQSVRFAQAGFDVTGLDLSQDMLAIAKKRAQSAKKKIDF
FT                   IQGNMLDLSQVGQFDFVTCYSDSICYMQDEVDVGDVFKEVYDVLANDGIFIFDVHSTYQ
FT                   TDECFPGYSYHENADDFAMVWDTYADEAPHSVVHELTFFIQEDDGRFSRFDEVHEERTY
FT                   ELLTYDILLEQAGFKSFKVYADFEDKEPTKTSKRWFFVAYK"
FT   gene            276834..277940
FT                   /locus_tag="SPy_0314"
FT                   /old_locus_tag="SPy0314"
FT   CDS_pept        276834..277940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0314"
FT                   /old_locus_tag="SPy0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||B69875 conserved hypothetical
FT                   protein ylbM - Bacillus subtilis
FT                   >gi|2340009|emb|CAB11359.1| (Z98682) YlbM protein [Bacillus
FT                   subtilis] >gi|2633877|emb|CAB13379.1| (Z99111) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33374"
FT                   /db_xref="GOA:Q9A1E8"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1E8"
FT                   /protein_id="AAK33374.1"
FT                   /translation="MTVTGIIAEFNPFHNGHKYLLETAEGLKIIAMSGNFMQRGEPALI
FT                   DKWIRSEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQLGIQQLAFGTENVIDYQ
FT                   KLIKVYEKKSEQMTAYLSTLEDTFSYPQKTQKMWEIFAGVKFSGQTPNHILGLSYAKAS
FT                   AGKHIQLCPIKRQGAAYHSKDKNHLLASASAIRQHLNDWDFISHSVPNAGLLINNPHMS
FT                   WDHYFSFLKYQILNHSDLTSIFQVNDELASRIKKAIKVSQNIDHLVDTVATKRYTKARV
FT                   RRILTYILVNAKEPTLPKGIHILGFTSKGQAHLKKLKKSRPLITRIGAETWDEMTQKAD
FT                   SIYQLGHQDIPEQSFGRIPIIIKNERLN"
FT   gene            278292..278432
FT                   /locus_tag="SPy_0315"
FT                   /old_locus_tag="SPy0315"
FT   CDS_pept        278292..278432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0315"
FT                   /old_locus_tag="SPy0315"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33375"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1E7"
FT                   /protein_id="AAK33375.1"
FT                   /translation="MLKTILYFYFTKAFQSAIIRELESILVTLMLTIFNKILLKGDKNG
FT                   T"
FT   gene            278422..279138
FT                   /locus_tag="SPy_0316"
FT                   /old_locus_tag="SPy0316"
FT   CDS_pept        278422..279138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0316"
FT                   /old_locus_tag="SPy0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="The N-terminal amino acid sequence of this ORF has
FT                   been determined from a spot isolated by 2-D gel
FT                   electrophoresis from another strain of S. pyogenes. Hogan,
FT                   D. A., Whitton, M. M., Rogers, J. and R. A. VanBogelen.
FT                   2000. Two-dimensional gel electrophoresis map of
FT                   Streptococcus pyogenes proteins. Unpublished data.; Best
FT                   Blastp hit = sp|P76351|YEEN_ECOLI HYPOTHETICAL 25.9 KDA
FT                   PROTEIN IN AMN-CBL INTERGENIC REGION
FT                   >gi|7448338|pir||A64963 conserved hypothetical protein
FT                   b1983 - Escherichia coli >gi|1788294|gb|AAC75047.1|
FT                   (AE000290) orf, hypothetical protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33376"
FT                   /db_xref="GOA:P67188"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67188"
FT                   /protein_id="AAK33376.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNT
FT                   ALKFVIDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEA
FT                   EEGTITVYTAPTDLHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDAL
FT                   ESDDDVQKVYHNVADF"
FT   gene            279341..280183
FT                   /locus_tag="SPy_0317"
FT                   /old_locus_tag="SPy0317"
FT   CDS_pept        279341..280183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0317"
FT                   /old_locus_tag="SPy0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC45332.1| (U97348) basic
FT                   surface protein [Lactobacillus fermentum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33377"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1E5"
FT                   /protein_id="AAK33377.1"
FT                   /translation="MIKKQYLGRATIALASTLVLAACGSSKTAESGNQGSSKEVLFATV
FT                   GTTAPFSYEKGGQLTGYDIEVAKAVFKGSDDYKVSFKKTEWSSIFTGLDSGKYQMGGNN
FT                   ISFTKERSAKYLFSYPIGSTPSVLVVPKDSDIKSFDDIQGHTTQVVQGTTSVAQLEDFN
FT                   KKHSDNPVTLKFTNENITQMLTNLSEGKADFKIFDAPTVNAIIKNQGLDNLKTIELTST
FT                   EQPFIYFIFSQDQEKLQSFVNKRIKELTADGTLSKLAKEHLGGDYVPSDKELKLPTAN"
FT   gene            280512..281357
FT                   /locus_tag="SPy_0319"
FT                   /old_locus_tag="SPy0319"
FT   CDS_pept        280512..281357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0319"
FT                   /old_locus_tag="SPy0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB59827.1| (AJ012388)
FT                   hypothetical protein [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33378"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1E4"
FT                   /protein_id="AAK33378.1"
FT                   /translation="MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQA
FT                   RWDKVEELLKKDNITLKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLV
FT                   AIADTYISPINLFSGTSQDGKAKYKSVADLPNGTQIAVPNDATNESRALYVLQSAGLIK
FT                   LNVSGDQLATIANISENKKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSL
FT                   FKEKADDNSKQWINIIAGQKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
FT                   "
FT   gene            281607..282671
FT                   /locus_tag="SPy_0320"
FT                   /old_locus_tag="SPy0320"
FT   CDS_pept        281607..282671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0320"
FT                   /old_locus_tag="SPy0320"
FT                   /product="putative ABC transporter (ATP-binding protein)h"
FT                   /note="Best Blastp hit = emb|CAB59828.1| (AJ012388)
FT                   hypothetical protein [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33379"
FT                   /db_xref="GOA:Q9A1E3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1E3"
FT                   /protein_id="AAK33379.1"
FT                   /translation="MNEAIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSG
FT                   AGKSTLVRVINLLQAPTNGKITVDGDVTFDQGKIQLSADALRQKRRDIGMIFQHFNLMA
FT                   QKTAKENVAFALRHSSLSKTEKEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARA
FT                   LANDPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAV
FT                   MQNGVLIEEGSVLDIFSNPKEALTQEFITTATGIDEALEKINQQDIVKHLPANALLAQL
FT                   KYAGTSTDEPLLNSIYRQFEVTANILYGNIEILDHIPVGDMIVVLEGQAENILAAEKAL
FT                   HEAGVDVSILKRGA"
FT   gene            282672..283364
FT                   /locus_tag="SPy_0321"
FT                   /old_locus_tag="SPy0321"
FT   CDS_pept        282672..283364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0321"
FT                   /old_locus_tag="SPy0321"
FT                   /product="putative ABC transporter (permease protein)"
FT                   /note="Best Blastp hit = emb|CAB59829.1| (AJ012388)
FT                   hypothetical protein [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33380"
FT                   /db_xref="GOA:Q9A1E2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1E2"
FT                   /protein_id="AAK33380.2"
FT                   /translation="MSQLIQTYLPNVYELGWSGDAGWGLAIWNTLYMTIVPFIVGGAIG
FT                   LLLGLLLVLTGPDGVIENKTICWVIDKVTSIFRAIPFVILIAILASFTYLLLRTTLGAT
FT                   AALVPLTFATFPFYARQVQVVFSELDKGVIEAAQASGATFWDIVKVYLSEGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATIIILLIIFAIQFIGDS
FT                   LTRRFSHK"
FT   gene            complement(283418..284788)
FT                   /gene="braB"
FT                   /locus_tag="SPy_0323"
FT                   /old_locus_tag="SPy0323"
FT   CDS_pept        complement(283418..284788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braB"
FT                   /locus_tag="SPy_0323"
FT                   /old_locus_tag="SPy0323"
FT                   /product="putative branched-chain amino acid transport
FT                   protein"
FT                   /note="Best Blastp hit = sp|P54104|BRNQ_LACDL
FT                   BRANCHED-CHAIN AMINO ACID TRANSPORT SYSTEM CARRIER PROTEIN
FT                   (BRANCHED-CHAIN AMINO ACID UPTAKE CARRIER)
FT                   >gi|2127378|pir||S60180 branched-chain amino acid carrier
FT                   brnQ - Lactobacillus delbrueckii >gi|732813|emb|CAA88595.1|
FT                   (Z48676) branched-chain amino acid carrier [Lactobacillus
FT                   delbrueckii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33381"
FT                   /db_xref="GOA:Q9A1E1"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1E1"
FT                   /protein_id="AAK33381.1"
FT                   /translation="MKQKNVYIVIGFMLFALFFGAANLIYPAFLGIYSGHQILWSIIGF
FT                   CLTGVSLPLLGVIAVAKSGSGDVESLARPISKWYAIFYSSILYLSIGPFFAIPRTGATS
FT                   FSVGIAPILGDNTTNKAIYAILFFGLSYFLAIKPSKLAENIGKFLTPTLLVVISILVIA
FT                   SFVHPAGNYGDAFNAGVGVNNAFKDFPFIAGLIQGYGTMDALASLVFAILVIEATKQFG
FT                   AKTDKEMTKITLISGAIAILLLALVYIFVGRIGATSQSLFPFIDGSFTLHGNPVNGGQI
FT                   LSHASRFYLGGIGQAFLAVVIFLACLTTSTGLITSSAEYFHKLVPALSHIAWATIFTLL
FT                   SAFFYFGGLSVIINWSAPVLFLLYPLTVDLIFLVLAQKCFNNDPIVYRTTIGLTFIPAI
FT                   FDALLTLSQMTGLFHLPEAVVTFFQKTVPLGQFSMGWIIFAAIGFLIGLILSKTKKS"
FT   gene            285022..286236
FT                   /locus_tag="SPy_0324"
FT                   /old_locus_tag="SPy0324"
FT   CDS_pept        285022..286236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0324"
FT                   /old_locus_tag="SPy0324"
FT                   /product="putative sodium/dicarboxylate symporter"
FT                   /note="Best Blastp hit = gb|AAF95950.1| (AE004347)
FT                   sodium/dicarboxylate symporter [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33382"
FT                   /db_xref="GOA:Q9A1E0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1E0"
FT                   /protein_id="AAK33382.1"
FT                   /translation="MKKIYDLWVRVSLIKKIGIGVVIGVMLGILAPDLTGFSILGKLFV
FT                   GGLKAIAPLLVFALVSQAISHQKKGKQTNMTLIIVLYLFGTFASALVAVLTAYLFPLTL
FT                   VLNTPVNTELSPPQGVAEVFQSLLLKLVDNPINALATANYIGVLSWAIIFGLALKAASK
FT                   ETKHLIKTAAEVTSQIVVWIINLAPIGIMSLVFTTISENGVGILSDYAFLILVLVGTML
FT                   FVALVVNPLIAVLITRQNPYPLVLRCLRESGLTAFFTRSSAANIPVNMQLCQKIGLSKD
FT                   TYSVSIPLGATINMGGAAITINVLTLAAVHTFGIPIDFLTALLLSVVAAVSACGASGVA
FT                   GGSLLLIPVACSLFGISNDLAMQVVGVGFIVGVIQDSCETALNSSTDVLFTAIAENAFW
FT                   KRKKA"
FT   gene            complement(286291..286965)
FT                   /locus_tag="SPy_0326"
FT                   /old_locus_tag="SPy0326"
FT   CDS_pept        complement(286291..286965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0326"
FT                   /old_locus_tag="SPy0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB04316.1| (AP001509) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33383"
FT                   /db_xref="GOA:Q9A1D9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1D9"
FT                   /protein_id="AAK33383.1"
FT                   /translation="MLKRKTVGVLGLGIFGRTVARELSNFDQDVIAIDIRESHVKEVAD
FT                   LVTKAAVGDITDKEFLLAVGIEHCDTVVIASGNNLESSVLAVMHCKKLGVPTIIAKAKN
FT                   KIFEEVLYGIGATKVITPERDSGKRVASNLLRRHIESIIYLEHGISMIEFVIPKSWEGQ
FT                   SLSELDVRRKYELNVIGMRQKEVKTLDTNVKPFEPLEPNTIIVAIANDHTFEKFDYLGY
FT                   LK"
FT   gene            complement(286975..288366)
FT                   /gene="ntpJ"
FT                   /locus_tag="SPy_0327"
FT                   /old_locus_tag="SPy0327"
FT   CDS_pept        complement(286975..288366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpJ"
FT                   /locus_tag="SPy_0327"
FT                   /old_locus_tag="SPy0327"
FT                   /product="putative V-type Na+-ATPase subunit J"
FT                   /note="Best Blastp hit = sp|P43440|NTPJ_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT J (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   J) >gi|487282|dbj|BAA04279.1| (D17462) Na+ -ATPase subunit
FT                   J [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33384"
FT                   /db_xref="GOA:Q9A1D8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1D8"
FT                   /protein_id="AAK33384.2"
FT                   /translation="MSGGNMKRSFIKSLSVTQRLTFSFAIVILIGTLLLSMPFTHYQNG
FT                   PNTVYLDHFFNVVSMVCVTGLSVVPVAEVYNGIGQTIAMALMQIGGLGLVTLIAVSTFA
FT                   LKRKMRLSDQTLLQSALNRGDSKDLKHYLFFAYKVTFSLEAFAAIVIMIDFIPRFGWKN
FT                   GIFNSIFLAVSAFCNAGFDNLGSSSLKDFMLNPTLNVIITFLIISGGLGFAVWVDLGVA
FT                   FKKYFFERPHCYGATFRKLSNQSRLVLQTTAVILFLGTFLTWFLEKDNSKTIANFSLHQ
FT                   QLMVSFFQTVTMRTAGFATISYNDTLAPTNILYMIQMVIGGAPGGTAGGIKVTTAAITF
FT                   LLFKAELSGQSEVTFRNRIIANKTIKQTMTVLIFFFAVLMIGFILLLSVEPHIAPIPLL
FT                   FESISAIATVGVSMDLTPQLSTAGRLIVIVLMFVGRVGPITVLISLIQRKEKTIQYATT
FT                   DILVG"
FT   gene            complement(288436..289149)
FT                   /gene="gidB"
FT                   /locus_tag="SPy_0329"
FT                   /old_locus_tag="SPy0329"
FT   CDS_pept        complement(288436..289149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SPy_0329"
FT                   /old_locus_tag="SPy0329"
FT                   /product="putative glucose-inhibited division protein"
FT                   /note="Best Blastp hit = sp|Q9K5M8|GIDB_BACHD GLUCOSE
FT                   INHIBITED DIVISION PROTEIN B >gi|10176685|dbj|BAB07779.1|
FT                   (AP001520) glucose-inhibited division protein [Bacillus
FT                   halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33385"
FT                   /db_xref="GOA:Q9A1D7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1D7"
FT                   /protein_id="AAK33385.1"
FT                   /translation="MTPQDFYRTLEEDGFSLSSKQKEQFDTYFKSLVEWNTKINLTAIT
FT                   EENEVYLKHFYDSIAPILQGFLANEPIKLLDIGAGAGFPSLPMKILFPNLEVTIIDSLN
FT                   KRISFLTLLAQELGLENVHFFHGRAEDFGQDKAFRGQFDVVTARAVARMQVLSELTIPF
FT                   LKIGGKLIALKAQAADQELEEAKNALCLLFGKVIKNHSYQLPNGDSRFITIVEKKKETP
FT                   NKYPRKAGLPNKKPL"
FT   gene            289299..289856
FT                   /gene="lemA"
FT                   /locus_tag="SPy_0330"
FT                   /old_locus_tag="SPy0330"
FT   CDS_pept        289299..289856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="SPy_0330"
FT                   /old_locus_tag="SPy0330"
FT                   /product="putative cytoplasmic membrane protein"
FT                   /note="Best Blastp hit = gb|AAG23700.1| (AF017421)
FT                   LemA-like protein [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33386"
FT                   /db_xref="GOA:Q9A1D6"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1D6"
FT                   /protein_id="AAK33386.1"
FT                   /translation="MPTVLIILVVLGVLALWLMISYNSLVKSRMHTKEAWSQIDVQLKR
FT                   RNDLIPNLIETVKGYASYEQKTFEKITDLRARVANASTPQETMAASNELSKQVTSLFAV
FT                   AENYPDLKANENFLKLQEELTNTENKISYSRQLYNSTTSNYNLQLESFPSNIAGKLFGF
FT                   KPSEFLQTPEAEKEVPKVEFNF"
FT   gene            289903..290799
FT                   /gene="htpX"
FT                   /locus_tag="SPy_0331"
FT                   /old_locus_tag="SPy0331"
FT   CDS_pept        289903..290799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="SPy_0331"
FT                   /old_locus_tag="SPy0331"
FT                   /product="putative heat shock protein"
FT                   /note="Best Blastp hit = sp|O30795|HTPX_STRGC PUTATIVE HEAT
FT                   SHOCK PROTEIN HTPX >gi|11277180|pir||T48855 probable heat
FT                   shock protein HtpX [imported] - Streptococcus gordonii
FT                   >gi|2407215|gb|AAB70525.1| (AF017421) putative heat shock
FT                   protein HtpX [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33387"
FT                   /db_xref="GOA:Q9A1D5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1D5"
FT                   /protein_id="AAK33387.2"
FT                   /translation="MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLLDNYAMGLVL
FT                   ALVIGVIYATSMIFQSTSLVMSMNNAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIE
FT                   DPSLNAFATGSSPQNAAVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALA
FT                   SAVTVISSIGGRMLWYGGGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAIS
FT                   RQREYLADASSVELTRNPQGMIKALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSL
FT                   FSTHPPIEERIERLKNM"
FT   gene            291030..291566
FT                   /locus_tag="SPy_0334"
FT                   /old_locus_tag="SPy0334"
FT   CDS_pept        291030..291566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0334"
FT                   /old_locus_tag="SPy0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAG32547.1| (U12643) YlbN-like
FT                   hypothetical protein [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33388"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1D4"
FT                   /protein_id="AAK33388.2"
FT                   /translation="MMLAISEIRKHPDGLSFDRLCDVKSMLLERDQQIIDIKAVKAVGN
FT                   VRYDKGLYLLDYQLSYEVILPSSRSMVPVCLSEVQHIQELFIEATDLADKKELVEDNLV
FT                   LVLDKDAINLEESIVDNILLAIPLQVLTEEEKKSKELPAGQNWAVLTEEDYQCLKEEKQ
FT                   KENNPFASLQGLFDE"
FT   gene            292525..294027
FT                   /gene="csrR"
FT                   /locus_tag="SPy_0336"
FT   CDS_pept        292525..294027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrR"
FT                   /locus_tag="SPy_0336"
FT                   /product="putative sensory transduction histidine kinase"
FT                   /note="Best Blastp hit = gb|AAC64936.1| (AF082668) CsrS
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33389"
FT                   /db_xref="GOA:Q7DAM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041610"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAM9"
FT                   /protein_id="AAK33389.1"
FT                   /translation="MENQKQKQKKYKNSLPKRLSNIFFVLFFCIFSAFTLIAYSSTNYF
FT                   LLKKEKQSVFQAVNIVRVRLSEVDSNFTLENLAEVLYKNDKTHLRIDDRKGSRVIRSER
FT                   DITNTLDANQDIYVYNIDKQMIFTTDNEESSPGLHGPIGRVYHDHIEDQYRGFSMTQKV
FT                   YSNRTGKFVGYVQVFHDLGNYYVIRARLLFWLLVVELFGTSLAYLIILITTRRFLKPLH
FT                   NLHEVMRNISENPNNLNLRSDISSGDEIEELSVIFDNMLDKLETHTKLQSRFISDVSHE
FT                   LRTPVAIIKGHIGLLQRWGKDDSDILEESLTATAHEADRMAIMINDMLDMIRVQGSFEG
FT                   HQNDMTVLEDSIETVVGNFRVLREDFIFTWQSENPKTIARIYKNHFEQALMILIDNAVK
FT                   YSRKEKKIAINLSVTGKQEAIVRVQDKGEGISKEDIEHIFERFYRTDKSRNRTSTQAGL
FT                   GIGLSILKQIVDGYHLQMKVESELNEGSVFILHIPLAQSKES"
FT   gene            294242..294736
FT                   /locus_tag="SPy_0338"
FT                   /old_locus_tag="SPy0338"
FT   CDS_pept        294242..294736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0338"
FT                   /old_locus_tag="SPy0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06865.1| (AP001517) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33390"
FT                   /db_xref="GOA:P67320"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67320"
FT                   /protein_id="AAK33390.1"
FT                   /translation="MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVE
FT                   ELPLLVIKKDGTREQFSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTYENEVS
FT                   STAIGNLVMDELAELDEITYVRFASVYKSFKDVDEIEELLQQITNRVRGKKKRLNNDET
FT                   N"
FT   gene            294720..295895
FT                   /locus_tag="SPy_0339"
FT                   /old_locus_tag="SPy0339"
FT   CDS_pept        294720..295895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0339"
FT                   /old_locus_tag="SPy0339"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAA22163.1| (AB006752) ORF1
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33391"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1D2"
FT                   /protein_id="AAK33391.1"
FT                   /translation="MMKPIDTFTYLKRNKVTLDSVTLIQLYFPIIGSDAVSIYQYFIHF
FT                   FDDGLQRHKFSDILNHLQFGMKRFEDALAILTAMELVSVYQLSDTYLITLHQPLSRDLF
FT                   FQHPAYSRLLEQKIGEVAVSELQVTVPSQARNISKRFSDIFGVQGDLTNVPQKPQKNFD
FT                   LSSFQQLMVRDGLQFEDNQKDIISLYSIAEQYDMTWFDTYQIAKATAVNGKIRPERLLA
FT                   KKNQSMTKPSKENFSQAEQIILREAKQDSALVFLEKIKKARRATITKDERILLQTLAKM
FT                   NFLDDVINVMVLYTFNKTKSANLQKSYVLKMANDFAYQKVSTAEEAIVVLRAFTDRQSR
FT                   RQSKVKTSQSNVPKWSNPDYQETTSQEEQAKLDQFKQAALKRLENLGKGGD"
FT   gene            295896..296798
FT                   /gene="dnaI"
FT                   /locus_tag="SPy_0340"
FT                   /old_locus_tag="SPy0340"
FT   CDS_pept        295896..296798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="SPy_0340"
FT                   /old_locus_tag="SPy0340"
FT                   /product="putative primosome component (helicase loader)"
FT                   /note="Best Blastp hit = sp|P06567|DNAI_BACSU PRIMOSOMAL
FT                   PROTEIN DNAI >gi|279708|pir||IQBS44 primosome component
FT                   (helicase loader) dnaI - Bacillus subtilis
FT                   >gi|39881|emb|CAA28633.1| (X04963) ORF 311 (AA 1-311)
FT                   [Bacillus subtilis] >gi|1769996|emb|CAA99605.1| (Z75208)
FT                   replication protein [Bacillus subtilis]
FT                   >gi|2293281|gb|AAC00359.1| (AF008220) DnaI [Bacillus
FT                   subtilis] >gi|2635363|emb|CAB14858.1| (Z99118) helicase
FT                   loader [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33392"
FT                   /db_xref="GOA:Q9A1D1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1D1"
FT                   /protein_id="AAK33392.1"
FT                   /translation="MEKIGETMAKLGQNTRVNSDQLIQTILADPEVASFISQHHLSQEQ
FT                   INLSLSKFNQFLVERQKYQLKDPSYIAKGYQPILAMNEGYADVSYLETKELVEAQKQAA
FT                   ISERIQLVSLPKSYRHIHLSDIDVNNASRMEAFSAILDFVEQYPSAEQKGLYLYGDMGI
FT                   GKSYLLAAMAHELSEKKGVSTTLLHFPSFAIDVKNAISNGSVKEEIDAVKNVPVLILDD
FT                   IGAEQATSWVRDEVLQVILQYRMLEELPTFFTSNYSFADLERKWATIKGSDETWQAKRV
FT                   MERVRYLAREFHLEGANRR"
FT   gene            296861..298171
FT                   /gene="pgdA"
FT                   /locus_tag="SPy_0341"
FT                   /old_locus_tag="SPy0341"
FT   CDS_pept        296861..298171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgdA"
FT                   /locus_tag="SPy_0341"
FT                   /old_locus_tag="SPy0341"
FT                   /product="putative phosphoglycerate dehydrogenase"
FT                   /note="Best Blastp hit = dbj|BAA88823.1| (AB016077)
FT                   phosphoglycerate dehydrogenase [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33393"
FT                   /db_xref="GOA:P64064"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64064"
FT                   /protein_id="AAK33393.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYAT
FT                   GEWLNRQFSLIDTGGIDDVDAPFMEQIKHQAQIAMEEADVIVFVVSGKEGVTDADEYVS
FT                   KILYRTNTPVILAVNKVDNPEMRNDIYDFYSLGLGDPYPVSSVHGIGTGDVLDAIVENL
FT                   PVEEAEENDDIIRFSLIGRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTHFTDADG
FT                   QEFTMIDTAGMRKSGKIYENTEKYSVMRAMRAIDRSDVVLMVINAEEGIREYDKRIAGF
FT                   AHEAGKGMIIVVNKWDTIDKDNHTVAKWEADIRDQFQFLTYAPIIFVSALTKQRLNKLP
FT                   DLIKRISESQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVSVKPPTFVVFV
FT                   NEEELMHFSYLRFLENQIRAAFTFEGTPIHLIARKRK"
FT   gene            298378..301476
FT                   /gene="snf"
FT                   /locus_tag="SPy_0342"
FT                   /old_locus_tag="SPy0342"
FT   CDS_pept        298378..301476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snf"
FT                   /locus_tag="SPy_0342"
FT                   /old_locus_tag="SPy0342"
FT                   /product="putative SNF helicase"
FT                   /note="Best Blastp hit = emb|CAA67095.1| (X98455) SNF
FT                   [Bacillus cereus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33394"
FT                   /db_xref="GOA:Q9A1C9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1C9"
FT                   /protein_id="AAK33394.1"
FT                   /translation="MMARLIPGRVRNEGIKLYEQGLVSFQDDNKGILQIEVETYQVQYG
FT                   ADDEDITCQCDTFHMKHYCKHIAAVEYFLKNDQKGKLFLKQLTNQTKIKETTKKMTSFG
FT                   SLFLDSLAMNEDDSVKYRLSALGSRSPFSSDYWWSLKINRLPDDRSYVIRDIKGFLQLI
FT                   KKEGFYQIGKNYFEQLSWLQFDPSSQALIEFLWRLASDTDKGDNENIFPNHARHLRLPS
FT                   GFFEEGIHYLTSLYDFTFEGPSQTYHHLFVRSLEAEAGLYEFKVEVHRKSIELQIAEKN
FT                   VQYLFDNDYLLYQDTFYHLTLKQRKMVQAIRSLPIEADLAKHIHFDLDDHAKLAASLSD
FT                   FKQIGLVEAPKSFAIRDFEVTFQFDLLNRDEISCQLMFDYGNYQVSDKASLEALPFASH
FT                   LKKEEKINRSLLAFGFSPQFYSKKRLTSAKELYTFFEETVPCFERLGNVALSTAIQALQ
FT                   VKEMPKIAIRRNQGLLDISFDFSTIIENDIDQAVTALFQNNPYFVSQTGQLVVFDDETQ
FT                   KVSKSLQELRARQLKNGHLQLDGIRALQVSKLFEGMTSVHFSKELEELAYHLQHPETFS
FT                   IKPLPVKAQMRDYQRNGVQWLSMLNHYGFGGILADDMGLGKTLQTLAFLASHLKSDSKV
FT                   LILSPSSLIYNWFDECQKFTPQLDVVVSYGLKQIRDQIIEEGHQITITSYSSFRQDFET
FT                   YQAFHYDYLILDEAQVIKNAQTKISHCLRAFNTANCFALSGTPIENKMLEIWSIFQIVL
FT                   PGLLPTKKEFLKLTAEQVSRYIKPFVMRRKKEDVLPELPDLIEINYSNEMTDEQKAIYL
FT                   AQLRQMQDQIRNSSDVDISRQKIEILSGITRLRQICDTPSLFMDYQGKSGKLDSLRILL
FT                   TQIKENGHRALIFSQFRGMLDLAKQEMTALGLTSYQMTGSTPANERQEMTRAFNNGSKD
FT                   AFLISLKAGGVGINLTGADTVILIDLWWNPAVEMQAISRAYRIGQKENVEVYRLITRGT
FT                   IEEKILELQESKRNLVTTVLDGNESRASMSIEEIKEILGLNTH"
FT   gene            301719..302321
FT                   /locus_tag="SPy_0343"
FT                   /old_locus_tag="SPy0343"
FT   CDS_pept        301719..302321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0343"
FT                   /old_locus_tag="SPy0343"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||T26413 hypothetical protein
FT                   Y106G6D.3 - Caenorhabditis elegans
FT                   >gi|3880676|emb|CAA20976.1| (AL031629) predicted using
FT                   Genefinder [Caenorhabditis elegans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33395"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1C8"
FT                   /protein_id="AAK33395.1"
FT                   /translation="MVKNQFPLVADGIAISDPAKQMALYENEDLITNIRGYYQDKEYDD
FT                   IARNEEFTAKATSRQTPSSKRFCSNDEKHHYVKEARQKAKQDLKEKRQAYLAKEMAYVP
FT                   KQVSKKQQPADSSPSQKQATTEMSRFTKKLHQDNYILAELPKEYKEPKNLPQQGTTKKN
FT                   NYDFLKSSQIYNNKEMRQQREKTIAQELNLSRFEDLP"
FT   gene            302361..303689
FT                   /gene="murC"
FT                   /locus_tag="SPy_0345"
FT                   /old_locus_tag="SPy0345"
FT   CDS_pept        302361..303689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SPy_0345"
FT                   /old_locus_tag="SPy0345"
FT                   /product="putative UDP-N-acetyl muramate-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Best Blastp hit = sp|P40778|MURC_BACSU
FT                   UDP-N-ACETYLMURAMATE-ALANINE LIGASE
FT                   (UDP-N-ACETYLMURAMOYL-L-ALANINE SYNTHETASE)
FT                   >gi|7437967|pir||C69662 UDP-N-acetylmuramate-alanine ligase
FT                   (EC 6.3.2.8) murC - Bacillus subtilis
FT                   >gi|2293216|gb|AAC00294.1| (AF008220) putative
FT                   UDP-N-acetylmuramate-alanine ligase [Bacillus subtilis]
FT                   >gi|2635463|emb|CAB14957.1| (Z99119) UDP-N-acetyl
FT                   muramate-alanine ligase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33396"
FT                   /db_xref="GOA:Q9A1C7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1C7"
FT                   /protein_id="AAK33396.1"
FT                   /translation="MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGLE
FT                   QAGITILPFSEDNITPDMELIVGNAFRENNKEVAYALRHQIPFKRYHDFLGDFMKSFIS
FT                   FAVAGAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANAQYFVFESDEYERHFMPYH
FT                   PEYSIITNIDFDHPDYFTGIADVRNAFNDYAKQVKKALFVYGEDDELKKIEAPAPIYYY
FT                   GFEEGNDFIAYDITRTTNGSDFKVKHQGEVIGQFHVPAYGKHNILNATAVIANLFVAGI
FT                   DMALVADHLKTFSGVKRRFTEKIINDTIIIDDFAHHPTEIVATIDAARQKYPSKEIVAI
FT                   FQPHTFTRTIALLEDFACALNEADSVYLAQIYGSAREVDKGEVKVEDLAAKIIKPSQVV
FT                   TVENVSPLLDHDNAVYVFMGAGDIQLYEHSFEELLANLTKNNQ"
FT   gene            303735..304217
FT                   /locus_tag="SPy_0346"
FT                   /old_locus_tag="SPy0346"
FT   CDS_pept        303735..304217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0346"
FT                   /old_locus_tag="SPy0346"
FT                   /product="putative arylalkylamine n-acetyltransferase"
FT                   /note="Best Blastp hit = pir||T39187 probable
FT                   arylalkylamine n-acetyltransferase - fission yeast
FT                   (Schizosaccharomyces pombe) >gi|6014421|emb|CAB57420.1|
FT                   (AL121764) putative arylalkylamine n-acetyltransferase
FT                   [Schizosaccharomyces pombe]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33397"
FT                   /db_xref="GOA:Q9A1C6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1C6"
FT                   /protein_id="AAK33397.1"
FT                   /translation="MLIRQVQGSDLEVIATIESDNFSPQEATTRAVLEEHIRLIPDTFL
FT                   VALIDQEIVGYIEGPVVTTPILEDSLFHGVTKNPKTGGYIAITSLSIAKHFQQQGVGTA
FT                   LLAALKDLVVAQQRTGLILTCHDYLISYYEMNGFINQGISESQHGGTLWYQMIWKL"
FT   gene            304329..305903
FT                   /locus_tag="SPy_0348"
FT                   /old_locus_tag="SPy0348"
FT   CDS_pept        304329..305903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0348"
FT                   /old_locus_tag="SPy0348"
FT                   /product="putative aminodeoxychorismate lyase"
FT                   /note="Best Blastp hit = gb|AAF77615.1|AF151720_1
FT                   (AF151720) aminodeoxychorismate lyase-like protein
FT                   [Streptococcus thermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33398"
FT                   /db_xref="GOA:Q9A1C5"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1C5"
FT                   /protein_id="AAK33398.1"
FT                   /translation="MALTDFKDKDQQDQQRSFKEQILAELEKANQIRKEKEEELFQKEL
FT                   EAKEAARRTAQLYAEYKRQDAFQKESIAHNNKTAKHFQAIKGAVMTSEALKPTLLSEKE
FT                   NSSLKTTNKRVVQANELQETASKESQVPLTIEKGHSVRRKLSKRQQTERAAKKISTVLI
FT                   SSIIITLLAVTLAGAGYVYSALNPVDKNSDAFVQVEIPSGSGNKLIGQILQKKGLIKNS
FT                   TVFSFYTKFKNFTNFQSGYYNLQKSMSLEEIASALQEGGTAEPTKPSLGKILIPEGYTI
FT                   KQIAKAVEHNSKGKTKKAKTPFNEKDFLDLVTDEAFIQDMVKRYPKLLATIPTKEKAIY
FT                   RLEGYLFPATYNYYKETTMRELVEDMLAAMDATLVPYYDKIAASGKTVNEVLTLASLVE
FT                   KEGSTDDDRRQIASVFYNRLNSGMALQSNIAILYAMGKLGEKTTLAEDATIDTTINSPY
FT                   NIYTNTGLMPGPVASSGVSAIEATLNPASTDYLYFVANVHTGEVYYAKTFEEHSANVEK
FT                   YVNSQIQ"
FT   gene            305928..306458
FT                   /gene="greA"
FT                   /locus_tag="SPy_0349"
FT                   /old_locus_tag="SPy0349"
FT   CDS_pept        305928..306458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="SPy_0349"
FT                   /old_locus_tag="SPy0349"
FT                   /product="putative transcription elongation factor"
FT                   /note="Best Blastp hit = sp|P80240|GREA_BACSU TRANSCRIPTION
FT                   ELONGATION FACTOR GREA (TRANSCRIPT CLEAVAGE FACTOR GREA)
FT                   (GENERAL STRESS PROTEIN 20M) (GSP20M)
FT                   >gi|7449152|pir||A69637 transcription elongation factor
FT                   greA - Bacillus subtilis >gi|2635178|emb|CAB14674.1|
FT                   (Z99117) transcription elongation factor [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33399"
FT                   /db_xref="GOA:P64285"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64285"
FT                   /protein_id="AAK33399.1"
FT                   /translation="MFVFLIRSKKKREKTIMAEKTYPMTLTEKEQLEKELEELKLVRRP
FT                   EIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETKIRYAEIIDSDAVAKDEVA
FT                   IGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKVRIESPAA
FT                   TYDVEIISVEKTN"
FT   gene            complement(307081..308004)
FT                   /locus_tag="SPy_0351"
FT                   /old_locus_tag="SPy0351"
FT   CDS_pept        complement(307081..308004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0351"
FT                   /old_locus_tag="SPy0351"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB04888.1| (AP001511) stage
FT                   III sporulation protein J [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33400"
FT                   /db_xref="GOA:Q9A1C3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1C3"
FT                   /protein_id="AAK33400.1"
FT                   /translation="MKLTLNRILFSGLALSILLTLTGCVGRDAHGNPKGMIWEFLGKPM
FT                   SYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMAFLKPVFEPIN
FT                   KRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGV
FT                   STSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMS
FT                   FSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKNPPKAYQSTSSRKDVT
FT                   PSQNMEQANLPKKIKSNRNAGKQRKR"
FT   gene            complement(308086..308364)
FT                   /locus_tag="SPy_0352"
FT                   /old_locus_tag="SPy0352"
FT   CDS_pept        complement(308086..308364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0352"
FT                   /old_locus_tag="SPy0352"
FT                   /product="putative acylphosphatase"
FT                   /note="Best Blastp hit = sp|O35031|ACYP_BACSU PUTATIVE
FT                   ACYLPHOSPHATASE (ACYLPHOSPHATE PHOSPHOHYDROLASE)
FT                   >gi|7436053|pir||B69811 conserved hypothetical protein yflL
FT                   - Bacillus subtilis >gi|2443234|dbj|BAA22305.1| (D86417)
FT                   YflL [Bacillus subtilis] >gi|2633088|emb|CAB12593.1|
FT                   (Z99108) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33401"
FT                   /db_xref="GOA:Q9A1C2"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1C2"
FT                   /protein_id="AAK33401.1"
FT                   /translation="MQKVRLIVSGRVQGVGFRYATHTLALDIGDIYGRVWNNNDGTVEI
FT                   LAQSKDSDKIATFIQEVRKGPSKWAKVTYVDVTMANFEDFQDFQIGK"
FT   gene            complement(308522..309650)
FT                   /locus_tag="SPy_0355"
FT                   /old_locus_tag="SPy0355"
FT                   /note="IS1548 transposase; There is a 10bp deletion
FT                   confirmed by sequence analysis that results in a frame
FT                   shift mutation located near the center of this gene."
FT   gene            309939..310676
FT                   /locus_tag="SPy_0356"
FT                   /old_locus_tag="SPy0356"
FT   CDS_pept        309939..310676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0356"
FT                   /old_locus_tag="SPy0356"
FT                   /product="putative rRNA methylase"
FT                   /note="Best Blastp hit = dbj|BAB06831.1| (AP001517) rRNA
FT                   methylase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33402"
FT                   /db_xref="GOA:Q9A1C1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1C1"
FT                   /protein_id="AAK33402.1"
FT                   /translation="MVITSKANQLIKQTKKLLQKKHRKQSYLIEGWHLFEEAQKSGQVF
FT                   RHIFVLEEMVERLAGEQELVIVSPQVLKELTDSPSPQGIVAEVEIPKLAFPSDYKGKYL
FT                   VLEDVQDPGNLGTIIRTADAARFDGVFLSEKSADIYNQKTLRSMQGSHFHLPIWRTDVY
FT                   QLCRELQEYETPILATTLSKKSVDYKSLTHHERLALVLGNEGQGISAEMAALADQLVHI
FT                   TMPGQAESLNVAVAAGILIFSLI"
FT   gene            310715..311215
FT                   /locus_tag="SPy_0357"
FT                   /old_locus_tag="SPy0357"
FT   CDS_pept        310715..311215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0357"
FT                   /old_locus_tag="SPy0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06585.1| (AP001516) unknown
FT                   conserved protein in B. subtilis [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33403"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1C0"
FT                   /protein_id="AAK33403.1"
FT                   /translation="MHYTEDKEYMEHVGHLIAHPRFQKLSHIVQHQHSTRLEHSINVSY
FT                   SSYKLAKRFGWDAKSTARGGLLHDFFYYDWRVTKFNKGHAWVHPRIAVRNAKKLTELNK
FT                   KEEDIILKHMWGATIAFPRYKESYIVTMVDKYWAVKEAVTPLRQKWSNRRFLRRKTLQS
FT                   HNR"
FT   gene            311230..311919
FT                   /locus_tag="SPy_0358"
FT                   /old_locus_tag="SPy0358"
FT   CDS_pept        311230..311919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0358"
FT                   /old_locus_tag="SPy0358"
FT                   /product="conserved hypothetical protein (putative membrane
FT                   spanning protein)"
FT                   /note="Best Blastp hit = gb|AAC18360.1| (AF064763) putative
FT                   membrane spanning protein [Lactococcus lactis subsp.
FT                   cremoris]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33404"
FT                   /db_xref="GOA:Q9A1B9"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1B9"
FT                   /protein_id="AAK33404.1"
FT                   /translation="MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRE
FT                   NLISILVNQPMIYYGAAIIELILVFVASSAARKNTPAALPIFLIYSALNGFTLSFIIVA
FT                   YAQTTVFQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGM
FT                   MSYVISVISVLIFSGLIASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLL
FT                   RIFGRND"
FT   gene            312097..312339
FT                   /locus_tag="SPy_0359"
FT                   /old_locus_tag="SPy0359"
FT   CDS_pept        312097..312339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0359"
FT                   /old_locus_tag="SPy0359"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF30674.1|AE002123_7
FT                   (AE002123) conserved hypothetical [Ureaplasma urealyticum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33405"
FT                   /db_xref="GOA:P67295"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67295"
FT                   /protein_id="AAK33405.1"
FT                   /translation="MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIR
FT                   EMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK"
FT   gene            312517..313311
FT                   /gene="glr"
FT                   /locus_tag="SPy_0361"
FT                   /old_locus_tag="SPy0361"
FT   CDS_pept        312517..313311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr"
FT                   /locus_tag="SPy_0361"
FT                   /old_locus_tag="SPy0361"
FT                   /product="putative glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="Best Blastp hit = gb|AAF72713.1|AF263927_1
FT                   (AF263927) glutamate racemase [Carnobacterium sp. St2]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33406"
FT                   /db_xref="GOA:Q9A1B7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="PDB:2OHG"
FT                   /db_xref="PDB:2OHO"
FT                   /db_xref="PDB:2OHV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1B7"
FT                   /protein_id="AAK33406.1"
FT                   /translation="MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPR
FT                   PKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAI
FT                   KSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSIQVRSLACPKFVPIVESNEMCSSIAKK
FT                   IVYDSLAPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFD
FT                   INGNYHQKAVEHRFFTTANPEIFQEIASIWLKQKINVEHVTL"
FT   gene            313308..314294
FT                   /locus_tag="SPy_0362"
FT                   /old_locus_tag="SPy0362"
FT   CDS_pept        313308..314294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0362"
FT                   /old_locus_tag="SPy0362"
FT                   /product="hypothetical protein"
FT                   /note="Another possible fusion protein; Best Blastp hit =
FT                   pir||C69986 conserved hypothetical protein ysnA - Bacillus
FT                   subtilis >gi|1770060|emb|CAA99555.1| (Z75208) hypothetical
FT                   protein [Bacillus subtilis] >gi|2635301|emb|CAB14796.1|
FT                   (Z99118) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33407"
FT                   /db_xref="GOA:Q9A1B6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1B6"
FT                   /protein_id="AAK33407.1"
FT                   /translation="MSEKIYEYKDENNWFIGKMTGHNLISGWGVKHTTIKKIDDLLDGI
FT                   AATLDWENPKGYDVSVVRHQSPLSLITFIIDMINQETQREIKVTPHAGTILLMENAKLL
FT                   AVYLPEGGVSTATFFATSEQGFGDIILIATRNEGKTKEFRNLFGQLGYRVENLNDYPEL
FT                   PEVAETGTTFEENARLKAETISRLTGKMVLADDSGLKVDALGGLPGVWSARFSGPDATD
FT                   AKNNAKLLHELAMVFDQKKRSAQFHTTLVVAAPNKDSLVVEADWPGYIATQPKGENGFG
FT                   YDPVFIVGETGHHAAELEADQKNQLSHRGQAVRKLMEVFPAWQAKQS"
FT   gene            314273..314794
FT                   /locus_tag="SPy_0363"
FT                   /old_locus_tag="SPy0363"
FT   CDS_pept        314273..314794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0363"
FT                   /old_locus_tag="SPy0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06785.1| (AP001517) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33408"
FT                   /db_xref="GOA:Q9A1B5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1B5"
FT                   /protein_id="AAK33408.1"
FT                   /translation="MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSD
FT                   PIWAGIYVVGGNCDYDTGYPDRLVTQLGTVTIAQTHGHLYHINFTWDKLDYFAQEVVAD
FT                   ICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKL
FT                   YPSLSKEFKR"
FT   gene            314791..315252
FT                   /locus_tag="SPy_0364"
FT                   /old_locus_tag="SPy0364"
FT   CDS_pept        314791..315252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0364"
FT                   /old_locus_tag="SPy0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB05201.1| (AP001512) unknown
FT                   conserved protein in B. subtilis [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33409"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1B4"
FT                   /protein_id="AAK33409.1"
FT                   /translation="MIAKEFETFLMSHLDNYLIPEQDLAIFIDTHNADHVMLLLVSNGF
FT                   SRVPVITREKKYVGTISISDIMMYQSKRQLTDWEMSQTDIGEMVNTKIETISITSSLTE
FT                   IMHKLIDFPFLPVVDRANRFVGIITRKSILKAVNSLLHDFTDDYTIIKK"
FT   gene            315249..315995
FT                   /locus_tag="SPy_0365"
FT                   /old_locus_tag="SPy0365"
FT   CDS_pept        315249..315995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0365"
FT                   /old_locus_tag="SPy0365"
FT                   /product="hypothetical protein (possible
FT                   integrase/recombinase)"
FT                   /note="Best Blastp hit = gi|10956351 pXO1-103 [Bacillus
FT                   anthracis] >gi|7474211|pir||G59103 hypothetical protein
FT                   pXO1-103 - Bacillus anthracis virulence plasmid pXO1
FT                   >gi|4894320|gb|AAD32408.1|AAD32408 (AF065404) pXO1-103
FT                   [Bacillus anthracis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33410"
FT                   /db_xref="GOA:Q9A1B3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1B3"
FT                   /protein_id="AAK33410.1"
FT                   /translation="MKSYIEPFIASKALSQNSQKAYRYDLQQFCQLIGERVNQDKLLLY
FT                   QNSIANLSLSAKKRKLSTANQFLYYLYQIKYLNSYFRLTDTMKVMRTEKQQAAIINTDI
FT                   FYQKTPFVWGQLISLLILELGLTPSEVAGIEVANLDLNFQMLTLKTKKGVRVLPLSQIL
FT                   IPFLEQQLVGKEVYLFEHRGIPFSRQWFFNHLKTFVRSIGYEGLTAQKLREQFILKEKL
FT                   AGKSIIELSDILGLKSPMTLEKYYKS"
FT   gene            315995..316696
FT                   /locus_tag="SPy_0366"
FT                   /old_locus_tag="SPy0366"
FT   CDS_pept        315995..316696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0366"
FT                   /old_locus_tag="SPy0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P35154|YPUG_BACSU HYPOTHETICAL
FT                   29.6 KD PROTEIN IN RIBT-DACB INTERGENIC REGION (ORFX7)
FT                   >gi|629132|pir||S45549 conserved hypothetical protein ypuG
FT                   - Bacillus subtilis >gi|410131|gb|AAA67487.1| (L09228)
FT                   ORFX7 [Bacillus subtilis] >gi|2634757|emb|CAB14254.1|
FT                   (Z99116) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33411"
FT                   /db_xref="GOA:Q9A1B2"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A1B2"
FT                   /protein_id="AAK33411.1"
FT                   /translation="MDIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETL
FT                   QVMKLEVAGDYMLMASQLMLIKSRRLLPKVVEHIEEDLEQDLLEKIEEYSRFKAVSQAL
FT                   AKQHDQRAKWYSKPKQELIFEDAILQEDKTVMDLFLAFSNIMAAKRAVLKNNHTVIERD
FT                   DYKIEDMMASIKQRLEKENVIRLSAIFEECQTLNEVISIFLASLELIKLHVVFVEQLSN
FT                   FGAIILRKEKK"
FT   gene            316693..317244
FT                   /locus_tag="SPy_0367"
FT                   /old_locus_tag="SPy0367"
FT   CDS_pept        316693..317244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0367"
FT                   /old_locus_tag="SPy0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P35155|YPUH_BACSU HYPOTHETICAL
FT                   22.0 KD PROTEIN IN RIBT-DACB INTERGENIC REGION (ORFX8)
FT                   >gi|629133|pir||S45550 conserved hypothetical protein ypuH
FT                   - Bacillus subtilis >gi|410132|gb|AAA67488.1| (L09228)
FT                   ORFX8 [Bacillus subtilis] >gi|2634756|emb|CAB14253.1|
FT                   (Z99116) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33412"
FT                   /db_xref="GOA:P60220"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60220"
FT                   /protein_id="AAK33412.1"
FT                   /translation="MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQK
FT                   YEKDQHSSLCLIETANTYRLVTKEGFAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPI
FT                   TRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVGRPHLYATTDYFLDYMGINHLDEL
FT                   IEVSAVEPADEEIALFRTQD"
FT   gene            317367..318089
FT                   /locus_tag="SPy_0369"
FT                   /old_locus_tag="SPy0369"
FT   CDS_pept        317367..318089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0369"
FT                   /old_locus_tag="SPy0369"
FT                   /product="putative hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB05295.1| (AP001512)
FT                   pseudouridylate synthase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33413"
FT                   /db_xref="GOA:Q9A1B0"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1B0"
FT                   /protein_id="AAK33413.1"
FT                   /translation="MRINKYIAHAGIASRRKAEELIKQGLVTLNGQVITDLATTVKSGD
FT                   VVEIEGSPIYNEEKVYYLLNKPRGAISSVSDDKGRKTVLDLLPQVKERIYPVGRLDWDT
FT                   SGVLILTNDGDFTDTMIHPRNEIDKVYLARVKGIATKENLRPLTRGIVIDGKKTKPARY
FT                   NIVRVEADKSRSIVELTIHEGRNHQVKKMFESVGLLVDKLSRTRFGTVDLKGLRPGEAR
FT                   RLNKKEISQLHNLANTKK"
FT   gene            318089..318349
FT                   /locus_tag="SPy_0370"
FT                   /old_locus_tag="SPy0370"
FT   CDS_pept        318089..318349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0370"
FT                   /old_locus_tag="SPy0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||G72251 conserved hypothetical
FT                   protein - Thermotoga maritima (strain MSB8)
FT                   >gi|4982027|gb|AAD36530.1|AE001797_10 (AE001797) conserved
FT                   hypothetical protein [Thermotoga maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33414"
FT                   /db_xref="GOA:P67307"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67307"
FT                   /protein_id="AAK33414.1"
FT                   /translation="MKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGTKG
FT                   ILMGIARILRCHPFVAGGVDPVPEDFSLMRNKNTSKNAEKA"
FT   gene            318527..319075
FT                   /locus_tag="SPy_0371"
FT                   /old_locus_tag="SPy0371"
FT   CDS_pept        318527..319075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0371"
FT                   /old_locus_tag="SPy0371"
FT                   /product="putative rRNA methylase"
FT                   /note="Best Blastp hit = dbj|BAB04742.1| (AP001510) rRNA
FT                   methylase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33415"
FT                   /db_xref="GOA:Q9A1A9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A9"
FT                   /protein_id="AAK33415.1"
FT                   /translation="MTTKELINKNDKVKKARNHIVLFQPQIPQNTGNIARTCAATNAPL
FT                   HIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQCHGQLHLISKFAVNNYSQA
FT                   TYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVSNTVCMVIYEALR
FT                   QQGFQGLELKHTYEHDKLK"
FT   gene            319386..319949
FT                   /locus_tag="SPy_0373"
FT                   /old_locus_tag="SPy0373"
FT   CDS_pept        319386..319949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0373"
FT                   /old_locus_tag="SPy0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P50726|YPAA_BACSU HYPOTHETICAL
FT                   20.5 KD PROTEIN IN SERA-FER INTERGENIC REGION
FT                   >gi|7475251|pir||E69932 hypothetical protein ypaA -
FT                   Bacillus subtilis >gi|1146197|gb|AAC83944.1| (L47648)
FT                   putative [Bacillus subtilis] >gi|2634740|emb|CAB14237.1|
FT                   (Z99116) ypaA [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33416"
FT                   /db_xref="GOA:Q9A1A8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A8"
FT                   /protein_id="AAK33416.1"
FT                   /translation="MSKTHKMIMIGILSAISFLLMLVSFAIIPGAAFLKIEFSIIPVLF
FT                   GLMIMDLKSAYLILLLRSLLKLFLNNRGVNDFIGLPMNIIAIALFVTAFALVWNRQKTL
FT                   SQYVFASLLGTGLLTFGMVVLNYTFAIPLYAIFANIDIRAYIGVTKYMMTMVIPFNLVE
FT                   GLIFAITFYFVYIASKPILERYLH"
FT   gene            319951..320604
FT                   /locus_tag="SPy_0374"
FT                   /old_locus_tag="SPy0374"
FT   CDS_pept        319951..320604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0374"
FT                   /old_locus_tag="SPy0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC45388.1| (U81488) putative
FT                   phosphatidic acid phosphatase [Lactococcus lactis subsp.
FT                   cremoris]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33417"
FT                   /db_xref="GOA:Q9A1A7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A7"
FT                   /protein_id="AAK33417.1"
FT                   /translation="MMTNKQTHFLIASFALLIFVIIGYTVKFFPERLALLDNTIQAEIR
FT                   GNLPIVLTQFFRGVTVFGNVMTQVLLVIVSVLVLFFMKWKIEALFILSNGAIAAFLITT
FT                   LKLFYQRPRPAIEHLVYAGGYSFPSGHAMGSMLIFGSLLIICYQRLHSKLLQFVTSMIF
FT                   IILILLIGLSRIYLGVHYPSDILAGFVLGFGILHFIYPFYKQKRFEWRFLLKQD"
FT   gene            320897..321817
FT                   /locus_tag="SPy_0376"
FT                   /old_locus_tag="SPy0376"
FT   CDS_pept        320897..321817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0376"
FT                   /old_locus_tag="SPy0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||D69999 conserved hypothetical
FT                   protein ytqA - Bacillus subtilis >gi|2293302|gb|AAC00380.1|
FT                   (AF008220) YtqA [Bacillus subtilis]
FT                   >gi|2635532|emb|CAB15026.1| (Z99119) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33418"
FT                   /db_xref="GOA:Q9A1A6"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A6"
FT                   /protein_id="AAK33418.1"
FT                   /translation="MKKRYQTLNEHYRQLFGAKMFKVPIDAGFDCPNRDGTVAHGGCTF
FT                   CTVSGSGDAIVAPDAPIKEQFYKEIDFMHRKWPDVNRYLVYFQNFTNTHDTVDVIRDRY
FT                   EQAINEPGVVGINIGTRPDCLPDDTIAYLAELSERMHVTVELGLQTTYEETSRLINRAH
FT                   SYDLYKETVRRLRHYPNINIVSHLINGLPKETHDMMLENVRRCVTDNDIQGIKLHLLHL
FT                   MTNTRMQRDYHEGRLKLLSQKDYVSIICDQLEIIPKHIVIHRITGDAPRDMLIGPMWSL
FT                   NKWEVLNAIDKEMERRGSFQGCKVD"
FT   gene            321856..322410
FT                   /locus_tag="SPy_0377"
FT                   /old_locus_tag="SPy0377"
FT   CDS_pept        321856..322410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0377"
FT                   /old_locus_tag="SPy0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB07004.1| (AP001518) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33419"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A5"
FT                   /protein_id="AAK33419.1"
FT                   /translation="MLKRPIHLSHDFLAEVVDKSSVVVDATMGNGNDTAFLAQLAKKVY
FT                   AFDVQEQAIRKTSERLAQLGLSNAELILAGHEAVDQYVTEPVRAAIFNLGYLPSADKSI
FT                   ITLPNTTLQALSKLLTLLMVGGRIAIMVYYGHDGGSLEKDALLDFVKQLDQRKVSAMLY
FT                   QPLNQVNTPPFLIMLEKLADF"
FT   gene            322543..323877
FT                   /gene="hlyX"
FT                   /locus_tag="SPy_0378"
FT                   /old_locus_tag="SPy0378"
FT   CDS_pept        322543..323877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyX"
FT                   /locus_tag="SPy_0378"
FT                   /old_locus_tag="SPy0378"
FT                   /product="putative hemolysin"
FT                   /note="Best Blastp hit = gb|AAC05772.1| (AF051356) putative
FT                   hemolysin [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33420"
FT                   /db_xref="GOA:Q9A1A4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A4"
FT                   /protein_id="AAK33420.1"
FT                   /translation="MEDPVSQSLVIQFLLLVVLTLLNAFFSASEMALVSLNRSRVEQKA
FT                   ADGDKKYARLLRVLEEPNHFLSTIQVGITFISLLSGASLSASLGKVISGWLGNSATART
FT                   AGTIISLVFLTYVSIVLGELYPKRIAMNLKDKLAIVSAPIIIGLGRLVSPFVWLLSAST
FT                   NLLSRLTPMTFDDADEQMTRDEIEYMLSKSEATLDAEEIEMLQGVFSLDEMMAREVMVP
FT                   RTDAFMIDINDDPLENIQEILKQSFSRIPVYDVDKDKIIGLIHTKRLLESGFRQGFDQI
FT                   NMRKMLQEPLFVPETIFVDDLLRQLRNTQNQMAILLDEYGGVAGLVTLEDLLEEIVGEI
FT                   DDETDKAEQFVHEIGDNTYIVVGTMTLNEFNDYFDTELESDDVDTIAGFYLTGIGTIPS
FT                   QEQKEAYEIDNKDKHLVLINDKVKDGRITKLKLILSNIEQIIEED"
FT   gene            323955..324746
FT                   /gene="pflC"
FT                   /locus_tag="SPy_0379"
FT                   /old_locus_tag="SPy0379"
FT   CDS_pept        323955..324746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflC"
FT                   /locus_tag="SPy_0379"
FT                   /old_locus_tag="SPy0379"
FT                   /product="putative pyruvate-formate lyase activating
FT                   enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="Best Blastp hit = sp|O68575|PFLA_STRMU PYRUVATE
FT                   FORMATE-LYASE ACTIVATING ENZYME (PFL-ACTIVATING ENZYME)
FT                   >gi|2952528|gb|AAC05773.1| (AF051356) pyruvate-formate
FT                   lyase activating enzyme [Streptococcus mutans]
FT                   >gi|3986294|dbj|BAA34998.1| (AB018417) PFL-activating
FT                   enzyme [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33421"
FT                   /db_xref="GOA:Q9A1A3"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A3"
FT                   /protein_id="AAK33421.1"
FT                   /translation="MTEKDYGQVTGMVHSTESFGSVDGPGIRFIIFLQGCKLRCQYCHN
FT                   PDTWEMETNNSKIRTVNDVLKEALQYKHFWGKKGGITVSGGEAMLQIDFITALFIEAKK
FT                   LGIHTTLDTCGFTYRPTPEYHQVLDNLLAVTDLILLDLKEIDEKQHKIVTRQPNKNILQ
FT                   FARYLSDKQIPVWIRHVLVPGLTDIDDHLTRLGEFVKTLKNVDKFEVLPYHTMGEFKWR
FT                   ELGIPYQLEGVKPPTKERVQNAKNLMQTESYTEYMNRIHQS"
FT   gene            324877..325812
FT                   /locus_tag="SPy_0380"
FT                   /old_locus_tag="SPy0380"
FT   CDS_pept        324877..325812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0380"
FT                   /old_locus_tag="SPy0380"
FT                   /product="putative manganese-dependent inorganic
FT                   pyrophosphatase (intrageneric coaggregation-relevant
FT                   adhesin)"
FT                   /note="The N-terminal amino acid sequence of this ORF has
FT                   been determined from a spot isolated by 2-D gel
FT                   electrophoresis from another strain of S. pyogenes. Hogan,
FT                   D. A., Whitton, M. M., Rogers, J. and R. A. VanBogelen.
FT                   2000. Two-dimensional gel electrophoresis map of
FT                   Streptococcus pyogenes proteins. Unpublished data.; Best
FT                   Blastp hit = sp|P95765|PPAC_STRGC PROBABLE
FT                   MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
FT                   (PYROPHOSPHATE PHOSPHO-HYDROLASE) (PPASE)
FT                   >gi|1743856|gb|AAB39104.1| (U57759) intrageneric
FT                   coaggregation-relevant adhesin [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33422"
FT                   /db_xref="GOA:P65757"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65757"
FT                   /protein_id="AAK33422.1"
FT                   /translation="MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNE
FT                   ETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVAN
FT                   FETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVS
FT                   DHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVN
FT                   TVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFN
FT                   FTLDNNHAFLAGAVSRKKQVVPQLTESFGA"
FT   gene            325888..326541
FT                   /locus_tag="SPy_0382"
FT                   /old_locus_tag="SPy0382"
FT   CDS_pept        325888..326541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0382"
FT                   /old_locus_tag="SPy0382"
FT                   /product="conserved streptococcal hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC05779.1| (AF051356) unknown
FT                   [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33423"
FT                   /db_xref="InterPro:IPR014924"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A1"
FT                   /protein_id="AAK33423.1"
FT                   /translation="MITVFHSDKLTRQPFFQDLINYLDQHDHVILREIKKAFPNVTGID
FT                   KAIESYVQAGYIRRENKRYGINLPLVSSDQQLALDTMLFVDTCSAMYENILAVVFETQL
FT                   TNQTNRVMIKEKTNITRDDLTLANYFYRLKRGEKPSAEQMDLYDLLGDVNQEYALKYMT
FT                   TFLLKFTRKDFVMQKRPDIFVEALVTLGYLKQVEPTTYQLLMTLDKESLTFIAP"
FT   gene            complement(326586..327623)
FT                   /gene="fhuG"
FT                   /locus_tag="SPy_0383"
FT                   /old_locus_tag="SPy0383"
FT   CDS_pept        complement(326586..327623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="SPy_0383"
FT                   /old_locus_tag="SPy0383"
FT                   /product="putative ferrichrome ABC transporter (permease)"
FT                   /note="Best Blastp hit = dbj|BAB04801.1| (AP001510)
FT                   ferrichrome ABC transporter (permease) [Bacillus
FT                   halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33424"
FT                   /db_xref="GOA:Q9A1A0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A1A0"
FT                   /protein_id="AAK33424.2"
FT                   /translation="MLFMVNKKRRPLLKSQRHLLRLYTSLILLLVSLMGLALSLGESHL
FT                   SFLDLVHVFLGKSSHAISFIVINIRLPRILAACLGGGSLALSGLLLQRLTRNPLADSGV
FT                   LGITIGAGISLAIVVSFSFFEQAHISHYLPLFAMLGAIVTTFSVYWLSLTKQGQIDPTR
FT                   LILTGVAVTTMLSSLMVALVGHINRYKVDLVINWLSGQLIGDDWPTLSVIAPLLLCFWL
FT                   LTYSQAHFLNIMGLADNTAIGLGLPLNRKRRLILVLAAGLGALSVLLVGNISFIGLIAG
FT                   HFSTYLVGSNHKITIPISILIGMILLLVADTVGRVYLVGSNIQTGILVSLIGAPYFLYL
FT                   MAKTK"
FT   gene            complement(327584..328615)
FT                   /gene="fhuB.1"
FT                   /locus_tag="SPy_0384"
FT                   /old_locus_tag="SPy0384"
FT   CDS_pept        complement(327584..328615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB.1"
FT                   /locus_tag="SPy_0384"
FT                   /old_locus_tag="SPy0384"
FT                   /product="putative ferrichrome ABC transporter (permease)"
FT                   /note="Best Blastp hit = gb|AAD33526.3|AF132117_3
FT                   (AF132117) ferrichrome transport permease [Staphylococcus
FT                   aureus] >gi|9755014|gb|AAF98154.1|AF251216_2 (AF251216)
FT                   FhuB [Staphylococcus aureus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33425"
FT                   /db_xref="GOA:Q9A199"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A199"
FT                   /protein_id="AAK33425.2"
FT                   /translation="MCLERFCLKKTQIITKSHIFWLVFVLLSFSLCVAIYCHLRFGAVA
FT                   LSHQDLNSILFGKQNGHKANVLLAIRLPRLFGATLTGSALAVSGTIMQAITRNPIAEPG
FT                   LLGINAGAGLALVLAYAFVPHLHYSLIILLSLLGSSLAATLVFGLSYQSGKGYHQLRLV
FT                   LAGAMVSILLSALGQGITNYYHLANAVIGWQAGGLVGVNWQMIGYIAPLIILSLCLAQL
FT                   LSYHLTVLSLSESQAKALGQKTNLISAVFMILVLILSSAAVAIAGSISFIGLVIPHLMK
FT                   HFTPHHYRYLLPLCAVSGASFMVWVDIACRNLNPPYETPLGALVSLIGFPCFLWLIRRG
FT                   GRY"
FT   gene            complement(328626..329558)
FT                   /gene="fhuD"
FT                   /locus_tag="SPy_0385"
FT                   /old_locus_tag="SPy0385"
FT   CDS_pept        complement(328626..329558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="SPy_0385"
FT                   /old_locus_tag="SPy0385"
FT                   /product="ferrichrome ABC transporter (ferrichrome-binding
FT                   protein)"
FT                   /note="Best Blastp hit = sp|P37580|FHUD_BACSU
FT                   FERRICHROME-BINDING PROTEIN PRECURSOR
FT                   >gi|421493|pir||S32930 ferrichrome ABC transporter fhuD
FT                   precursor - Bacillus subtilis >gi|289272|gb|AAA22424.1|
FT                   (M87283) ferrichrome-binding protein [Bacillus subtilis]
FT                   >gi|1070012|emb|CAA63642.1| (X93092) protein-dependent
FT                   [Bacillus subtilis] >gi|2635846|emb|CAB15338.1| (Z99121)
FT                   ferrichrome ABC transporter (ferrichrome-binding protein)
FT                   [Bacillus subtilis] >gi|2832795|emb|CAA11719.1| (AJ223978)
FT                   ferrichrome binding protein, FhuD [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33426"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A198"
FT                   /protein_id="AAK33426.1"
FT                   /translation="MKKLTLLLTLCLTTITLIACGNQATNHSNTASKSLSPMPQIAGVT
FT                   YYGDIPKQPKRVVSLASTYTGYLKKLDMNLVGVTSYDKKNPILAKTVKKAKQVAATDLE
FT                   AVTTLKPDLIVVGSTEENIKQLAEIAPVISIEYRKRDYLQVLSDFGRIFNKEDKAKKWL
FT                   KDWKTKTAAYEKEVKAVTGDKATFTIMGLYEKDVYLFGKDWGRGGEIIHQAFHYDAPEK
FT                   VKTEVFKQGYLSLSQEVLPDYIGDYVVVAAEDDKTGSALYESKLWQSIPAVKKHHVIKV
FT                   NANVFYFTDPLSLEYQLETLREAILSSEN"
FT   gene            complement(329584..330366)
FT                   /gene="fhuA"
FT                   /locus_tag="SPy_0386"
FT                   /old_locus_tag="SPy0386"
FT   CDS_pept        complement(329584..330366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="SPy_0386"
FT                   /old_locus_tag="SPy0386"
FT                   /product="putative ferrichrome ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="Best Blastp hit = gb|AAD33527.2|AF132117_4
FT                   (AF132117) FhuA [Staphylococcus aureus]
FT                   >gi|9755013|gb|AAF98153.1|AF251216_1 (AF251216) FhuC
FT                   [Staphylococcus aureus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33427"
FT                   /db_xref="GOA:Q9A197"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A197"
FT                   /protein_id="AAK33427.1"
FT                   /translation="MTTISAEDLTIAYEQRTIIDKLSFYIPEGKITTIIGANGCGKSSL
FT                   LKALTRLLPPKQGVVYLNGQNIATLETKEVAKKLALLPQVQEATNGITVYELVSYGRFP
FT                   HQSYFGNLSPADKKAIHWAMQATNVMAYADQPVDALSGGQRQRVWLAMALAQGTDTIFL
FT                   DEPTTYLDLNHQLEILELVKSLNKDAGKTIVMVLHDLNLSARYSDHLIAMKHGKIHYTG
FT                   TIADVMTSPIIQDIFQIKPVLVDDPIHNCPIVLTYQLQ"
FT   gene            complement(330612..332057)
FT                   /gene="murE"
FT                   /locus_tag="SPy_0388"
FT                   /old_locus_tag="SPy0388"
FT   CDS_pept        complement(330612..332057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SPy_0388"
FT                   /old_locus_tag="SPy0388"
FT                   /product="putative
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="Best Blastp hit = sp|O67631|MURE_AQUAE
FT                   UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE-2,6-DIAMINOPIMELATE
FT                   LIGASE (UDP-N-ACETYLMURAMYL-TRIPEPTIDE SYNTHETASE)
FT                   (MESO-DIAMINOPIMELATE-ADDING ENZYME) (UDP-MURNAC-TRIPEPTIDE
FT                   SYNTHETASE) >gi|7451747|pir||E70450 UDP-MurNac-tripeptide
FT                   synthetase - Aquifex aeolicus >gi|2984050|gb|AAC07591.1|
FT                   (AE000754) UDP-MurNac-tripeptide synthetase [Aquifex
FT                   aeolicus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33428"
FT                   /db_xref="GOA:Q9A196"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A196"
FT                   /protein_id="AAK33428.1"
FT                   /translation="MITIEQLLDILKKDHNFREVLDADGYHYHYQGFSFERLSYDSRQV
FT                   DGKTLFFAKGATFKADYLKEAITNGLQLYISEVDYELGIPVVLVTDIKKAMSLIAMAFY
FT                   GNPQEKLKLLAFTGTKGKTTAAYFAYHMLKESYKPAMFSTMNTTLDGKTFFKSQLTTPE
FT                   SLDLFAMMAECVTNGMTHLIMEVSSQAYLVDRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMENSRAVVINSGMDHFSFLADQVADQEHVFYGPLSDNQITTSQAFSFEA
FT                   KGQLAGHYDIQLIGHFNQENAMAAGLACLRLGASLADIQKGIAKTRVPGRMEVLTMTNH
FT                   AKVFVDYAHNGDSLEKLLSVVEEHQTGKLMLILGAPGNKGESRRADFGRVIHQHPNLTV
FT                   ILTADDPNFEDPEDISKEIASHIARPVEIISDREQAIQKAMSLCQGAKDAVIIAGKGAD
FT                   AYQIVKGQQVAYAGDLAIAKHYL"
FT   gene            332145..333779
FT                   /locus_tag="SPy_0390"
FT                   /old_locus_tag="SPy0390"
FT   CDS_pept        332145..333779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0390"
FT                   /old_locus_tag="SPy0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||G69992 spore cortex protein
FT                   homolog ytgP - Bacillus subtilis >gi|2293198|gb|AAC00276.1|
FT                   (AF008220) YtgP [Bacillus subtilis]
FT                   >gi|2635489|emb|CAB14983.1| (Z99119) similar to spore
FT                   cortex protein [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33429"
FT                   /db_xref="GOA:Q9A195"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A195"
FT                   /protein_id="AAK33429.1"
FT                   /translation="MSTEKKQLTQEELMVQGAAWSTAGNFISRLLGVLYIIPWYIWMGQ
FT                   YAIQANALFNMGYNVYAYFLLISTTGLNVAIAKQVAKYNSMGQTEHSYQLIRSTLKLML
FT                   GLGLIFSAIMYLGSPLFASLSGGDDTLVPIMHSLSLAVFIFPVMSVIRGIFQGHNNIKP
FT                   YAVSQIAEQLIRVIWMLLTTFFIMKLGSGDYASAVTQSTFAAFIGMVASMGVLGYYLWK
FT                   QGLLAAIFSKPDHTVSIDIKGLLLETLKESIPFIVTGSAIQAFQLIDQWTFVNTMTLFT
FT                   DYSRSQLLVLFGYFNANPAKITMVLIAVAASIGGVGIALLTENYVKKDMKAAARLIINN
FT                   IEMLVMFLLPALTGAIILARPLYSVFYGASEERAIHLFVAVLFQTLLLALYTLFSPMLQ
FT                   ALFENRKAIYYFAYGILIKLVLQIPLIYLLHAYGPLLATTIALVVPIYLMYRRLYQVTH
FT                   FNRKLLQKRLLLTLIETLLMGLVVFVANWLLGYAFKPTGRLTSLLYLLIIGGLGMTVYT
FT                   ALTLLTHQLDKLIGSKASRLRQKLGWH"
FT   gene            333947..334576
FT                   /gene="upp"
FT                   /locus_tag="SPy_0392"
FT                   /old_locus_tag="SPy0392"
FT   CDS_pept        333947..334576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="SPy_0392"
FT                   /old_locus_tag="SPy0392"
FT                   /product="putative uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="Best Blastp hit = sp|P36399|UPP_STRSL URACIL
FT                   PHOSPHORIBOSYLTRANSFERASE (UMP PYROPHOSPHORYLASE) (UPRTASE)
FT                   >gi|347998|gb|AAA26890.1| (L07793) uracil
FT                   phosphoribosyltransferase [Streptococcus salivarius]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33430"
FT                   /db_xref="GOA:P67400"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67400"
FT                   /protein_id="AAK33430.1"
FT                   /translation="MGKCQVISHPLIQHKLSILRRQTTSTKDFRELVNEIAMLMGYEVS
FT                   RDLPLEDVDIQTPVSKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKVGHIGMYR
FT                   NEETLEPVEYLVKLPEDINQRQIFLVDPMLATGGSAILAVDSLKKRGAANIKFVCLVAA
FT                   PEGVKKLQEAHPDIDIFTAALDDHLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            334545..334679
FT                   /locus_tag="SPy_0393"
FT                   /old_locus_tag="SPy0393"
FT   CDS_pept        334545..334679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0393"
FT                   /old_locus_tag="SPy0393"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33431"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A193"
FT                   /protein_id="AAK33431.1"
FT                   /translation="MLVIVYLGQNKRDNHQIVAFLGQSFLILFKKSERFLFFKGKASL"
FT   gene            334800..335390
FT                   /gene="clpP"
FT                   /locus_tag="SPy_0395"
FT                   /old_locus_tag="SPy0395"
FT   CDS_pept        334800..335390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SPy_0395"
FT                   /old_locus_tag="SPy0395"
FT                   /product="putative ATP-dependent protease proteolytic
FT                   subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="Best Blastp hit = sp|P36398|CLPP_STRSL ATP-DEPENDENT
FT                   CLP PROTEASE PROTEOLYTIC SUBUNIT (ENDOPEPTIDASE CLP)
FT                   >gi|347999|gb|AAA26891.1| (L07793) ATP-dependent protease
FT                   proteolytic subunit [Streptococcus salivarius]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33432"
FT                   /db_xref="GOA:P69884"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69884"
FT                   /protein_id="AAK33432.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GTKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRHRLEKILAQNAGKTIK
FT                   QIHKDAERDYWMSAEETLAYGFIDEIMENNELK"
FT   gene            335882..336157
FT                   /locus_tag="SPy_0397"
FT                   /old_locus_tag="SPy0397"
FT   CDS_pept        335882..336157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0397"
FT                   /old_locus_tag="SPy0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||D69874 conserved hypothetical
FT                   protein ylbG - Bacillus subtilis
FT                   >gi|2340003|emb|CAB11353.1| (Z98682) YlbG protein [Bacillus
FT                   subtilis] >gi|2633871|emb|CAB13373.1| (Z99111) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33433"
FT                   /db_xref="GOA:P60419"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60419"
FT                   /protein_id="AAK33433.1"
FT                   /translation="MFQKQERIGLVVYLYYNRDARKLSKFGDLYYHSKRSRYLIIYINK
FT                   NDLDTKLEEMRRLKCVKDIRPSAFDDIDRQFVGNLHRDETNNHQKG"
FT   gene            336406..337041
FT                   /gene="tmk"
FT                   /locus_tag="SPy_0399"
FT                   /old_locus_tag="SPy0399"
FT   CDS_pept        336406..337041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SPy_0399"
FT                   /old_locus_tag="SPy0399"
FT                   /product="putative thymidylate kinase"
FT                   /note="Best Blastp hit = dbj|BAB03761.1| (AP001507)
FT                   thymidylate kinase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33434"
FT                   /db_xref="GOA:Q9A190"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A190"
FT                   /protein_id="AAK33434.1"
FT                   /translation="MITGKLITVEGPDGAGKTTVLEQLIPLLKQKVAQDILTTREPGGV
FT                   AISEHIRELILDINHTAMDPKTELLLYIAARRQHLVEKVLPALEAGQLVFIDRFIDSSV
FT                   AYQGAGRGLIKADIQWLNEFATDGLEPDLTLYFDVPSEIGLARINANQQREVNRLDLET
FT                   IEIHQRVRKGYLALAKEHPKRIVTIDATKPLKEVVSVALEHVLALLLA"
FT   gene            337059..337934
FT                   /locus_tag="SPy_0400"
FT                   /old_locus_tag="SPy0400"
FT   CDS_pept        337059..337934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0400"
FT                   /old_locus_tag="SPy0400"
FT                   /product="putative DNA polymerase III delta' subunit"
FT                   /note="Best Blastp hit = dbj|BAB03763.1| (AP001507) DNA
FT                   polymerase III delta' subunit [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33435"
FT                   /db_xref="GOA:Q9A189"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A189"
FT                   /protein_id="AAK33435.1"
FT                   /translation="MDLAQKAPNVYQAFQTILKKDRLNHAYLFSGDFANEEMALFLAKV
FT                   IFCEQKKDQTPCGHCRSCQLIEQGDFADVTVLEPTGQVIKTDVVKEMMANFSQTGYENK
FT                   RQVFIIKDCDKMHINAANSLLKYIEEPQGEAYIFLLTNDDNKVLPTIKSRTQVFQFPKN
FT                   EAYLYQLAQEKGLLNHQAKLVAKLATNTSHLERLLQTSKLLELITQAERFVSIWLKDQL
FT                   QAYLALNRLVQLATEKEEQDLVLTLLTLLLARERAQTPLTQLEAVYQARLMWQSNVNFQ
FT                   NTLEYMVMSE"
FT   gene            337953..338192
FT                   /locus_tag="SPy_0401"
FT                   /old_locus_tag="SPy0401"
FT   CDS_pept        337953..338192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0401"
FT                   /old_locus_tag="SPy0401"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB03764.1| (AP001507) signal
FT                   peptidase-like protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33436"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A188"
FT                   /protein_id="AAK33436.1"
FT                   /translation="MGKRSLSKDLPVATKVAAHKGKKAFEENTAFATDLMKEVSRLITQ
FT                   NQLEMTFVNSVFLLDQHVVLIPFSAEEHMDFYNC"
FT   gene            338597..338920
FT                   /locus_tag="SPy_0405"
FT                   /old_locus_tag="SPy0405"
FT   CDS_pept        338597..338920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0405"
FT                   /old_locus_tag="SPy0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB03765.1| (AP001507) unknown
FT                   conserved protein in B. subtilis [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33437"
FT                   /db_xref="GOA:Q9A187"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A187"
FT                   /protein_id="AAK33437.1"
FT                   /translation="MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLEN
FT                   TKLRERLSHLEHETVAKNPSKQRKDHLEGIYDEGFHICNFFYGQRRENDEECMFCRELL
FT                   DRK"
FT   gene            338925..339788
FT                   /locus_tag="SPy_0406"
FT                   /old_locus_tag="SPy0406"
FT   CDS_pept        338925..339788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0406"
FT                   /old_locus_tag="SPy0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB03768.1| (AP001507) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33438"
FT                   /db_xref="GOA:Q9A186"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A186"
FT                   /protein_id="AAK33438.1"
FT                   /translation="MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFICA
FT                   EDTRNTGLLLKHFDIATKQISFHEHNAYEKIPDLIDLLISGRSLAQVSDAGMPSISDPG
FT                   HDLVKAAIDSDIAVVALPGASAGITALIASGLAPQPHVFYGFLPRKAGQQKAFFEDKHH
FT                   YPETQMFYESPYRIKDTLTNMLACYGDRQVVLVRELTKLFEEYQRGSISEILSYLEETP
FT                   LKGECLLIVAGAQADSEVELTADVDLVSLVQKEIQAGAKPNQAIKTIAKAYQVNRQELY
FT                   QQFHDL"
FT   gene            339815..340207
FT                   /locus_tag="SPy_0407"
FT                   /old_locus_tag="SPy0407"
FT   CDS_pept        339815..340207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0407"
FT                   /old_locus_tag="SPy0407"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAA61744.1| (X89566)
FT                   cytochrome-c oxidase sbunit I [Nitrobacter winogradskyi]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33439"
FT                   /db_xref="GOA:Q9A185"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A185"
FT                   /protein_id="AAK33439.1"
FT                   /translation="MTEDQATILILGVYGIILAVFLLSALLCLIANWRLFKRAGYKGWY
FT                   SLIPFYAGFVKHKITFGEDNKWFYFIGWVIAIYYYYVHFCYVRAFGGSKGLAVFGLFFP
FT                   GIASLIVAFGKTYTTQECHPVPHLLN"
FT   gene            complement(340254..340883)
FT                   /locus_tag="SPy_0408"
FT                   /old_locus_tag="SPy0408"
FT   CDS_pept        complement(340254..340883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0408"
FT                   /old_locus_tag="SPy0408"
FT                   /product="hypothetical protein"
FT                   /note="similar to Human CGI-32 protein; Best Blastp hit =
FT                   gi|7705728 CGI-32 protein [Homo sapiens]
FT                   >gi|4680703|gb|AAD27741.1|AF132966_1 (AF132966) CGI-32
FT                   protein [Homo sapiens]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33440"
FT                   /db_xref="GOA:Q9A184"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A184"
FT                   /protein_id="AAK33440.1"
FT                   /translation="MIKEFCAENLTLLPTLDAGQISRVELCDNLAVGGTTPSYGVIKEA
FT                   CQLLHDKKISVATMIRPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENQLD
FT                   TDAIEQLLPATQGLPLVFHMAFDRIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDN
FT                   VEQLKSLVTYANKRIEIMIGGGITAENCQSLSQLTGTAIVHGTKII"
FT   gene            341230..341538
FT                   /locus_tag="SPy_0410"
FT                   /old_locus_tag="SPy0410"
FT   CDS_pept        341230..341538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0410"
FT                   /old_locus_tag="SPy0410"
FT                   /product="putative arsenate reductase"
FT                   /note="Best Blastp hit = dbj|BAB07204.1| (AP001518)
FT                   arsenate reductase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33441"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A183"
FT                   /protein_id="AAK33441.1"
FT                   /translation="MAELKQLVSDFEAIDIKANPPKAQDLKHWMETSGYTIKNFFNTSG
FT                   NSYRELGLKDKIDQLSLDKAAELLATDGMLIKRPILIKDGNVLQVGYRKPYQELDLG"
FT   gene            complement(341612..342439)
FT                   /gene="exoA"
FT                   /locus_tag="SPy_0412"
FT                   /old_locus_tag="SPy0412"
FT   CDS_pept        complement(341612..342439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="SPy_0412"
FT                   /old_locus_tag="SPy0412"
FT                   /product="putative 3'-exo-deoxyribonuclease"
FT                   /EC_number="3.1.11.-"
FT                   /note="Best Blastp hit = sp|P37454|EXOA_BACSU
FT                   EXODEOXYRIBONUCLEASE >gi|2126877|pir||S66012
FT                   3'-exo-deoxyribonuclease exoA [similarity] - Bacillus
FT                   subtilis >gi|467372|dbj|BAA05218.1| (D26185)
FT                   3'-exo-deoxyribonuclease [Bacillus subtilis]
FT                   >gi|2636635|emb|CAB16125.1| (Z99124)
FT                   3'-exo-deoxyribonuclease [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33442"
FT                   /db_xref="GOA:Q9A182"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A182"
FT                   /protein_id="AAK33442.1"
FT                   /translation="MKLISWNIDSLNAALTGESPRALLSRAVLDTLVAQDADIIAIQET
FT                   KLSAKGPTKKHIETLLSYFPNYLHVWRSSVEPARKGYAGTMFLYKNTLNPVITFPEIGA
FT                   PTTMDAEGRIITLEFEDFFVTQVYTPNAGDGLRRLDDRQIWDHKYADYLTELDAQKPVL
FT                   ATGDYNVAHKEIDLANPNSNRRSPGFTDEERQGFTNLLARGFTDTFRHVHGDIPHVYTW
FT                   WAQRSKTSKINNTGWRIDYWLASNRLVDKVKRSEMISSGERQDHTPILLDIDL"
FT   gene            342667..343854
FT                   /gene="lctO"
FT                   /locus_tag="SPy_0414"
FT                   /old_locus_tag="SPy0414"
FT   CDS_pept        342667..343854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="SPy_0414"
FT                   /old_locus_tag="SPy0414"
FT                   /product="putative lactate oxidase"
FT                   /note="Best Blastp hit = emb|CAA68903.1| (Y07622) lactate
FT                   oxidase [Streptococcus iniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33443"
FT                   /db_xref="GOA:Q9A181"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014080"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A181"
FT                   /protein_id="AAK33443.1"
FT                   /translation="MSMAQKTVITEETTDFVMDFKTSSAEGNVDFINVFDLEKMAQQVI
FT                   PKGAFGYIASGAGDTFTLHENIRSFNHKLIVPHSLKGVENPSTEITFDGDYLTSPLILA
FT                   PVAAHKLANEQGEVASAKGLKEFGSIYTTSSYSTTDLPEISAALGGTPHWFQFYYSKDD
FT                   GINRNIMDRVKAQGCKAIVLTADATVGGNREVDRRNGFVFPVGMPIVQEYLPDGAGKTM
FT                   DYVYKSAKQALTSKDIEYIATYSGLPVYVKGPQCAEDTLRALDAGASGIWVTNHGGRQL
FT                   DGGPAAFDSLQEVAEAVDQKVPIVFDSGIRRGQHIFKALASGADLVALGRPAIYGLAMG
FT                   GSIGTRQVFEKLNDELKMVMQLAGTQTIQDVKAFNLRHNPYDSSIPFDQNALRLD"
FT   gene            344117..349060
FT                   /gene="prtS"
FT                   /locus_tag="SPy_0416"
FT                   /old_locus_tag="SPy0416"
FT   CDS_pept        344117..349060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtS"
FT                   /locus_tag="SPy_0416"
FT                   /old_locus_tag="SPy0416"
FT                   /product="putative cell envelope proteinase"
FT                   /note="Best Blastp hit = gb|AAG09771.1|AF243528_1
FT                   (AF243528) cell envelope proteinase [Streptococcus
FT                   thermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33444"
FT                   /db_xref="GOA:Q9A180"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A180"
FT                   /protein_id="AAK33444.1"
FT                   /translation="MEKKQRFSLRKYKSGTFSVLIGSVFLVMTTTVAADELSTMSEPTI
FT                   TNHAQQQAQHLTNTELSSAESKSQDTSQITLKTNREKEQSQDLVSEPTTTELADTDAAS
FT                   MANTGSDATQKSASLPPVNTDVHDWVKTKGAWDKGYKGQGKVVAVIDTGIDPAHQSMRI
FT                   SDVSTAKVKSKEDMLARQKAAGINYGSWINDKVVFAHNYVENSDNIKENQFEDFDEDWE
FT                   NFEFDAEAEPKAIKKHKIYRPQSTQAPKETVIKTEETDGSHDIDWTQTDDDTKYESHGM
FT                   HVTGIVAGNSKEAAATGERFLGIAPEAQVMFMRVFANDIMGSAESLFIKAIEDAVALGA
FT                   DVINLSLGTANGAQLSGSKPLMEAIEKAKKAGVSVVVAAGNERVYGSDHDDPLATNPDY
FT                   GLVGSPSTGRTPTSVAAINSKWVIQRLMTVKELENRADLNHGKAIYSESVDFKDIKDSL
FT                   GYDKSHQFAYVKESTDAGYNAQDVKGKIALIERDPNKTYDEMIALAKKHGALGVLIFNN
FT                   KPGQSNRSMRLTANGMGIPSAFISHEFGKAMSQLNGNGTGSLEFDSVVSKAPSQKGNEM
FT                   NHFSNWGLTSDGYLKPDITAPGGDIYSTYNDNHYGSQTGTSMASPQIAGASLLVKQYLE
FT                   KTQPNLPKEKIADIVKNLLMSNAQIHVNPETKTTTSPRQQGAGLLNIDGAVTSGLYVTG
FT                   KDNYGSISLGNITDTMTFDVTVHNLSNKDKTLRYDTELLTDHVDPQKGRFTLTSHSLKT
FT                   YQGGEVTVPANGKVTVRVTMDVSQFTKELTKQMPNGYYLEGFVRFRDSQDDQLNRVNIP
FT                   FVGFKGQFENLAVAEESIYRLKSQGKTGFYFDESGPKDDIYVGKHFTGLVTLGSETNVS
FT                   TKTISDNGLHTLGTFKNADGKFILEKNAQGNPVLAISPNGDNNQDFAAFKGVFLRKYQG
FT                   LKASVYHASDKEHKNPLWVSPESFKGDKNFNSDIRFAKSTTLLGTAFSGKSLTGAELPD
FT                   GHYHYVVSYYPDVVGAKRQEMTFDMILDRQKPVLSQATFDPETNRFKPEPLKDRGLAGV
FT                   RKDSVFYLERKDNKPYTVTINDSYKYVSVEDNKTFVERQADGSFILPLDKAKLGDFYYM
FT                   VEDFAGNVAIAKLGDHLPQTLGKTPIKLKLTDGNYQTKETLKDNLEMTQSDTGLVTNQA
FT                   QLAVVHRNQPQSQLTKMNQDFFISPNEDGNKDFVAFKGLKNNVYNDLTVNVYAKDDHQK
FT                   QTPIWSSQAGASVSAIESTAWYGITARGSKVMPGDYQYVVTYRDEHGKEHQKQYTISVN
FT                   DKKPMITQGRFDTINGVDHFTPDKTKALDSSGIVREEVFYLAKKNGRKFDVTEGKDGIT
FT                   VSDNKVYIPKNPDGSYTISKRDGVTLSDYYYLVEDRAGNVSFATLRDLKAVGKDKAVVN
FT                   FGLDLPVPEDKQIVNFTYLVRDADGKPIENLEYYNNSGNSLILPYGKYTVELLTYDTNA
FT                   AKLESDKIVSFTLSADNNFQQVTFKITMLATSQITAHFDHLLPEGSRVSLKTAQDQLIP
FT                   LEQSLYVPKAYGKTVQEGTYEVVVSLPKGYRIEGNTKVNTLPNEVHELSLRLVKVGDAS
FT                   DSTGDHKVMSKNNSQALTASATPTKSTTSATAKALPSTGEKMGLKLRIVGLVLLGLTCV
FT                   FSRKKSTKD"
FT   gene            349831..350538
FT                   /locus_tag="SPy_0421"
FT                   /old_locus_tag="SPy0421"
FT   CDS_pept        349831..350538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0421"
FT                   /old_locus_tag="SPy0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||E69896 hypothetical protein
FT                   yoaK - Bacillus subtilis >gi|2619025|gb|AAB84449.1|
FT                   (AF027868) putative permease [Bacillus subtilis]
FT                   >gi|2634257|emb|CAB13756.1| (Z99114) yoaK [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33445"
FT                   /db_xref="GOA:Q9A179"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A179"
FT                   /protein_id="AAK33445.1"
FT                   /translation="MSKKKRKHYQVYEGLRCAMTLCFISGYVNAFTYMTQGKRFAGVQT
FT                   GNLLSFAIRLSEQQLKEALQFLLPMIVFMLGQSFTYFMHRWATKKGLHWYLLSSVILTG
FT                   IAFGTALFTPFLPSNVTVAALAFFASIQVDTFKTLRGASYANVMMTGNIKNAAYLLTKG
FT                   LYEKNHELTHIGRNTLIVILAFAVGVVCSTLLCIAYGEYALMPILMPLLYVNYLLAQEF
FT                   YHIQTKIKPIKRT"
FT   gene            350778..352778
FT                   /gene="metS"
FT                   /locus_tag="SPy_0422"
FT                   /old_locus_tag="SPy0422"
FT   CDS_pept        350778..352778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="SPy_0422"
FT                   /old_locus_tag="SPy0422"
FT                   /product="putative methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="Best Blastp hit = dbj|BAB03772.1| (AP001507)
FT                   methionyl-tRNA synthetase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33446"
FT                   /db_xref="GOA:Q9A178"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A178"
FT                   /protein_id="AAK33446.1"
FT                   /translation="MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVF
FT                   YLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEV
FT                   VAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVE
FT                   WVSEESYFLRLSKYDDRLVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSRTTFTW
FT                   GVPVPSDPKHVVYVWIDALLNYATALGYRQANHANFDKFWNGTVFHMVGKDILRFHSIY
FT                   WPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSL
FT                   PVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLS
FT                   QLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVM
FT                   AHLAASLRLVAHVIQPFMMETSAAIMAQLGLEPVSDLSTLALADFPANTKVVAKGTPIF
FT                   PRLDMEAEIDYIKAQMGDSSAISQEKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKE
FT                   VSKVEGSEKLLRFRVDAGDGQDRQILSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKY
FT                   ISQGMILSAEHGDQLTVLTVDSSVPNGSIIG"
FT   gene            353273..354286
FT                   /gene="nrdF.1"
FT                   /locus_tag="SPy_0425"
FT                   /old_locus_tag="SPy0425"
FT   CDS_pept        353273..354286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF.1"
FT                   /locus_tag="SPy_0425"
FT                   /old_locus_tag="SPy0425"
FT                   /product="putative ribonucleotide reductase 2"
FT                   /note="Best Blastp hit = sp|P75461|RIR2_MYCPN
FT                   RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN
FT                   (RIBONUCLEOTIDE REDUCTASE) >gi|2146587|pir||S73840
FT                   ribonucleotide reductase 2 - Mycoplasma pneumoniae (strain
FT                   ATCC 29342) >gi|1674208|gb|AAB96162.1| (AE000050)
FT                   Mycoplasma pneumoniae, ribonucleotide reductase 2; similar
FT                   to Swiss-Prot Accession Number P17424, from S. typhimurium"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33447"
FT                   /db_xref="GOA:Q9A177"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A177"
FT                   /protein_id="AAK33447.1"
FT                   /translation="MTQHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVT
FT                   QNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDH
FT                   EQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGD
FT                   DPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQ
FT                   QKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQ
FT                   NLGYESPFTDEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF"
FT   gene            354290..354778
FT                   /gene="nrdI"
FT                   /locus_tag="SPy_0426"
FT                   /old_locus_tag="SPy0426"
FT   CDS_pept        354290..354778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="SPy_0426"
FT                   /old_locus_tag="SPy0426"
FT                   /product="putative ribonucleotide reductase (NrdI protein)"
FT                   /note="Best Blastp hit = sp|P47472|NRDI_MYCGE NRDI PROTEIN
FT                   >gi|1361639|pir||D64225 hypothetical protein MG230 -
FT                   Mycoplasma genitalium >gi|3844833|gb|AAC71451.1| (U39702)
FT                   nrdI protein (nrdI) [Mycoplasma genitalium]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33448"
FT                   /db_xref="GOA:Q9A176"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A176"
FT                   /protein_id="AAK33448.1"
FT                   /translation="MAELIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNRPLEVSTHYLL
FT                   IVPTYAAGGSDAKGAVSKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKL
FT                   QVPLLHQFELLGTATDVKKVQAIFARLKHHTHDKQKQTNNLITERTHPCHKPMRHTSH"
FT   gene            354745..356925
FT                   /gene="nrdE.1"
FT                   /locus_tag="SPy_0427"
FT                   /old_locus_tag="SPy0427"
FT   CDS_pept        354745..356925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE.1"
FT                   /locus_tag="SPy_0427"
FT                   /old_locus_tag="SPy0427"
FT                   /product="ribonucleoside-diphosphate reductase, large
FT                   chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="Best Blastp hit = sp|P78027|RIR1_MYCPN
FT                   RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE ALPHA CHAIN
FT                   (RIBONUCLEOTIDE REDUCTASE) >gi|2146586|pir||S73838
FT                   ribonucleoside-diphosphate reductase (EC 1.17.4.1) large
FT                   chain nrdE - Mycoplasma pneumoniae (strain ATCC 29342)
FT                   >gi|1674206|gb|AAB96160.1| (AE000050) Mycoplasma
FT                   pneumoniae, ribonucleoside-diphosphate reductase; similar
FT                   to Swiss-Prot Accession Number Q08698, from S. typhimurium"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33449"
FT                   /db_xref="GOA:Q9A175"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A175"
FT                   /protein_id="AAK33449.1"
FT                   /translation="MSQTNASYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQ
FT                   MAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSY
FT                   ALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKR
FT                   RGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATG
FT                   IVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALG
FT                   LVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISAR
FT                   KFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLS
FT                   FETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVETGNAA
FT                   NHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKGAFAGF
FT                   SLSTYSDGTYFAKYLQEDAKPQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAH
FT                   LLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYE
FT                   VGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQD
FT                   VLAGSEQYDEDSLVTAPGASDETTTECQSCMI"
FT   gene            complement(357119..357871)
FT                   /locus_tag="SPy_0428"
FT                   /old_locus_tag="SPy0428"
FT   CDS_pept        complement(357119..357871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0428"
FT                   /old_locus_tag="SPy0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P15879|ARC3_CBDP
FT                   MONO-ADP-RIBOSYLTRANSFERASE C3 PRECURSOR (EXOENZYME C3)
FT                   >gi|625586|pir||A38912 NAD+-asparagine
FT                   ADP-ribosyltransferase (EC 2.4.2.-) C3 precursor -
FT                   Clostridium botulinum phage (strain CST)
FT                   >gi|296787|emb|CAA41767.1| (X59039) exoenzyme C3
FT                   [Clostridium botulinum C phage] >gi|505281|emb|CAA41768.1|
FT                   (X59040) exoenzyme C3 [Clostridium botulinum D phage]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33450"
FT                   /db_xref="GOA:Q9A174"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="InterPro:IPR016678"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A174"
FT                   /protein_id="AAK33450.1"
FT                   /translation="MLKKRYQLAIVLLLSCFSLIWQTEGLVELFVCEHYERAVCEGTPA
FT                   YFTFSDQKGAETLIKKRWGKGLIYPRAEQEAMAAYTCQQAGPINTSLDKAKGELSQLTP
FT                   ELRDQVAQLDAATHRLVIPWNIVVYRYVYETFLRDIGVSHADLTSYYRNHQFDPHILCK
FT                   IKLGTRYTKHSFMSTTALKNGAMTHRPVEVRICVKKGAKAAFVEPYSAVPSEVELLFPR
FT                   GCQLEVVGAYVSQDQKKLHIEAYFKGSL"
FT   gene            358312..358866
FT                   /locus_tag="SPy_0430"
FT                   /old_locus_tag="SPy0430"
FT   CDS_pept        358312..358866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0430"
FT                   /old_locus_tag="SPy0430"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAD29424.1|AF136451_1
FT                   (AF136451) fibronectin-binding protein SFS [Streptococcus
FT                   equi]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33451"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A173"
FT                   /protein_id="AAK33451.1"
FT                   /translation="MKWSGFMKTKSKRFLNLATLCLALLGTTLLMAHPVQAEVISKRDY
FT                   MTRFGLGDLEDDSANYPSNLEARYKGYLEGYEKGLKGDDIPERPKIQVPEDVQPSDHGD
FT                   YRDGYEEGFGEGQHKRDPLETEAEDDSQGGRQEGRQGHQEGADSSDLNVEESDGLSVID
FT                   EVVGVIYQAFSTIWTYLSGLF"
FT   gene            complement(358956..359174)
FT                   /locus_tag="SPy_0431"
FT                   /old_locus_tag="SPy0431"
FT   CDS_pept        complement(358956..359174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0431"
FT                   /old_locus_tag="SPy0431"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A172"
FT                   /protein_id="AAK33452.1"
FT                   /translation="MLRTGNTFFSGINAPFSTHGSLKPKKATPIRGGLTTKGIIPIIAE
FT                   NCFKTVGLLNTNKEFYQPRIHQPFKNT"
FT   gene            359140..359391
FT                   /locus_tag="SPy_0432"
FT                   /old_locus_tag="SPy0432"
FT   CDS_pept        359140..359391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0432"
FT                   /old_locus_tag="SPy0432"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33453"
FT                   /db_xref="GOA:Q9A171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A171"
FT                   /protein_id="AAK33453.1"
FT                   /translation="MPEKKVLPVLSIVVSFVCLLDHIFFFATYSYLYLPLVASSLALIG
FT                   LVQNKGRQKVWSLAGLVLAALAVAVVAYAYYDPTVIPY"
FT   gene            complement(359485..360117)
FT                   /locus_tag="SPy_0433"
FT                   /old_locus_tag="SPy0433"
FT   CDS_pept        complement(359485..360117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0433"
FT                   /old_locus_tag="SPy0433"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33454"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A170"
FT                   /protein_id="AAK33454.1"
FT                   /translation="MKKTLTLLLALFAIGVTSSVRAEDEQSSTQKPVKFDLDGPQQKIK
FT                   DYSGNTITLEDLYVGSKVVKIYIPQGWWVYLYRQCDHNSKERGILASPILEKNITKTDP
FT                   YRQYYTGVPYILNLGEDPLKKGEKLTFSFKGEDGFYVGSYIYRDSDTIKKEKEAEEALQ
FT                   KKEEEKQQKQLEESMLKQIREEDHKPWHQRLSESIQDQWWNFKGLFQ"
FT   gene            360796..361116
FT                   /locus_tag="SPy_0435"
FT                   /old_locus_tag="SPy0435"
FT   CDS_pept        360796..361116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0435"
FT                   /old_locus_tag="SPy0435"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33455"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A169"
FT                   /protein_id="AAK33455.1"
FT                   /translation="MKKTLLLSTAVLTLAGTVALLTHSVDASTYSYYSTSHFLRQDGRE
FT                   TLREAKYAAELQIRNLLSQYHINGKEYNNYFRYYYRQAMQARNIDEVNKIIEDLEKNLQ
FT                   AQ"
FT   gene            complement(361429..362127)
FT                   /gene="speJ"
FT                   /locus_tag="SPy_0436"
FT                   /old_locus_tag="SPy0436"
FT   CDS_pept        complement(361429..362127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speJ"
FT                   /locus_tag="SPy_0436"
FT                   /old_locus_tag="SPy0436"
FT                   /product="putative exotoxin (superantigen)"
FT                   /note="Best Blastp hit = sp|P13380|SPEC_STRPY EXOTOXIN TYPE
FT                   C PRECURSOR (SPE C)"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33456"
FT                   /db_xref="GOA:Q99QN1"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/TrEMBL:Q99QN1"
FT                   /protein_id="AAK33456.1"
FT                   /translation="MKRIIKTIILVIIIFHGYGSVKSDSENIKDVKLQLNYAYEIIPVD
FT                   YTNCNIDYLTTHDFYIDISSYKKKNFSVDSEVESYITTKFTKNQKVNIFGLPYIFTRYD
FT                   VYYIYGGVTPSVNSNSENSKIVGNLLIDGVQQKTLINPIKIDKPIFTIQEFDFKIRQYL
FT                   MQTYKIYDPNSPYIKGQLEIAINGNKHESFNLYDATSSSTRSDIFKKYKDNKTINMKDF
FT                   SHFDIYLWTK"
FT   gene            complement(362375..362989)
FT                   /locus_tag="SPy_0437"
FT                   /old_locus_tag="SPy0437"
FT   CDS_pept        complement(362375..362989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0437"
FT                   /old_locus_tag="SPy0437"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33457"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A168"
FT                   /protein_id="AAK33457.1"
FT                   /translation="MKKTLTLLLALFAIGVTSSVRAEDEQNKFILDGLQEKVKEVSVSD
FT                   FSVGESKIKVWLPQAWSVKISREHSPKSSISNSGEQKPLSNSSENKEGQFSKRLPYGTQ
FT                   HTIKLSSQLTKGERVTLTFRDEDFWGAGYCFYRDSLSIKEDKQYEEEIKKIEDDLERQD
FT                   LENDALEMFKKQTEREANKPWHQRLSENIQDQWWNFKGLFQ"
FT   gene            363350..363586
FT                   /locus_tag="SPy_0439"
FT                   /old_locus_tag="SPy0439"
FT   CDS_pept        363350..363586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0439"
FT                   /old_locus_tag="SPy0439"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33458"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A167"
FT                   /protein_id="AAK33458.1"
FT                   /translation="MTFEEILPGLKAKKKYVRTGWGGAENYVQLFDTLEVDGKVLQATP
FT                   YFLIHVTGAGEGFSMWAPTPCDVLAEDWIEVND"
FT   gene            363579..364277
FT                   /locus_tag="SPy_0440"
FT                   /old_locus_tag="SPy0440"
FT   CDS_pept        363579..364277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0440"
FT                   /old_locus_tag="SPy0440"
FT                   /product="putative dehydrogenease / oxidoreductase"
FT                   /note="Best Blastp hit = sp|P39640|YWFD_BACSU HYPOTHETICAL
FT                   OXIDOREDUCTASE IN PTA-ROCC INTERGENIC REGION
FT                   >gi|629089|pir||S39737 glucose 1-dehydrogenase homolog ywfD
FT                   - Bacillus subtilis >gi|414006|emb|CAA51638.1| (X73124)
FT                   ipa-82d [Bacillus subtilis] >gi|2636308|emb|CAB15799.1|
FT                   (Z99123) alternate gene name: ipa-82d; similar to glucose
FT                   1-dehydrogenase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33459"
FT                   /db_xref="GOA:Q9A166"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A166"
FT                   /protein_id="AAK33459.1"
FT                   /translation="MTKVVLVTGCASGIGYAQARYFLKQGHHVYGVDKSDKPDLSGNFH
FT                   FIKLDLSSELAPLFKVVPSVDILCNTAGILDAYKPLLDVSDEEVEHLFDINFFATVKLT
FT                   RHYLRRMVEKQSGVIINMCSIASFIAGGGGVAYTSSKHALAGFTRQLALDYAKDQIHIF
FT                   GIAPGAVKTAMTANDFEPGGLADWVARETPIGRWTKPDEVAELTGFLASGKARSMQGEI
FT                   VKIDGGWTLK"
FT   gene            364353..365312
FT                   /locus_tag="SPy_0441"
FT                   /old_locus_tag="SPy0441"
FT   CDS_pept        364353..365312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0441"
FT                   /old_locus_tag="SPy0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06422.1| (AP001516) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33460"
FT                   /db_xref="GOA:Q9A165"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A165"
FT                   /protein_id="AAK33460.1"
FT                   /translation="MKLAVLGTGMIVKEVLPVLQKIDGIDLVAILSTVRSLTTAKDLAK
FT                   AHHMPLATSKYEAILGNEEIDTVYIGLPNHLHFAYAKEALLAGKHVICEKPFTMTAGEL
FT                   DELVVIARKRKLILLEAITNQYLSNMTFIKEHLDQLGDIKIVECNYSQYSSRYDAFKRG
FT                   DIAPAFNPKMGGGALRDLNIYNIHFVVGLFGRPKTVQYLANVEKGIDTSGMLVMDYEQF
FT                   KVVCIGAKDCTAEIKSTIQGNKGSLAVLGATNTLPQVQLSLHGHEPQVINHNKHDHRMY
FT                   EEFVAFRDMIDQRDFEKVNQALEHSRAVMAVLERAVHS"
FT   gene            365645..366982
FT                   /locus_tag="SPy_0442"
FT                   /old_locus_tag="SPy0442"
FT   CDS_pept        365645..366982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0442"
FT                   /old_locus_tag="SPy0442"
FT                   /product="putative glycerol-3-phosphate transporter"
FT                   /note="Best Blastp hit = pir||C82495 glycerol-3-phosphate
FT                   transporter VCA0137 [imported] - Vibrio cholerae (group O1
FT                   strain N16961) >gi|9657525|gb|AAF96050.1| (AE004355)
FT                   glycerol-3-phosphate transporter [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33461"
FT                   /db_xref="GOA:Q9A164"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A164"
FT                   /protein_id="AAK33461.1"
FT                   /translation="MEEDYNKREPEKFTQFLRRQKVVFFVAFFGYVCAYLVRNNFKLMS
FT                   NTIMVQNGWDKAQIAILLSCLTVSYGLAKFYMGALGDRVSLRKLFSISLGASALICILI
FT                   GFFNSSMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAIAGWNISQNMGSALL
FT                   PLTIALLTSMGLVVPANGNILLAFLIPGVLVFLFALCCWKLGGDNPESEGLDSLRTMYG
FT                   DAGESAVASEEEKHNLSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYLSQ
FT                   VANMSEAHIHFAISMLEWVAIPGSLVFAWLAVRYPNKMAKVGAIGLFVLAAIVFVYERL
FT                   TATGAPNYFLLLVIAGILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIGNM
FT                   GANWLMPILADGFGWFWSYIVVAALSAFSAVGYLILAKREEEIIKD"
FT   gene            367155..368537
FT                   /gene="gcaD"
FT                   /locus_tag="SPy_0443"
FT                   /old_locus_tag="SPy0443"
FT   CDS_pept        367155..368537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="SPy_0443"
FT                   /old_locus_tag="SPy0443"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /note="Best Blastp hit = dbj|BAB03784.1| (AP001507)
FT                   UDP-N-acetylglucosamine pyrophosphorylase [Bacillus
FT                   halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33462"
FT                   /db_xref="GOA:Q9A163"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A163"
FT                   /protein_id="AAK33462.1"
FT                   /translation="MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAISP
FT                   EKSVTVIGHKSEMVRAVLADQSAFVHQTEQLGTGHAVMMAETQLEGLEGHTLVIAGDTP
FT                   LITGESLKSLIDFHVNHKNVATILTATAQDPFGYGRIVRNKDGEVIKIVEQKDANEYEQ
FT                   QLKEINTGTYVFDNKRLFEALKCITTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNE
FT                   SLGVNDRVALAIAETVMRQRITQKHMVNGVTFQNPETVYIESDVEIAPDVLIEGNVTLK
FT                   GRTHIGSGTVLTNGTYIVDSEIGDNCVVTNSMIESSVLAAGVTVGPYAHLRPGTTLDRE
FT                   VHIGNFVEVKGSHIGEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDGQNKYETVIGDH
FT                   AFIGSNSTLIAPLEVGDHALTAAGSTISKTVPIDSIAIGRSRQVTKEGYAKRLAHHPSR
FT                   SK"
FT   gene            368568..369122
FT                   /locus_tag="SPy_0444"
FT                   /old_locus_tag="SPy0444"
FT   CDS_pept        368568..369122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0444"
FT                   /old_locus_tag="SPy0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P54570|YQKG_BACSU HYPOTHETICAL
FT                   21.0 KDA PROTEIN IN GLNQ-ANSR INTERGENIC REGION
FT                   >gi|7429371|pir||A69967 conserved hypothetical protein yqkG
FT                   - Bacillus subtilis >gi|1303984|dbj|BAA12639.1| (D84432)
FT                   YqkG [Bacillus subtilis] >gi|2634796|emb|CAB14293.1|
FT                   (Z99116) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33463"
FT                   /db_xref="GOA:Q9A162"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A162"
FT                   /protein_id="AAK33463.1"
FT                   /translation="MKFEEKTLKRQTVFDGHIFKVVVDDVELPNNLGQSKRELIFHRGA
FT                   VAVLAITPERKIVLVKQYRKAIERVSYEIPAGKLEIGEEGSKLKAAARELEEETAYTGT
FT                   LTFLYEFYTAIGFCNEKITLFLATDLIQVANPKPQDDDEVIEVLELTYQECMDLVAQGK
FT                   LADAKTLIALQYYALHFGGEQ"
FT   gene            369122..369373
FT                   /locus_tag="SPy_0446"
FT                   /old_locus_tag="SPy0446"
FT   CDS_pept        369122..369373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0446"
FT                   /old_locus_tag="SPy0446"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33464"
FT                   /db_xref="GOA:Q9A161"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A161"
FT                   /protein_id="AAK33464.1"
FT                   /translation="MGRPLLTDDIIEKARRMETFEPDDAVNFDTKVMTLPEKDDKARIY
FT                   KSRRIENAKRSQLQSKLNVILIAVMLLIAILVYAIFYL"
FT   gene            369393..370088
FT                   /gene="pfs"
FT                   /locus_tag="SPy_0447"
FT                   /old_locus_tag="SPy0447"
FT   CDS_pept        369393..370088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="SPy_0447"
FT                   /old_locus_tag="SPy0447"
FT                   /product="putative MTA/SAH nucleosidase
FT                   (5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase)"
FT                   /note="Best Blastp hit = sp|P24247|PFS_ECOLI MTA/SAH
FT                   NUCLEOSIDASE (P46) [INCLUDES: 5'-METHYLTHIOADENOSINE
FT                   NUCLEOSIDASE ; S-ADENOSYLHOMOCYSTEINE NUCLEOSIDASE ]
FT                   >gi|628786|pir||S45227 pfs protein - Escherichia coli
FT                   >gi|473817|dbj|BAA05606.1| (D26562) 'ORF' [Escherichia
FT                   coli] >gi|1552737|gb|AAB08589.1| (U70214) similar to purine
FT                   nucleoside phosphorylase (deoD) [Escherichia coli]
FT                   >gi|1786354|gb|AAC73270.1| (AE000125) orf, hypothetical
FT                   protein [Escherichia coli] >gi|2981267|gb|AAC38291.1|
FT                   (U24438) MTA/SAH nucleosidase [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33465"
FT                   /db_xref="GOA:Q9A160"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A160"
FT                   /protein_id="AAK33465.1"
FT                   /translation="MKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELIL
FT                   VQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATA
FT                   FGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKT
FT                   AFSDVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQTL
FT                   MTFLENLPV"
FT   gene            370239..370580
FT                   /locus_tag="SPy_0448"
FT                   /old_locus_tag="SPy0448"
FT   CDS_pept        370239..370580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0448"
FT                   /old_locus_tag="SPy0448"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A159"
FT                   /protein_id="AAK33466.1"
FT                   /translation="MTLKKHYYLLSLLALVTVGAAFNTSQSVSAQVYSNEGYHQHLTDE
FT                   KSHLQYSKDNAQLQLRNILDGYQNDLGRHYSSYYYYNLRTVMGLSSEQDIEKHYEELKN
FT                   KLHDMYNHY"
FT   gene            complement(370681..371328)
FT                   /locus_tag="SPy_0450"
FT                   /old_locus_tag="SPy0450"
FT   CDS_pept        complement(370681..371328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0450"
FT                   /old_locus_tag="SPy0450"
FT                   /product="putative metal-dependent transcriptional
FT                   regulator"
FT                   /note="Best Blastp hit = gb|AAF81675.1|AF232688_4
FT                   (AF232688) SloR [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33467"
FT                   /db_xref="GOA:Q9A158"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A158"
FT                   /protein_id="AAK33467.2"
FT                   /translation="MTPNKEDYLKCIYEIGEQEPKITNKMVAEKMHVSAPAVSEMIKKM
FT                   ISQGWIVKDKAKGYLLKDKGYALVANLYRKHRLIEVFLIHQLGYNTQEVHQEAEVLEHT
FT                   VSDSFIDRLDKILDFPDFCPHGGTIPRYGQPLVEMNTTTLNTITELGRFRLSRIHDHFD
FT                   LIQYLEAHHLNINTELTLTQIDTFAKTYTICYGDKELVIPENIAKQLYVTAL"
FT   gene            371474..372406
FT                   /gene="mtsA"
FT                   /locus_tag="SPy_0453"
FT                   /old_locus_tag="SPy0453"
FT   CDS_pept        371474..372406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsA"
FT                   /locus_tag="SPy_0453"
FT                   /old_locus_tag="SPy0453"
FT                   /product="metal binding protein of ABC transporter
FT                   (lipoprotein)"
FT                   /note="Best Blastp hit = pir||T48894 lipoprotein mtsA,
FT                   metal binding [validated] - Streptococcus pyogenes
FT                   (fragment) >gi|5932388|gb|AAD56939.1|AF180521_1 (AF180521)
FT                   metal binding protein of ABC transporter MtsA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33468"
FT                   /db_xref="GOA:P0A4G4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="PDB:3HH8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4G4"
FT                   /protein_id="AAK33468.1"
FT                   /translation="MGKRMSLILGAFLSVFLLVACSSTGTKTAKSDKLKVVATNSIIAD
FT                   MTKAIAGDKIDLHSIVPIGQDPHEYEPLPEDVEKTSNADVIFYNGINLEDGGQAWFTKL
FT                   VKNAQKTKNKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAKD
FT                   PKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSAY
FT                   IWEINTEEEGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFTD
FT                   SIAKKGKPGDSYYAMMKWNLDKISEGLAK"
FT   gene            372470..373195
FT                   /gene="mtsB"
FT                   /locus_tag="SPy_0454"
FT                   /old_locus_tag="SPy0454"
FT   CDS_pept        372470..373195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsB"
FT                   /locus_tag="SPy_0454"
FT                   /old_locus_tag="SPy0454"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="Best Blastp hit = gb|AAD56937.1|AF180520_2
FT                   (AF180520) ATP-binding protein MtsB [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33469"
FT                   /db_xref="GOA:Q7DAM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAM8"
FT                   /protein_id="AAK33469.1"
FT                   /translation="MITTNNLCVTYDGNSNALEAINVTIEGPSIVGIIGPNGAGKSTFM
FT                   KAILNLIDYQGHVTVDGKDGRKLGHTVAYVEQRSMIDYNFPITVKECVALGTYSKLGLF
FT                   RRVGKKQFEQVDKVLKQVGLEDFGHRPIKSLSGGQFQRMLVARCLIQESDYIFLDEPFV
FT                   GIDSVSEKIIVDLLKELKMAGKTILIVHHDLSKVEHYFDKLMILNKHLVAYGNVCEVFT
FT                   VDTLSKAYGNHLILGKEMV"
FT   gene            373196..374050
FT                   /gene="mtsC"
FT                   /locus_tag="SPy_0456"
FT                   /old_locus_tag="SPy0456"
FT   CDS_pept        373196..374050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsC"
FT                   /locus_tag="SPy_0456"
FT                   /old_locus_tag="SPy0456"
FT                   /product="ABC transporter (permease protein)"
FT                   /note="Best Blastp hit = gb|AAD56938.1|AF180520_3
FT                   (AF180520) integral membrane protein MtsC [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33470"
FT                   /db_xref="GOA:Q7DAM7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAM7"
FT                   /protein_id="AAK33470.1"
FT                   /translation="MSMKFFEGLMSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMG
FT                   DAISHAVLPGVALSFILGVNFFIGAIIFGLLASVIITYIKENSVIKGDTAIGITFSSFL
FT                   ALGVILIGVANSSTDLFHILFGNILAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFD
FT                   PILAKSMGVKVNAYHYLLMVLLTLVAVTAMQSVGTILIVALLITPAATAYLYANSLKVM
FT                   LVMSSLLGALASVLGLYLGYTFNVAAGSSIVLTSAMMFLISFFVSPKQGYLKRWMQKKE
FT                   KTP"
FT   gene            complement(374198..375004)
FT                   /locus_tag="SPy_0457"
FT                   /old_locus_tag="SPy0457"
FT   CDS_pept        complement(374198..375004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0457"
FT                   /old_locus_tag="SPy0457"
FT                   /product="putative cyclophilin-type protein"
FT                   /note="Best Blastp hit = pir||T41399 probable
FT                   cyclophilin-related peptidyl prolyl cis-trans isomerase -
FT                   fission yeast (Schizosaccharomyces pombe)
FT                   >gi|3169061|emb|CAA19257.1| (AL023704) putative
FT                   Cyclophilin-type peptidyl-prolyl cis-trans isomerase
FT                   protein [Schizosaccharomyces pombe]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33471"
FT                   /db_xref="GOA:Q9A156"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A156"
FT                   /protein_id="AAK33471.1"
FT                   /translation="MKKLLSLSLVAISLLNLSACESVDRAIKGDKYIDEKTAKEESEAA
FT                   SKAYEESIQKALKADASQFPQLTKEVGKEEAKVVMRTSQGDITLKLFPKYAPLAVENFL
FT                   THAKKGYYDNLTFHRVINDFMIQSGDPKGDGTGGESIWKGKDPKKDAGNGFVNEISPFL
FT                   YHIRGALAMANAGANTNGSQFYINQNKKNQSKGLSSTNYPKPIISAYEHGGNPSLDGGY
FT                   TVFGQVIDGMDVVDKIAATSINQNDKPEQDITITSIDIVKDYRFKN"
FT   gene            375221..377626
FT                   /locus_tag="SPy_0458"
FT                   /old_locus_tag="SPy0458"
FT   CDS_pept        375221..377626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0458"
FT                   /old_locus_tag="SPy0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06114.1| (AP001515) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33472"
FT                   /db_xref="GOA:Q9A155"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A155"
FT                   /protein_id="AAK33472.1"
FT                   /translation="MVKRNQRKKSAPKKRLTKAEVEKQRAIKRMILSVLMALLLIFAML
FT                   RLGVFGVTTYNMIRFLVGSLAYPFMFAWLIYLFCFKWLRQKDGMIAGVVIAFLGLLVEW
FT                   HAFLFAMPRMLDQDIFLGTARLITRDLLALRVTEFVGGGMLGALLYKPIAFLFSNIGSY
FT                   FIGFLFILLGLFLMTPWDIYDVSHFVKEAVDKLAVAYQENKEKRFIKREEHRLQAEKEA
FT                   LEKQAQEEEKRLAELTVDPETGEIVEDSQSQVSYDLAEDMTKEPEILAYDSHLKDDETS
FT                   LFDQEDLAYAHEEIGAYDSLSALASSEDEMDMDEPVEVDFTPKTHLLYKLPTIDLFAPD
FT                   KPKNQSKEKNLVRKNIKVLEDTFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISN
FT                   LADDLALALAAKDVRIEAPIPGKSLIGIEVPNSEIATVSFRELWEQSDANPENLLEVPL
FT                   GKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIISSILMKARPDQVKFMMIDPKMV
FT                   ELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIAGYNTKVEEFN
FT                   ASSEQKQIPLPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVD
FT                   VISGLIKANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSF
FT                   ISDDDVERIVNFIKDQTEADYDDAFDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLE
FT                   TQKASASMIQRRLSVGFNRATRLMDELEEAGVIGPAEGTKPRKVLQTN"
FT   gene            complement(377696..378049)
FT                   /locus_tag="SPy_0459"
FT                   /old_locus_tag="SPy0459"
FT   CDS_pept        complement(377696..378049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0459"
FT                   /old_locus_tag="SPy0459"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33473"
FT                   /db_xref="GOA:Q9A154"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A154"
FT                   /protein_id="AAK33473.1"
FT                   /translation="MMIYKLTALAFLIVTPLFAMIVTSLFKLNKKGFKFPDVALLLFAI
FT                   EIVLVSGKFFTHNLLPYYLIIMSLLAIVISLLLVIRTQSFSYHRFMKLFWRVGFLVTVI
FT                   FYLILVIFIFTLA"
FT   gene            378293..378718
FT                   /gene="rplK"
FT                   /locus_tag="SPy_0460"
FT                   /old_locus_tag="SPy0460"
FT   CDS_pept        378293..378718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SPy_0460"
FT                   /old_locus_tag="SPy0460"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Best Blastp hit = sp|Q06796|RL11_BACSU 50S RIBOSOMAL
FT                   PROTEIN L11 (BL11) >gi|481872|pir||S39860 ribosomal protein
FT                   L11 (BL11) rplK - Bacillus subtilis
FT                   >gi|285629|dbj|BAA02561.1| (D13303) ribosomal protein L11
FT                   [Bacillus subtilis] >gi|2632369|emb|CAB11878.1| (Z99104)
FT                   ribosomal protein L11 (BL11) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33474"
FT                   /db_xref="GOA:P66058"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66058"
FT                   /protein_id="AAK33474.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNTTKVATVTRAQ
FT                   VQEIAETKMPDLNAANIEAAMRMIEGTARSMGFTVTD"
FT   gene            378824..379513
FT                   /gene="rplA"
FT                   /locus_tag="SPy_0461"
FT                   /old_locus_tag="SPy0461"
FT   CDS_pept        378824..379513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SPy_0461"
FT                   /old_locus_tag="SPy0461"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Best Blastp hit = sp|P04447|RL1_BACST 50S RIBOSOMAL
FT                   PROTEIN L1"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33475"
FT                   /db_xref="GOA:P66097"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66097"
FT                   /protein_id="AAK33475.1"
FT                   /translation="MAKKSKQMRAALEKVDSTKAYSVEEAVALVKETNFAKFDASVEVA
FT                   YNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGI
FT                   KVDPNSL"
FT   gene            379836..380564
FT                   /gene="pyrH"
FT                   /locus_tag="SPy_0462"
FT                   /old_locus_tag="SPy0462"
FT   CDS_pept        379836..380564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SPy_0462"
FT                   /old_locus_tag="SPy0462"
FT                   /product="putative uridylate kinase (UMP-kinase)"
FT                   /note="Best Blastp hit = emb|CAB38122.1| (AJ011960)
FT                   UMP-kinase [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33476"
FT                   /db_xref="GOA:P65938"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="PDB:1Z9D"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65938"
FT                   /protein_id="AAK33476.1"
FT                   /translation="MEPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGV
FT                   QIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAI
FT                   PMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNG
FT                   VDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGN
FT                   IQRVVFGEHIGTTVSNKVCD"
FT   gene            380593..381150
FT                   /gene="rrf"
FT                   /locus_tag="SPy_0463"
FT                   /old_locus_tag="SPy0463"
FT   CDS_pept        380593..381150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /locus_tag="SPy_0463"
FT                   /old_locus_tag="SPy0463"
FT                   /product="putative ribosome recycling factor"
FT                   /note="Best Blastp hit = sp|O31203|RRF1_STAAU PROBABLE
FT                   RIBOSOME RECYCLING FACTOR (RIBOSOME RELEASING FACTOR) (RRF)
FT                   >gi|3915844|sp|O33276|RRF_STAAU PROBABLE RIBOSOME RECYCLING
FT                   FACTOR (RIBOSOME RELEASING FACTOR) (RRF)
FT                   >gi|2645713|gb|AAB87473.1| (AF033018) ribosome recycling
FT                   factor [Staphylococcus aureus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33477"
FT                   /db_xref="GOA:P68903"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68903"
FT                   /protein_id="AAK33477.1"
FT                   /translation="MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYY
FT                   GAPTPLNQLASITVPEARVLLISPFDKSSIKDIERALNASDLGITPANDGSVIRLVIPA
FT                   LTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAKKQEKAKEITEDELKTLEKDIQKA
FT                   TDDAIKEIDRMTAEKEKELLSV"
FT   gene            381259..382116
FT                   /locus_tag="SPy_0464"
FT                   /old_locus_tag="SPy0464"
FT   CDS_pept        381259..382116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0464"
FT                   /old_locus_tag="SPy0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAA70667.1| (Y09476) YitL
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33478"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A150"
FT                   /protein_id="AAK33478.1"
FT                   /translation="MNDLLATVITGLIKEENANDYFIHKEGFTFTLSKAEGERQIGDMV
FT                   TGFAYTDIEQKARLTTKEIRSTRTSYGWGEVTEVRRDLGVFVDTGIPNKEIVVSLDVLP
FT                   EMKELWPKKGDKLYIRLDVDKKDRIWGLPAEPEVFQKMASPAYNNMQNQHWPAIVYRLK
FT                   LTGTFVYLPENNMLGFIHSSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLE
FT                   NDAQMIVTYLEANGGFMTLNDKSSPEEIKASFGISKGQFKKALGGLMKAKRIKQDATGT
FT                   ELIG"
FT   gene            382189..382698
FT                   /gene="msrA.2"
FT                   /locus_tag="SPy_0466"
FT                   /old_locus_tag="SPy0466"
FT   CDS_pept        382189..382698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA.2"
FT                   /locus_tag="SPy_0466"
FT                   /old_locus_tag="SPy0466"
FT                   /product="putative peptide methionine sulfoxide reductase"
FT                   /note="Best Blastp hit = dbj|BAB05167.1| (AP001512) peptide
FT                   methionine sulfoxide reductase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33479"
FT                   /db_xref="GOA:Q9A149"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A149"
FT                   /protein_id="AAK33479.1"
FT                   /translation="MERAIFAGGCFWCMVQPFEEQAGILSVRSGYTGGHLPNPSYEQVC
FT                   AKTTGHTEAVEIIFDPKQIAYKDLVELYWTQTDPTDAFGQFEDRGDNYRPVIYYTTERQ
FT                   KEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNPKRYAQSSAIRHQF
FT                   LEENWS"
FT   gene            382695..382910
FT                   /locus_tag="SPy_0467"
FT                   /old_locus_tag="SPy0467"
FT   CDS_pept        382695..382910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0467"
FT                   /old_locus_tag="SPy0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||A69931 hypothetical protein
FT                   yozE - Bacillus subtilis >gi|2634360|emb|CAB13859.1|
FT                   (Z99114) yozE [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33480"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A148"
FT                   /protein_id="AAK33480.1"
FT                   /translation="MRKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELIS
FT                   RYLEDQASFSFNLGQFDEIWEDYLAH"
FT   gene            383066..384235
FT                   /locus_tag="SPy_0469"
FT                   /old_locus_tag="SPy0469"
FT   CDS_pept        383066..384235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0469"
FT                   /old_locus_tag="SPy0469"
FT                   /product="putative 42 kDa protein"
FT                   /note="Best Blastp hit = gb|AAA51869.1| (U09352) ORF1,
FT                   putative 42 kDa protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33481"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A147"
FT                   /protein_id="AAK33481.1"
FT                   /translation="MIITKKSLFVTSVALSLVPLATAQAQEWTPRSVTEIKSELVLVDN
FT                   VFTYTVKYGDTLSTIAEAMGIDVHVLGDINHIANIDLIFPDTILTANYNQHGQATNLTV
FT                   QAPASSPASVSHVPSSEPLPQASATSQPTVPMAPPATPSDVPTTPFASAKPDSSVTASS
FT                   ELTSSTNDVSTELSSESQKQPEVPQEAVPTPKAAETTEVEPKTDISEAPTSANRPVPNE
FT                   SASEEVSSAAPAQAPAEKEETSAPAAQKAVADTTSVATSNGLSYAPNHAYNPMNAGLQP
FT                   QTAAFKEEVASAFGITSFSGYRPGDPGDHGKGLAIDFMVPENSALGDQVAQYAIDHMAE
FT                   RGISYVIWKQRFYAPFASIYGPAYTWNPMPDRGSITENHYDHVHVSFNA"
FT   gene            384549..386321
FT                   /locus_tag="SPy_0470"
FT                   /old_locus_tag="SPy0470"
FT   CDS_pept        384549..386321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0470"
FT                   /old_locus_tag="SPy0470"
FT                   /product="67 kDa Myosin-crossreactive streptococcal
FT                   antigen"
FT                   /note="Best Blastp hit = gb|AAA51870.1| (U09352) 67 kDa
FT                   Myosin-crossreactive streptococcal antigen [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33482"
FT                   /db_xref="GOA:Q9A146"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A146"
FT                   /protein_id="AAK33482.1"
FT                   /translation="MYYTSGNYEAFATPRKPEGVDQKSAYIVGTGLAGLAAAVFLIRDG
FT                   HMAGERIHLFEELPLAGGSLDGIEKPHLGFVTRGGREMENHFECMWDMYRSIPSLEIPG
FT                   ASYLDEFYWLDKDDPNSSNCRLIHKRGNRVDDDGQYTLGKQSKELIHLIMKTEESLGDQ
FT                   TIEEFFSEDFFKSNFWVYWATMFAFEKWHSAVEMRRYAMRFIHHIDGLPDFTSLKFNKY
FT                   NQYDSMVKPIIAYLESHDVDIQFDTKVTDIQVEQTAGKKVAKTIHMTVSGEAKAIELTP
FT                   DDLVFVTNGSITESSTYGSHHEVAKPTKALGGSWNLWENLAAQSDDFGHPKVFYQDLPA
FT                   ESWFVSATATIKHPAIEPYIERLTHRDLHDGKVNTGGIITITDSNWMMSFAIHRQPHFK
FT                   EQKENETTVWIYGLYSNSEGNYVHKKIEECTGQEITEEWLYHLGVPVDKIKDLASQDYI
FT                   NTVPVYMPYITSYFMPRVKGDRPKVIPDGSVNLAFIGNFAESPSRDTVFTTEYSIRTAM
FT                   EAVYSFLNVERGIPEVFNSAYDIRELLKAFYYLNDKKAIKDMDLPIPALIEKIGHKKIK
FT                   DTFIEELLKDANLM"
FT   gene            386480..387532
FT                   /gene="phoH"
FT                   /locus_tag="SPy_0471"
FT                   /old_locus_tag="SPy0471"
FT   CDS_pept        386480..387532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="SPy_0471"
FT                   /old_locus_tag="SPy0471"
FT                   /product="phosphate starvation-induced protein"
FT                   /note="Best Blastp hit = sp|P46343|PHOL_BACSU PHOH-LIKE
FT                   PROTEIN >gi|7446992|pir||E69676 phosphate
FT                   starvation-induced protein phoH - Bacillus subtilis
FT                   >gi|1303821|dbj|BAA12477.1| (D84432) YqfE [Bacillus
FT                   subtilis] >gi|2634980|emb|CAB14476.1| (Z99117) phosphate
FT                   starvation-induced protein [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33483"
FT                   /db_xref="GOA:Q9A145"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A145"
FT                   /protein_id="AAK33483.1"
FT                   /translation="MQEYSIDITLTHPDDVLALFGSNERHLKLIEAHLGVIVHARTERV
FT                   QVIGDDEEAVELARLTIKALLVLVGRGMVVNTSDVVTALSMAESHQIDQFMALYEEEII
FT                   KDNYGKAIRVKTLGQKTYVDSVKRHDVVFGVGPAGTGKTFLAVTLAVTALKRGQVKRII
FT                   LTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYHILGKEQTTRLMERDVIEIAPLAY
FT                   MRGRTLDDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIVNGDTSQIDLPRNVKSGLIDA
FT                   TQKLQGIKQIDFVYFSAKDVVRHPVVADIIKAYETSSEEMKDLLKPKASDVEADYQPGL
FT                   TKYPVIGQEH"
FT   gene            387578..388153
FT                   /locus_tag="SPy_0472"
FT                   /old_locus_tag="SPy0472"
FT   CDS_pept        387578..388153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0472"
FT                   /old_locus_tag="SPy0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|O86222|Y22A_HAEIN HYPOTHETICAL
FT                   PROTEIN HI0220.2 >gi|3212185|gb|AAC21888.1| (U32707) H.
FT                   influenzae predicted coding region HI0220.2 [Haemophilus
FT                   influenzae Rd]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33484"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A144"
FT                   /protein_id="AAK33484.1"
FT                   /translation="MDDLTKAIMADEANLSYTERGIFPLYDAPQTARIIIVGQAPGIVA
FT                   QGTKLYWNDRSGIRLRDWLGVDNDTFYHSGLFGIIPMDFYYPGKGKSGDLPPREGFAAK
FT                   WHPPLRALMPEVELTILVGRYAQDFYLGNKAYKTLTETVRHFEDYLPDYFPLVHPSPRN
FT                   QLWLAKNPWFEQDLLPILQKRVEAILTK"
FT   gene            388312..388809
FT                   /locus_tag="SPy_0473"
FT                   /old_locus_tag="SPy0473"
FT   CDS_pept        388312..388809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0473"
FT                   /old_locus_tag="SPy0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC38046.1| (AF000954) No
FT                   definition line found [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33485"
FT                   /db_xref="GOA:P67140"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67140"
FT                   /protein_id="AAK33485.1"
FT                   /translation="MYIEMIDETGQVSQEIMEQTLDLLNFAAQKTGKEEKEMSVTFVTN
FT                   ERSHELNLEYRDTDRPTDVISLEYKPETPILFSQEDLAADPSLAEMMAEFDAYIGELFI
FT                   SIDKAREQSQEYGHSFEREMGFLAVHGFLHINGYDHYTLEEEKEMFTLQEEILTAYGLT
FT                   RQ"
FT   gene            388790..389197
FT                   /gene="dgk"
FT                   /locus_tag="SPy_0475"
FT                   /old_locus_tag="SPy0475"
FT   CDS_pept        388790..389197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="SPy_0475"
FT                   /old_locus_tag="SPy0475"
FT                   /product="putative diacylglycerol kinase"
FT                   /note="Best Blastp hit = pir||A36933 diacylglycerol kinase
FT                   homolog - Streptococcus mutans"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33486"
FT                   /db_xref="GOA:Q9A142"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A142"
FT                   /protein_id="AAK33486.1"
FT                   /translation="MALHDNNTTKRKWKNRTITSSLEFALTGVFTAFKEERNLRSHLLS
FT                   ACLACVAGLFFSISAIEWLFLLLAIFLVITLEIVNSAIENVVDLASDYHFSMLAKNAKD
FT                   MAAGAVLMISGYAVLTGLIIFIPKIWNIFVH"
FT   gene            389317..390213
FT                   /gene="era"
FT                   /locus_tag="SPy_0476"
FT                   /old_locus_tag="SPy0476"
FT   CDS_pept        389317..390213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="SPy_0476"
FT                   /old_locus_tag="SPy0476"
FT                   /product="GTP-binding protein (GTPase)"
FT                   /note="Best Blastp hit = gb|AAD41632.1|AF072811_1
FT                   (AF072811) GTPase Era [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33487"
FT                   /db_xref="GOA:P0C0B9"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0B9"
FT                   /protein_id="AAK33487.1"
FT                   /translation="MFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMG
FT                   IYTTETEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDMI
FT                   IERLKAAKIPVILVINKIDKVHPDQLLEQIDDFHSQMDFKEVVPISALEGNNVPTLIKL
FT                   LTDNLEEGFQYFPEDQITDHPERFLVSEMVREKVLHLTQQEVPHSVAVVVESMKRDEET
FT                   DKVHIRATIMVERDSQKGIIIGKQGAMLKKIGKMARRDIELMLGDKVYLETWVKVKKNW
FT                   RDKKLDLADFGYNEKEY"
FT   gene            390233..390709
FT                   /locus_tag="SPy_0477"
FT                   /old_locus_tag="SPy0477"
FT   CDS_pept        390233..390709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0477"
FT                   /old_locus_tag="SPy0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB05612.1| (AP001513) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33488"
FT                   /db_xref="GOA:Q9A141"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A141"
FT                   /protein_id="AAK33488.1"
FT                   /translation="MPQDYISYIRSKVGHDKIILNFAGGILTNDDGKVLMQLRGDKKTW
FT                   TIPGGTMELGESSLETCKREFLEETGIEVEAVRLLNVYTHFEEVYPNGDAVQTIVFIYE
FT                   LTAVSDMAIDNFHNEETLKLQFFSHEEIAELESVSAKHRLMLEEYFSDSFAMGH"
FT   gene            complement(391014..391268)
FT                   /locus_tag="SPy_0478"
FT                   /old_locus_tag="SPy0478"
FT   CDS_pept        complement(391014..391268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0478"
FT                   /old_locus_tag="SPy0478"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33489"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A140"
FT                   /protein_id="AAK33489.1"
FT                   /translation="MSGLFYHKSYFFKSKQVYDLLNEIRMRYPHAHIILIGNHINYEEI
FT                   FKNHYRVFGVIDTTSHKSLRSIRDQIQLYLDELYNSNNG"
FT   gene            391666..391911
FT                   /locus_tag="SPy_0479"
FT                   /old_locus_tag="SPy0479"
FT   CDS_pept        391666..391911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0479"
FT                   /old_locus_tag="SPy0479"
FT                   /product="conserved hypothetical protein-bacteriocin like
FT                   peptide associated"
FT                   /note="Best Blastp hit = emb|CAC03521.1| (AJ276410) BlpJ
FT                   protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33490"
FT                   /db_xref="GOA:Q9A139"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A139"
FT                   /protein_id="AAK33490.1"
FT                   /translation="MIKFAEEIQKEELFHIIGGYSATDCKNHLIGGITSGAIAGGVGAG
FT                   MATLGVGGVAGAFAGAHVGAIAGGLTCVGGMLFNGK"
FT   gene            391926..392108
FT                   /locus_tag="SPy_0480"
FT                   /old_locus_tag="SPy0480"
FT   CDS_pept        391926..392108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0480"
FT                   /old_locus_tag="SPy0480"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33491"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A138"
FT                   /protein_id="AAK33491.1"
FT                   /translation="MDNFLELQFEELVNISGGKGNIGSAIGGCLGGMLIAAAGGPITGG
FT                   AAAFVCVASGIAAYQ"
FT   gene            complement(392433..392985)
FT                   /locus_tag="SPy_0481"
FT                   /old_locus_tag="SPy0481"
FT                   /note="Transposase; IS905-like: There are several sequence
FT                   confirmed mutation within this region inactivating this
FT                   gene."
FT   gene            393532..393732
FT                   /locus_tag="SPy_0484"
FT                   /old_locus_tag="SPy0484"
FT   CDS_pept        393532..393732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0484"
FT                   /old_locus_tag="SPy0484"
FT                   /product="conserved hypothetical protein-bacteriocin like
FT                   peptide associated"
FT                   /note="Best Blastp hit = sp|Q48509|LAFX_LACJO BACTERIOCIN
FT                   LACTACIN F, SUBUNIT LAFX PRECURSOR
FT                   >gi|149570|gb|AAA16637.1| (M57961) role in the expression
FT                   of lactacin F, part of the laf operon [Lactobacillus sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33492"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A137"
FT                   /protein_id="AAK33492.1"
FT                   /translation="MTTMKELTINDMSSISGGNAPGDAVIGGLGGLASGLKFCKLPHPV
FT                   LTGGCVVGFTVGGAYLGYTAN"
FT   gene            394026..394220
FT                   /locus_tag="SPy_0486"
FT                   /old_locus_tag="SPy0486"
FT   CDS_pept        394026..394220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0486"
FT                   /old_locus_tag="SPy0486"
FT                   /product="conserved hypothetical protein-bacteriocin like
FT                   peptide associated"
FT                   /note="Best Blastp hit = sp|Q48509|LAFX_LACJO BACTERIOCIN
FT                   LACTACIN F, SUBUNIT LAFX PRECURSOR
FT                   >gi|149570|gb|AAA16637.1| (M57961) role in the expression
FT                   of lactacin F, part of the laf operon [Lactobacillus sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33493"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A136"
FT                   /protein_id="AAK33493.1"
FT                   /translation="MEVLKNGLAIINGGGKDGANIFLTGMAGAAQGVTVCAQTGVFIPW
FT                   QGYILCGAAGAATNIIWPH"
FT   gene            394713..395708
FT                   /locus_tag="SPy_0488"
FT                   /old_locus_tag="SPy0488"
FT   CDS_pept        394713..395708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0488"
FT                   /old_locus_tag="SPy0488"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33494"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A135"
FT                   /protein_id="AAK33494.1"
FT                   /translation="MRQIQSIRLIDVLELAFGVGYKEETTSQFSSDQPSQVVLYRGEAN
FT                   TVRFAYTNQMSLMKDIRIALDGSDKSLTAQIVPGMGHVYEGFQTSARGIFTMSGVPEST
FT                   VPVANPNVQTKYIRYFKVIDDMHNTMYKGTVFLVQPQAWKYTMKSVDQLPVDDLNHIGV
FT                   AGIERMTTLIKNAGALLTTGGSGAFPDNIKVSINPKGRQATITYGDGSTDIIPPAVLWK
FT                   KGSVKEPTEADQSVGTPTPGIPGKFKRDQSLNEHEAMVNVEPLSHVVKDNIKVIDEKST
FT                   GRFEPFRPNEDEKEKPASDVKVRPAEVGSWLEPATALPSVEMSAEDRLKS"
FT   gene            395753..396199
FT                   /locus_tag="SPy_0489"
FT                   /old_locus_tag="SPy0489"
FT   CDS_pept        395753..396199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0489"
FT                   /old_locus_tag="SPy0489"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33495"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A134"
FT                   /protein_id="AAK33495.1"
FT                   /translation="MEVSSEVAVSASQPEELHRLPNRLIPEEDNNKLSRVAKEVVTEPR
FT                   LNNPFLLPKKVLSLEDDAAILNHLEEDRDVNKLFLEPVAAEAKREINFHPSDQQVTAKV
FT                   KESSDFHQKQHQTGITYGDDTLADLTHHLLHSDGVIPSLNDKSA"
FT   gene            complement(396547..396816)
FT                   /locus_tag="SPy_0492"
FT                   /old_locus_tag="SPy0492"
FT   CDS_pept        complement(396547..396816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0492"
FT                   /old_locus_tag="SPy0492"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33496"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A133"
FT                   /protein_id="AAK33496.1"
FT                   /translation="MTKKQFYLILAISILCFILAVSPKPPILKHTIERKRTAMTIGHSK
FT                   QNPHKKEALKHKKNKNKALFLPSGDSAIKSVISMTVRLLLDDQS"
FT   gene            397887..398753
FT                   /gene="mutR"
FT                   /locus_tag="SPy_0496"
FT                   /old_locus_tag="SPy0496"
FT   CDS_pept        397887..398753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutR"
FT                   /locus_tag="SPy_0496"
FT                   /old_locus_tag="SPy0496"
FT                   /product="putative positive transcriptional regulator"
FT                   /note="Best Blastp hit = gb|AAD04237.1| (AF007761) MutR
FT                   [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33497"
FT                   /db_xref="GOA:Q9A132"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A132"
FT                   /protein_id="AAK33497.1"
FT                   /translation="MEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGESEITC
FT                   SRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDYAHKDY
FT                   ERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYNTLFLL
FT                   TKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRDELNFY
FT                   EKTVFLYVHGYYKLKQEEMSGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLGGKGDE
FT                   DWSEADL"
FT   gene            398925..399752
FT                   /gene="fpg"
FT                   /locus_tag="SPy_0497"
FT                   /old_locus_tag="SPy0497"
FT   CDS_pept        398925..399752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /locus_tag="SPy_0497"
FT                   /old_locus_tag="SPy0497"
FT                   /product="putative formamidopyrimidine-DNA glycosylase"
FT                   /note="Best Blastp hit = sp|P55045|FPG_STRMU
FT                   FORMAMIDOPYRIMIDINE-DNA GLYCOSYLASE (FAPY-DNA GLYCOSYLASE)
FT                   >gi|475032|dbj|BAA05066.1| (D26071) formamidopyrimidine-DNA
FT                   glycosylase [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33498"
FT                   /db_xref="GOA:Q9A131"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A131"
FT                   /protein_id="AAK33498.1"
FT                   /translation="MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVKTDLETFALTL
FT                   PGQIIQSVGRRGKYLLIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTL
FT                   VYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLD
FT                   QTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRT
FT                   YRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRL"
FT   gene            399749..400342
FT                   /locus_tag="SPy_0498"
FT                   /old_locus_tag="SPy0498"
FT   CDS_pept        399749..400342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0498"
FT                   /old_locus_tag="SPy0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|O34932|YTAG_BACSU HYPOTHETICAL
FT                   22.0 KD PROTEIN IN GAPB-MUTM INTERGENIC REGION
FT                   >gi|7449771|pir||A69988 conserved hypothetical protein ytaG
FT                   - Bacillus subtilis >gi|2293275|gb|AAC00353.1| (AF008220)
FT                   YtaG [Bacillus subtilis] >gi|2635371|emb|CAB14866.1|
FT                   (Z99118) similar to hypothetical proteins [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33499"
FT                   /db_xref="GOA:P58102"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58102"
FT                   /protein_id="AAK33499.1"
FT                   /translation="MIIGITGGIASGKSTVVKVIRKAGYQVIDADQVVHDLQEKGGRLY
FT                   EALREAFGNQILKADGELDRTKLSEMLFSNPDNMATSSAIQNQIIKEELAAKRDHLAQS
FT                   QAIFFMDIPLLMELGYQDWFDAIWLVYVDAQTQLQRLMARNRLDKGKARQRIASQLPIE
FT                   EKKPYASLVIDNSGDIAALIKQVQSALLLLANPR"
FT   gene            400532..402034
FT                   /locus_tag="SPy_0500"
FT                   /old_locus_tag="SPy0500"
FT   CDS_pept        400532..402034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0500"
FT                   /old_locus_tag="SPy0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P39342|YJGR_ECOLI HYPOTHETICAL
FT                   54.3 KD PROTEIN IN PEPA-GNTV INTERGENIC REGION (F500)
FT                   >gi|1361112|pir||S56489 hypothetical 54.3K protein
FT                   (pepa-gntv intergenic region) - Escherichia coli
FT                   >gi|537105|gb|AAA97160.1| (U14003) ORF_f500 [Escherichia
FT                   coli] >gi|1790714|gb|AAC77220.1| (AE000497) orf,
FT                   hypothetical protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33500"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A130"
FT                   /protein_id="AAK33500.1"
FT                   /translation="MTTMTIAKGNQPIALQLGMLNRHGLIAGATGTGKTVTLKVLAEQL
FT                   SLAGVPVFLADIKGDLSNLTKAGEVTDKLAARLATIGVSDYQPQAFPVRMWDVFGQNGQ
FT                   PLRTTISELGPMMLSRLLNLNDTQTGVLNIVFKIADEKGWLLIDLKDLQAILKEVGDHA
FT                   SDYSSHYGNIAKQSIGAIQRSLLTLEQEGAHQFFGEPALDVADLMQLDVASGYGAINIL
FT                   SATKLFQSPTLYTTFLLWLLSELYKLLPEVGDLDKPKMVFFFDEAHLLFKDAPKVFLEK
FT                   VEQIVRLIRSKGVGIFFVTQNPLDLPETVLAQLGNRIQHAFRAYTPKEQKAVRVAADTF
FT                   RQNPDLDVARVITELEVGEALISVLNDKGQPSIVERAYIMPPKSSFAVLSEIESQQLVQ
FT                   SSPFASKYSQSIDRESAYEKLAAKVLEDNRLAQEAIATAQREKEAKEAIKAQAATKKAN
FT                   RRSVGRSHKTVVEKATDAFISTTVRTIGRELVRGLLGSLRKR"
FT   gene            402156..403349
FT                   /locus_tag="SPy_0501"
FT                   /old_locus_tag="SPy0501"
FT   CDS_pept        402156..403349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0501"
FT                   /old_locus_tag="SPy0501"
FT                   /product="putative multi-drug resistance efflux pump"
FT                   /note="Best Blastp hit = emb|CAA07482.1| (AJ007367)
FT                   multi-drug resistance efflux pump [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33501"
FT                   /db_xref="GOA:Q9A129"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A129"
FT                   /protein_id="AAK33501.1"
FT                   /translation="MNWRQNLKVAWLGNFFTGASFSLVMPFMALYVENLGTPTELVEYY
FT                   AGLAVAVTALASALFAPVWGKLADRYGRKPMMLRASFVMTFTMGGLAIIPNVFWLLILR
FT                   LLTGVSAGYVPNATALIASQAPKEESGYALGTLATGVTAGALIGPLLGGILAELLGIRQ
FT                   VFLLVGVILFLCSLMTAVYVKEEFKPVRRFEMIPTKVILKQVKSPQIMLGLFVTSMIIQ
FT                   ISAQSVAPILSLYIRHLGQTHNLMFTSGLVVSAMGFSSLFSSSYLGKLGDRFGNHRLLL
FT                   AALCYSFIMYFSSALAQTSFQLGVLRFAYGFGVGALMPSINSLLTKLTPKEGISRVFAY
FT                   NQMFSNLGQVIGPFIGSNVAVVLGYRSVFYVTSLIVFVNLIWSLIIFRKYIKVKDIV"
FT   gene            403538..403774
FT                   /locus_tag="SPy_0502"
FT                   /old_locus_tag="SPy0502"
FT   CDS_pept        403538..403774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0502"
FT                   /old_locus_tag="SPy0502"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33502"
FT                   /db_xref="GOA:Q9A128"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A128"
FT                   /protein_id="AAK33502.2"
FT                   /translation="MYNLLLTILLVLSVLLVIAIFMQPQKNPSSNVFDSSGSEALFERT
FT                   KARGFEAFMQRFTAVLVFFWLAIALVLAILSSK"
FT   gene            403868..406201
FT                   /locus_tag="SPy_0503"
FT                   /old_locus_tag="SPy0503"
FT   CDS_pept        403868..406201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0503"
FT                   /old_locus_tag="SPy0503"
FT                   /product="putative exoribonuclease R"
FT                   /note="Best Blastp hit = sp|O32231|RNR_BACSU RIBONUCLEASE R
FT                   (RNASE R) (VACB PROTEIN HOMOLOG) >gi|7443068|pir||G70027
FT                   conserved hypothetical protein yvaJ - Bacillus subtilis
FT                   >gi|2635874|emb|CAB15366.1| (Z99121) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33503"
FT                   /db_xref="GOA:Q9A127"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A127"
FT                   /protein_id="AAK33503.1"
FT                   /translation="MMKERIMTYLKEHGKSNVNDLAAALEMAGAKHFPSLIKTISKMES
FT                   QSLLRFSDDGSLALRKEREKKKEPTVQGVFRANKAGFGFLHVDENEDDMFIGRNDVGYA
FT                   IDGDTVEVVVKKPADRLKGTAAEAKVVAIVDRSLKTAVGTFILDDDKPKYAGYIRSKNQ
FT                   KIQQKIYIKKEPVVLKGTEIIKVDIDKYPIRGHDYFVASVRDIVGHQGDVGIDVLEVLE
FT                   SMDIVSEFPAEVLAEANAISEAPTAKDLIGRVDLRQETTITIDGADAKDLDDAIHIKLL
FT                   DNGNYELGVHIADVSYYVTEGSALDKEAIARGTSVYVTDRVVPMLPERLSNGICSLNPN
FT                   IDRLTQSALMEINSQGHVVNYQICQSVIKTTYRMTYSTVNDMIAGDEEALQEFASIADD
FT                   VTLMVALHRILEAMRSKRGALNFDTQEAKIIVNDKGMPVDVVLRQRGIAERMIESFMLA
FT                   ANECVAEHFAKAKLPFIYRIHEEPKAEKLQQFIDYASTFGIHIQGTANKISQEALQAFM
FT                   AKVEGQPGAEVLNMMLLRSMQQARYSEHNHGHYGLAAEYYTHFTSPIRRYPDLLVHRMV
FT                   REYNQPSQEKRDHFAQIIPELATSSSQLERRAIDAERVVEAMKKAEYMAEYVGEEFDGI
FT                   VSSVVKFGFFVELPNTIEGLVHITSLPEYYHFNERTLSLQGEKSGKVFKVGQPIRVKLV
FT                   KADKETGDIDFEYLPSDFDVVEKIKMSDKASRRDRRKSSKSSKGTKKKEPKEVAKAKTK
FT                   GKTKKGSKKPFYKEQAKKKSRKRS"
FT   gene            406204..406671
FT                   /locus_tag="SPy_0504"
FT                   /old_locus_tag="SPy0504"
FT   CDS_pept        406204..406671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0504"
FT                   /old_locus_tag="SPy0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAC23745.1| (AF052209) VacB
FT                   homolog [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33504"
FT                   /db_xref="GOA:Q9A126"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A126"
FT                   /protein_id="AAK33504.1"
FT                   /translation="MAKGEGHILAQNKKARHDYHIVETVEAGIVLTGTEIKSVRAARIQ
FT                   LKDGFAQIKNGEAWLVNVHIAPFEQGNIWNADPERTRKLLLKKREITHLANELKGSGMT
FT                   LVPLKVYLKDGFAKVLIGLAKGKHEYDKRETIKRRDQERDIKKQMKHYNAR"
FT   gene            406677..407396
FT                   /locus_tag="SPy_0505"
FT                   /old_locus_tag="SPy0505"
FT   CDS_pept        406677..407396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0505"
FT                   /old_locus_tag="SPy0505"
FT                   /product="putative glutamine cyclotransferase"
FT                   /note="Best Blastp hit = pir||E75557 glutamine
FT                   cyclotransferase - Deinococcus radiodurans (strain R1)
FT                   >gi|6457779|gb|AAF09704.1|AE001874_1 (AE001874) glutamine
FT                   cyclotransferase [Deinococcus radiodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33505"
FT                   /db_xref="GOA:Q9A125"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A125"
FT                   /protein_id="AAK33505.1"
FT                   /translation="MSIMITKGQVRLLRTYSYDSNLYTQGLEQLNNNHILLSAGRYGFS
FT                   KVGVYDLTQEIFSEKIAFPDTVFAEGLTVVEDYFWLLTYKEGVAYKFDKATCNCLGAYP
FT                   FEGDGWGLAYDKENQCLWMTSGNAFLQKRDPKDFALLDTVLVAIESVPISMLNELEYVD
FT                   GYLYANIWQTNTIVKLQPDSGKVVATYDISPLLKALNLDKSHYPDLNVLNGIAHLDQQR
FT                   FLITGKLYPLMLEVVLD"
FT   gene            complement(407512..408159)
FT                   /gene="pcp"
FT                   /locus_tag="SPy_0506"
FT                   /old_locus_tag="SPy0506"
FT   CDS_pept        complement(407512..408159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="SPy_0506"
FT                   /old_locus_tag="SPy0506"
FT                   /product="putative pyrrolidone carboxyl peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="Best Blastp hit = sp|O87765|PCP_LACLC
FT                   PYRROLIDONE-CARBOXYLATE PEPTIDASE (5-OXOPROLYL-PEPTIDASE)
FT                   (PYROGLUTAMYL-PEPTIDASE I) (PGP-I) (PYRASE)
FT                   >gi|3647287|emb|CAA11691.1| (AJ223960) pyrrolidone carboxyl
FT                   peptidase [Lactococcus lactis subsp. cremoris]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33506"
FT                   /db_xref="GOA:P68896"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68896"
FT                   /protein_id="AAK33506.1"
FT                   /translation="MKILVTGFDPFGGEAINPALEAIKKLPATIHGAEIKCIEVPTVFQ
FT                   KSADVLQQHIESFQPDAVLCIGQAGGRTGLTPERVAINQDDARIPDNEGNQPIDTPIRA
FT                   DGKAAYFSTLPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKYCPNAKAGF
FT                   MHIPFMMEQVVDKPNTAAMNLDDITRGIEAAIFAIVDFKDRSDLKRVGGATH"
FT   gene            complement(408209..409135)
FT                   /locus_tag="SPy_0507"
FT                   /old_locus_tag="SPy0507"
FT   CDS_pept        complement(408209..409135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0507"
FT                   /old_locus_tag="SPy0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB56669.1| (AL121596)
FT                   putative membrane protein [Streptomyces coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33507"
FT                   /db_xref="GOA:Q9A124"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A124"
FT                   /protein_id="AAK33507.1"
FT                   /translation="MANIANLVLETIYILIGLQLFHTAYCTFKDKTNPVYFGTALFWGL
FT                   LGVTFVGGAFLPNKVIGFIVIVLALLTLFKQVRIGTLPAFNEQKAEESAHRIGNWIFLP
FT                   VMLMAMISLLLALILPDFSKSAIGIAGILATIAILIITKQKPSALLAENNRMNQQVSTS
FT                   GILPQLLGALGAIFAAAGVGDVIASLIREIVPADSRFFGVLAYVLGMVIFTMIMGNAFA
FT                   AFTVITTGIGVPFVFALGADPIIAGALAMTAGFCGTLLTPMAANFNALPVALMEIKDRN
FT                   AVIKKQAPIALVLIISHIALMYLLAYY"
FT   gene            complement(409135..409818)
FT                   /locus_tag="SPy_0508"
FT                   /old_locus_tag="SPy0508"
FT   CDS_pept        complement(409135..409818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0508"
FT                   /old_locus_tag="SPy0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||H81401 hydrophobic protein
FT                   Cj0552 [imported] - Campylobacter jejuni (strain NCTC
FT                   11168) >gi|6968020|emb|CAB75188.1| (AL139075) hydrophobic
FT                   protein [Campylobacter jejuni]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33508"
FT                   /db_xref="GOA:Q9A123"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A123"
FT                   /protein_id="AAK33508.1"
FT                   /translation="MEWIKLIGIVIIVLGFILKCDAIATVVVAGLVTALVSGISFIDFL
FT                   DILGKEFTNQRLLTIFFITLPLIGLSETYGLKHRATQLIQRVQALTVGRLLTLYLIIRE
FT                   LAGLFSIRLGGHPQFVRPLIQPMGEAAAKANIGEELTDAEKDDIKAMAAANENFGNFFA
FT                   QNTFVGAGGVLLIAGTLEQLGYDGNQAKIAFSSILIAIISIIIVAIYNYLFEKKMERQH
FT                   QKGDN"
FT   gene            complement(410029..410955)
FT                   /locus_tag="SPy_0510"
FT                   /old_locus_tag="SPy0510"
FT   CDS_pept        complement(410029..410955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0510"
FT                   /old_locus_tag="SPy0510"
FT                   /product="putative sugar transferase"
FT                   /note="Best Blastp hit = sp|Q45539|CSBB_BACSU CSBB PROTEIN
FT                   >gi|2126920|pir||JC5173 stress response protein csbB -
FT                   Bacillus subtilis >gi|1387979|gb|AAB38429.1| (L77099) 44%
FT                   identity over 302 residues with hypothetical protein from
FT                   Synechocystis sp, accession D64006_CD; expression induced
FT                   by environmental stress; some similarity to glycosyl
FT                   transferases; two potential membrane-spanning helices
FT                   [Bacillus subtil> >gi|2633183|emb|CAB12688.1| (Z99108)
FT                   stress response protein [Bacillus subtilis]
FT                   >gi|2804544|dbj|BAA24480.1| (D85082) YfhN [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33509"
FT                   /db_xref="GOA:Q9A122"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A122"
FT                   /protein_id="AAK33509.1"
FT                   /translation="MTLLSIIVPCFNEEANILPYFEEMHQLETSMTNQLAFEYIFIDDG
FT                   SKDNTLGILRELAARFPNVHYLSFSRHFGKEAGLLAGLKEAKGNYITVMDVDLQDPPEL
FT                   LPIMYAKLKEGYDIVGTRRQNRQGEPLIRSMCSNLFYGLIKHLSDTEMVNGVRDYRLMT
FT                   RQVVDSILELGEVNRFSKGIFSWVGYRITYLSFENQKRKYGKSRWHFWELLRYSLDGFI
FT                   NFSEMPLTIATWTGTFSFLISIFAILFIIIRKILFGDPVSGWASTVSIILFMGGIQLFC
FT                   MGIIGKYISKIFLETKKRPLYIIKEKH"
FT   gene            complement(411100..411477)
FT                   /gene="gloA"
FT                   /locus_tag="SPy_0511"
FT                   /old_locus_tag="SPy0511"
FT   CDS_pept        complement(411100..411477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="SPy_0511"
FT                   /old_locus_tag="SPy0511"
FT                   /product="putative lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="Best Blastp hit = sp|O33393|LGUL_NEIMA
FT                   LACTOYLGLUTATHIONE LYASE (METHYLGLYOXALASE)
FT                   (ALDOKETOMUTASE) (GLYOXALASE I) (GLX I) (KETONE-ALDEHYDE
FT                   MUTASE) (S-D-LACTOYLGLUTATHIONE METHYLGLYOXAL LYASE)
FT                   >gi|2281946|emb|CAA74673.1| (Y14298) lactoylglutathione
FT                   lyase [Neisseria meningitidis] >gi|7225560|gb|AAF40783.1|
FT                   (AE002390) lactoylglutathione lyase [Neisseria meningitidis
FT                   MC58] >gi|7380768|emb|CAB85359.1| (AL162758)
FT                   lactoylglutathione lyase [Neisseria meningitidis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33510"
FT                   /db_xref="GOA:Q9A121"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A121"
FT                   /protein_id="AAK33510.1"
FT                   /translation="MKALHTCIRVKDLDQSVAFYTSAFPFKENYRKDFPDSQFTLVYLA
FT                   LEGESYELELTYNYGHGDYDLGNGYGHIALGSEHFEADHKKHRQAGFPVTDIKELADKS
FT                   ARYYFIQDPDGYKIEVIDLNN"
FT   gene            complement(411488..412153)
FT                   /locus_tag="SPy_0512"
FT                   /old_locus_tag="SPy0512"
FT   CDS_pept        complement(411488..412153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0512"
FT                   /old_locus_tag="SPy0512"
FT                   /product="putative NAD(P)H-flavin oxidoreductase"
FT                   /note="Best Blastp hit = pir||E81949 probable
FT                   NAD(P)H-flavin oxidoreductase NMA1015 [imported] -
FT                   Neisseria meningitidis (group A strain Z2491)
FT                   >gi|7379717|emb|CAB84284.1| (AL162754) putative
FT                   NAD(P)H-flavin oxidoreductase [Neisseria meningitidis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33511"
FT                   /db_xref="GOA:Q9A120"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="PDB:2HAY"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A120"
FT                   /protein_id="AAK33511.1"
FT                   /translation="MDQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSS
FT                   IGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETASHFILLIAEKHARYDSPAIKNSLLR
FT                   RGIKEGDGLNSRLKLYESFQKEDMDMADNPRALFDWTAKQTYIALGNMMMTAALLGIDT
FT                   CPIEGFHYDKVNHILAKHNVIDLEKEGIASMLSLGYRLRDPKHAQVRKPKEEVISVVK"
FT   gene            complement(412202..413287)
FT                   /gene="pepQ"
FT                   /locus_tag="SPy_0513"
FT                   /old_locus_tag="SPy0513"
FT   CDS_pept        complement(412202..413287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="SPy_0513"
FT                   /old_locus_tag="SPy0513"
FT                   /product="putative XAA-PRO dipeptidase; X-PRO dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="Best Blastp hit = gb|AAD53120.1|AF176799_2
FT                   (AF176799) PepQ [Lactobacillus pentosus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33512"
FT                   /db_xref="GOA:Q9A119"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="PDB:3O5V"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A119"
FT                   /protein_id="AAK33512.1"
FT                   /translation="MTKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLF
FT                   VYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHL
FT                   NVNKFHGLQTIFSGQFNNLTPYVQGMRLVKSADEINKMMIAGQFADKAVQVGFDNISLD
FT                   ATETDVIAQIEFEMKKQGIHKMSFDTMVLTGNNAANPHGIPGTNNIENNALLLFDLGVE
FT                   TLGYTSDMTRTVAVGQPDQFKIDIYNLCLEAQLAAIDFIKPGVTAAQVDAAARQVIEKA
FT                   GYGEYFNHRLGHGIGMDVHEFPSIMAGNDLVLEEGMCFSVEPGIYIPGKVGVRIEDCGH
FT                   VTKNGFEVFTHTPKELLYFEG"
FT   gene            413461..414462
FT                   /gene="ccpA"
FT                   /locus_tag="SPy_0514"
FT                   /old_locus_tag="SPy0514"
FT   CDS_pept        413461..414462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="SPy_0514"
FT                   /old_locus_tag="SPy0514"
FT                   /product="catabolite control protein A"
FT                   /note="Best Blastp hit = dbj|BAA88121.3| (AB028599)
FT                   catabolite control protein A [Streptococcus bovis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33513"
FT                   /db_xref="GOA:Q9A118"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A118"
FT                   /protein_id="AAK33513.2"
FT                   /translation="MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVI
FT                   DRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFSILAKGIDDIAAMYKYNIVLASSDE
FT                   DDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPVVLAGTVDLDHQLPSVNI
FT                   DYRAAVSNVVDILAENHKCIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEA
FT                   NYSYKEGFELAQRVINSGATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVV
FT                   QYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEILLNHGIKKRGTTK"
FT   gene            414593..415591
FT                   /locus_tag="SPy_0515"
FT                   /old_locus_tag="SPy0515"
FT   CDS_pept        414593..415591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0515"
FT                   /old_locus_tag="SPy0515"
FT                   /product="putative sugar transferase"
FT                   /note="Best Blastp hit = gb|AAG19110.1| (AE005009) Vng0600c
FT                   [Halobacterium sp. NRC-1]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33514"
FT                   /db_xref="GOA:Q9A117"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A117"
FT                   /protein_id="AAK33514.1"
FT                   /translation="MKVLLYLEAENYLRKSGIGRAIKHQAKALSLVGQHFTTNPRETYD
FT                   LVHLNTYGLKSWLLMIKAQKAGKKVIMHGHSTEEDFRNSFIFSNLLSPWFKKYLCHFYN
FT                   KADAIITPTLYSKSLIESYGVKSPIFAVSNGIDLEQYGADPKKEAAFRRYFDIKEGEKV
FT                   VMGAGLFFLRKGIDDFVKVAQAMPDVRFIWFGETNKWVIPAQVRQMVNGNHPKNLIFPG
FT                   YIKGDVYEGAMTGADAFFFPSREETEGIVVLEALASRQHLVLRDIPVYYGWVDQSSAEL
FT                   ATDIPGFIEALKKVFSGASNKVEAGYKVAQSRRLETVGHALVDVYKKVMEL"
FT   gene            415593..416927
FT                   /locus_tag="SPy_0516"
FT                   /old_locus_tag="SPy0516"
FT   CDS_pept        415593..416927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0516"
FT                   /old_locus_tag="SPy0516"
FT                   /product="putative glucosyl transferase"
FT                   /note="Best Blastp hit = emb|CAA72250.1| (Y11463) ORF5
FT                   [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33515"
FT                   /db_xref="GOA:Q9A116"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A116"
FT                   /protein_id="AAK33515.1"
FT                   /translation="MRIGLFTDTYFPQVSGVATSIRTLKEELEKEGHEVYIFTTTDRDV
FT                   KRFEDPTIIRLPSVPFVSFTDRRVVYRGLISSYKIAKHYNLDIIHTQTEFSLGLLGKMI
FT                   GKALRIPVVHTYHTQYEDYVSYIANGKIIRPSMVKPLLRGYLKDLDGVICPSRIVLNLL
FT                   EGYEVTIPKRVIPTGIPLEKYIRDDITAEEVTNLKAELGIAGDETMLLSLSRISYEKNI
FT                   QAIINQMPAILAENAKIKLIIVGNGPYLQDLKHLAMQLEVDKHVTFTGMVPHDKVALYY
FT                   KACDFFISASTSETQGLTYIESLASGTPIIAHGNPYLDDVVTDKMFGTLYYAETDLTDA
FT                   IIDAILKTPVMDKRLLAKKRYEISAQHFGKSIYTFYLDTLIARNSKEAQKLSLYLNHSG
FT                   KSSSLKLVQGAIHLPKRAAKVTAITSVKVVKAPIKLVHAIKDFLD"
FT   gene            417349..419292
FT                   /gene="thrS"
FT                   /locus_tag="SPy_0517"
FT                   /old_locus_tag="SPy0517"
FT   CDS_pept        417349..419292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="SPy_0517"
FT                   /old_locus_tag="SPy0517"
FT                   /product="putative threonyl-tRNA synthetase 1"
FT                   /EC_number="6.1.1.3"
FT                   /note="Best Blastp hit = dbj|BAB06860.1| (AP001517)
FT                   threonyl-tRNA synthetase 1 [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33516"
FT                   /db_xref="GOA:Q9A115"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A115"
FT                   /protein_id="AAK33516.1"
FT                   /translation="MIKITFPDGAVREFESGVTTFDIAESISKSLAKKALAGKFNDQLI
FT                   DTTRAIEEDGSIEIVTPDHKDAYEVLRHSAAHLFAQAAKRLFPNLHLGVGPAIAEGFYY
FT                   DTDNAEGQISNEDLPRIEAEMQKIVTENYPCIREEVTKEEALELFKDDPYKVELINEHA
FT                   GAGLTVYRQGEFVDLCRGPHVPSTGRIQVFHLLNVAGAYWRGNSDNNMMQRIYGTAWFD
FT                   KKDLKAYLTRLEEAKERDHRKLGKELDLFMISQEVGQGLPFWLPDGATIRRTLERYITD
FT                   KELASGYQHVYTPPLASVELYKTSGHWDHYQEDMFPVMDMGDGEEFVLRPMNCPHHIQV
FT                   YKNHVRSYRELPIRIAELGMMHRYEKSGALSGLQRVREMTLNDGHIFVTPEQIQEEFQR
FT                   ALQLIIDVYADFNLTDYRFRLSYRDPNDTHKYYDNDEMWENAQSMLKAALDEMGVDYFE
FT                   AEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMIHRG
FT                   VISTMERFTAILIETYKGAFPTWLAPHQVTVIPISNEAHIDYAWEVAKTLRDRGVRADV
FT                   DDRNEKMQYKIRASQTSKIPYQLIVGDKEMEDKSVNVRRYGSKTTHTESVEEFVENILA
FT                   DIARKSRPDAQA"
FT   gene            419433..420425
FT                   /locus_tag="SPy_0518"
FT                   /old_locus_tag="SPy0518"
FT   CDS_pept        419433..420425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0518"
FT                   /old_locus_tag="SPy0518"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="Best Blastp hit = pir||G75548 ABC transporter,
FT                   ATP-binding protein - Deinococcus radiodurans (strain R1)
FT                   >gi|6457873|gb|AAF09790.1|AE001882_8 (AE001882) ABC
FT                   transporter, ATP-binding protein [Deinococcus radiodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33517"
FT                   /db_xref="GOA:Q9A114"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A114"
FT                   /protein_id="AAK33517.2"
FT                   /translation="MVMIEVSHLQKNFSKTIKEPGLKGALKSFVHPQREIFEAVKDLSF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGYCRINGKIPQDNRQYYVRDIGAVFG
FT                   QRTQLWWDLALQETYVVLKEIYDVPEKAFRKRMDFLNEVLDLNEFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIIMIDKGQEIFDGTVTQLKQSFGKMKSLSFELKPGQEQVVSQFMGLPDITVERHE
FT                   LSLDIQYDSSRYQTADIIQKTMADFAVRDVKMTDVDIEDIVRRFYRKEL"
FT   gene            420427..421245
FT                   /locus_tag="SPy_0519"
FT                   /old_locus_tag="SPy0519"
FT   CDS_pept        420427..421245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0519"
FT                   /old_locus_tag="SPy0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB88837.1| (AL353832)
FT                   putative integral membrane protein. [Streptomyces
FT                   coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33518"
FT                   /db_xref="GOA:Q9A113"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A113"
FT                   /protein_id="AAK33518.1"
FT                   /translation="MWSFWKRYRPFLSAGIQELITYRVNFFLYRIGDVMGAFVAYYLWK
FT                   AVFDSSKQSLINGFTLSDMTFYIIMSFVTTLLTKSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFMEIGFRWIVLMSVGFPFLMVLSGIKVMAGLSILQVLASSCLYLVSLLLAFLI
FT                   NFYFNICFGSSAFVFKNLWGSNLLKNALVAFMSGSLIPLAFFPKMVSIVLSFLPFSSLV
FT                   YTPVMIVIGKYSLSQIMVALSLQIFWLLVMVVLSQVIWKKVQYHLTIQGG"
FT   gene            421247..422032
FT                   /locus_tag="SPy_0521"
FT                   /old_locus_tag="SPy0521"
FT   CDS_pept        421247..422032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0521"
FT                   /old_locus_tag="SPy0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB88836.1| (AL353832)
FT                   putative integral membrane transport protein. [Streptomyces
FT                   coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33519"
FT                   /db_xref="GOA:Q9A112"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A112"
FT                   /protein_id="AAK33519.1"
FT                   /translation="MAKLRCMHAIFIKQYLKQIMEYKVDFVVGVLGVFLTQGLNLLFLS
FT                   VLFQHIPSLEGWTFEQIAFIYGFCLIPKGIDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   SPLFHVLVETFQVDALGELLVGVILLVTTAGSIVWTLPKVLLFILVIPFATLIYTSLKI
FT                   ATASISFWTKQSGAVIYIFYMFNDFSKYPMSIYHSFLRWLISFIIPFAFTAYYPASYFL
FT                   TGQHLLFNIGGLVVVSLLVLALSLKLWKWGLDAYESAGS"
FT   gene            422777..423925
FT                   /locus_tag="SPy_0524"
FT                   /old_locus_tag="SPy0524"
FT   CDS_pept        422777..423925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0524"
FT                   /old_locus_tag="SPy0524"
FT                   /product="putative acetyl-CoA c-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Best Blastp hit = dbj|BAB03328.1| (AB035449)
FT                   acetyl-CoA c-acetyltransferase [Staphylococcus aureus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33520"
FT                   /db_xref="GOA:Q9A111"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A111"
FT                   /protein_id="AAK33520.1"
FT                   /translation="MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPI
FT                   DQVICGNTVGTGGNIGRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASN
FT                   LLVGGIESSSLQPESVYASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEY
FT                   LNHWTLRSHQKASYCQEQALLADLILDLSGASDQGIRPRLSSKVLSKVPPILGEGHVIS
FT                   AANACLTHDAAAFLQLSSQPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMAD
FT                   MTAIEWNEAFAVIDGLFETHYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIK
FT                   NGRYGIAAIAAAGGQGFAVLLKYHKEFSHADKARILGKAMPK"
FT   gene            423882..425129
FT                   /locus_tag="SPy_0526"
FT                   /old_locus_tag="SPy0526"
FT   CDS_pept        423882..425129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0526"
FT                   /old_locus_tag="SPy0526"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||A69832 probable acid-CoA
FT                   ligase (EC 6.2.1.-) yhfT [similarity] - Bacillus subtilis
FT                   >gi|2226256|emb|CAA74543.1| (Y14084) hypothetical protein
FT                   [Bacillus subtilis] >gi|2633372|emb|CAB12876.1| (Z99109)
FT                   similar to long-chain fatty-acid-CoA ligase [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33521"
FT                   /db_xref="GOA:Q9A110"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A110"
FT                   /protein_id="AAK33521.1"
FT                   /translation="MLTKLEYWAKQCPNKKAIVADQISLTYQELWQAVLIKDQTIKDSV
FT                   PYIISHSRYLNQLLSFLRGLKEGSCPIILHPNISGTFQQQIKHVDGELLKKADFAVLSS
FT                   GTTGKAKLFWRRLSTWTRLFDYQNKVFGMTGNSCLFLHGSFSFTGNLNLALAQLWAGGC
FT                   LVLSQKLSLKTWLSLWQAKKVSHLYLLPTYLNRLLPYLTKNNMTATHLLTSSQMISQEL
FT                   LRHYYKKFPQLEIVIFYGASELSFITWCNGRAAVKINGLVGQPFPDVSISFKDKEIFVE
FT                   TPYSVEGMSQPYSVSDLGKMSPAGLILEGRQDDWVNQRGVKCHLPSLVELAHQAPNVKE
FT                   AHALKIGKGENETLILVLVLTKKDCLAPIKDFLALYLNSGQLPKYYLVIDCLPLKDNGK
FT                   INREVLLNKIPKQWLS"
FT   gene            425224..426219
FT                   /locus_tag="SPy_0527"
FT                   /old_locus_tag="SPy0527"
FT   CDS_pept        425224..426219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0527"
FT                   /old_locus_tag="SPy0527"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33522"
FT                   /db_xref="InterPro:IPR021462"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A109"
FT                   /protein_id="AAK33522.1"
FT                   /translation="MKQAILDRYQALKCYQNAGLSNQAFRAIAKEPIIDNRLGSPTFWV
FT                   IWPIEKENQSAKQLLTFLLDLVEMPFELSGQLHETQTLLTRFHPSLLPDHMFWKELASL
FT                   VDQAFPGKTLSQAGELEKRLHQFRYVISSQQAQSIRNHYKMIEMTDAQALALFLRSKKG
FT                   PCLWRQAPDYTLMDSARLHNKLRFEDNKVIFPSQEVSYNIKVLLWFHTEFTLDSTGFFL
FT                   NEVDAEVVTEKGIVNGASFNYGTDGPRHWDLDVDPISHHDPQFRRDTLKGFRSPKRVFR
FT                   QWFRAQKDDFMFSYFNAKGLFAYHNKSSFARVKKSAKQFKRQIHPIKGWF"
FT   gene            426381..427091
FT                   /gene="vicR"
FT                   /locus_tag="SPy_0528"
FT                   /old_locus_tag="SPy0528"
FT   CDS_pept        426381..427091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /locus_tag="SPy_0528"
FT                   /old_locus_tag="SPy0528"
FT                   /product="two-component response regulator"
FT                   /note="Best Blastp hit = emb|CAB65451.1| (AJ012051) VicR
FT                   protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33523"
FT                   /db_xref="GOA:Q9A108"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A108"
FT                   /protein_id="AAK33523.1"
FT                   /translation="MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK
FT                   PDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFS
FT                   NRELLARVKAHLRRTETIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVELTH
FT                   REFELLHHLANHMGQVMTREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYI
FT                   LTRRGVGYYMKSYD"
FT   gene            427084..428436
FT                   /gene="vicK"
FT                   /locus_tag="SPy_0529"
FT                   /old_locus_tag="SPy0529"
FT   CDS_pept        427084..428436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicK"
FT                   /locus_tag="SPy_0529"
FT                   /old_locus_tag="SPy0529"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="Best Blastp hit = emb|CAB65452.1| (AJ012051) VicK
FT                   protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33524"
FT                   /db_xref="GOA:Q9A107"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A107"
FT                   /protein_id="AAK33524.1"
FT                   /translation="MTRDIIGNLSTFELAILILLVFVAFYFIHLAVRDYRNARIIRMMS
FT                   HKIRDLINGRYTDIIDEKADIELMELSDQLNDLSDVFRLTHENLAQEKNRLASILAYMS
FT                   DGVLATDRSGKIIMINETARKQLNLSKEEALKKNITDLLEGDTSYTYRDLVSKTPVVTV
FT                   NSRNDMGEFVSLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRT
FT                   PLTSVKSYLEALDEGALKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTQLAVE
FT                   MTNFTAFITSILNRFDLVKNQHTGTGKVYEIVRDYPITSVWIEIDNDKMTQVIENILNN
FT                   AIKYSPDGGKITVRMKTTDTQLIISISDQGLGIPKTDLPLIFDRFYRVDKARSRAQGGT
FT                   GLGLAIAKEIIKQHHGFIWAKSDYGKGSTFTIVLPYEKDAAIYEEWEEDVD"
FT   gene            428440..429249
FT                   /gene="vicX"
FT                   /locus_tag="SPy_0530"
FT                   /old_locus_tag="SPy0530"
FT   CDS_pept        428440..429249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicX"
FT                   /locus_tag="SPy_0530"
FT                   /old_locus_tag="SPy0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB65453.1| (AJ012051) VicX
FT                   protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33525"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A106"
FT                   /protein_id="AAK33525.1"
FT                   /translation="MNESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLA
FT                   EIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLDIYANEKTWQLMDECNMLGKLDASQ
FT                   KHIFQRDKVLTFGDVDIESFGVSHDAIDPQFYRIMKDNKSFVMLTDTGYVSDRMTGIIE
FT                   NADGYLIESNHDIEILRSGSYPWSLKQRILSDLGHLSNEDGAGAMIRSLGYNTKKIYLG
FT                   HLSKENNIKELAHMTMVNQLAMADLAVGTDFTVHDTSPDTACPLTDI"
FT   gene            429693..430385
FT                   /gene="acpA"
FT                   /locus_tag="SPy_0531"
FT                   /old_locus_tag="SPy0531"
FT   CDS_pept        429693..430385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="SPy_0531"
FT                   /old_locus_tag="SPy0531"
FT                   /product="putative ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="Best Blastp hit = sp|P51833|RNC_BACSU RIBONUCLEASE
FT                   III (RNASE III) >gi|7435219|pir||B69693 ribonuclease III
FT                   (EC 3.1.26.3) - Bacillus subtilis
FT                   >gi|2633965|emb|CAB13466.1| (Z99112) ribonuclease III
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33526"
FT                   /db_xref="GOA:P66670"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66670"
FT                   /protein_id="AAK33526.1"
FT                   /translation="MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNER
FT                   LEFLGDAVLQLIISEYLFAKYPKKTEGDMSKLRSMIVREESLAGFSRFCSFDAYIKLGK
FT                   GEEKSGGRRRDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQVEKGNFERVKDYKT
FT                   CLQEFLQTKGDVAIDYQVISEKGPAHAKQFEVSIVVNGAVLSKGLGKSKKLAEQDAAKN
FT                   ALAQLSEV"
FT   gene            430386..433925
FT                   /gene="smc"
FT                   /locus_tag="SPy_0532"
FT                   /old_locus_tag="SPy0532"
FT   CDS_pept        430386..433925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="SPy_0532"
FT                   /old_locus_tag="SPy0532"
FT                   /product="putative chromosome segregation SMC protein"
FT                   /note="Best Blastp hit = sp|P51834|SMC_BACSU CHROMOSOME
FT                   PARTITION PROTEIN SMC >gi|7446600|pir||G69708 chromosome
FT                   segregation SMC protein - Bacillus subtilis
FT                   >gi|2633966|emb|CAB13467.1| (Z99112) chromosome segregation
FT                   SMC protein homolog [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33527"
FT                   /db_xref="GOA:Q9A104"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A104"
FT                   /protein_id="AAK33527.1"
FT                   /translation="MFLKEIELEGFKSFADKTKIEFDKGVTAVVGPNGSGKSNITESLR
FT                   WALGESSAKNLRGGKMPDVIFAGTQNRNPLNYAKVAVVLDNSDHFIKTAKKEIRVERHI
FT                   YRNGDSDYLIDGRKVRLRDIHDLFMDTGLGRDSFSIISQGRVEEIFNSKPEERRAIFEE
FT                   AAGVLKYKTRKKETQIKLNQTQDNLDRLEDIIYELDTQLAPLEKQAKVAKQFLELDANR
FT                   KQLQLDILVKDIDIAQERQTKDTEALAALQQDLASYYAKRQSMEEDYQKFKQKKQVLSQ
FT                   ESDQTQTTLLELTKLIADLEKQIELVKLESGQEAEKKAEAKKHLEQLQEQLDGFQAEEK
FT                   QCTEQLLHIDQQLCDVKQQLNELSNALERFSSDPDQLMETLREEFVLLMQKEAALSNQL
FT                   TALKAHLDKEKQARQHKAQEYQLLVTKLDQLNDESQKAQAHYKAQKEQVEMLLQNYQEG
FT                   DKRVQELERDYQLNQERLFDLLDQKKGKEARKASLESIQKSHSQFYAGVRAVLQSQKKL
FT                   GGIIGAVSEHLSFDSDYQTALEVALGANSQHIIVTDEAAAKRAIAYLKKNRQGRATFLP
FT                   LTTIKARSLSEHYHRQLATCEGYLGTAESLIRYDDSLSAIIQNLLSSTAIFETIDQANI
FT                   AARLLGYKVRIVTLDGTELRPGGSFSGGANRQSNTTFIKPELEQISEELTRLVEQLKIT
FT                   EKEVAALQSDLIAKKEELTQLKLAGDQARLAEQRAQMAYQQLQEKQEDSKALLAALDQS
FT                   QTTHSDESLLAEQARIEEALTAIAKKKNALTCDIDDIKENKDLIRQKTQNIHQALSQAR
FT                   LQERDLLNEKKFEQANQSRLRTQLKQCQQNILKLESILNNNVSQDSIQRLPQWQKQLQD
FT                   ATEHKSGAQKRLVQLRFEIEDYEARLEETAEKITKESEKNDTFIRRQTKLETHLEQVAN
FT                   RLRAYAKSLSEDFQMTLADAKEVTNSIDHLESAKEKLHHLQKTIRALGPINSDAINQYE
FT                   EVHERLTFLTSQKTDLTKAKNLLLETINSMDSEVKARFKVTFEAIQKSFKETFTQMFGG
FT                   GSADLVLTETDLLSAGIEISVQPPGKKIQSLNLMSGGEKALSALALLFAIIRVKTIPFV
FT                   ILDEVEAALDEANVKRFGDFLNRFDKDSQFIVVTHRKGTMAAADSIYGITMQESGVSKI
FT                   VSVKLKEAQEMTN"
FT   gene            complement(434178..435029)
FT                   /locus_tag="SPy_0533"
FT                   /old_locus_tag="SPy0533"
FT   CDS_pept        complement(434178..435029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0533"
FT                   /old_locus_tag="SPy0533"
FT                   /product="putative positive regulator"
FT                   /note="Best Blastp hit = gb|AAD04237.1| (AF007761) MutR
FT                   [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33528"
FT                   /db_xref="GOA:Q9A103"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A103"
FT                   /protein_id="AAK33528.1"
FT                   /translation="MKSKLGATLRKVRKGKQISLCFVADEHLSKSQISRFERGESEISC
FT                   IRLINILDKLHITLDEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIACLLSDTSD
FT                   YTLNSFEKTMVKSILHTMDSSIIPSDDELLQLTDYLFKVEKWGYYEILLLGNCVRTINY
FT                   NSYFLLTKEMLNNYIYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLIDEIKTLLD
FT                   NELNFYEQTVFLYATGYFEFKRQLETGVEKMKQAIQVLDILNEDKLKLHYADHFDKLVN
FT                   KD"
FT   gene            435249..436175
FT                   /gene="aroE.2"
FT                   /locus_tag="SPy_0534"
FT                   /old_locus_tag="SPy0534"
FT   CDS_pept        435249..436175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE.2"
FT                   /locus_tag="SPy_0534"
FT                   /old_locus_tag="SPy0534"
FT                   /product="putative shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="Best Blastp hit = sp|Q58484|AROE_METJA SHIKIMATE
FT                   5-DEHYDROGENASE >gi|2129280|pir||C64435 shikimate
FT                   5-dehydrogenase (EC 1.1.1.25) - Methanococcus jannaschii
FT                   >gi|1591730|gb|AAB99086.1| (U67551) shikimate
FT                   5-dehydrogenase (aroE) [Methanococcus jannaschii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33529"
FT                   /db_xref="GOA:Q9A102"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A102"
FT                   /protein_id="AAK33529.2"
FT                   /translation="MLVLYVSSKLIKRRRMKFMYSALLGNPVEHSISDELFEYLNHNIG
FT                   VLDEYKHKKILVDSVCLEDKIKHLINDPKCIGLNITLPYKREVMRYIDNLDRVAEITGS
FT                   VNNIYKSGNIITGTNTDWKGIYNTLVFFNISHITKCCVLGTGGTARAAIFTLQKLQISP
FT                   TVVYREPISENTRSLIKSFPDLKYITYKELADQQILNDMEIIINTTPVGMINYEESLPI
FT                   NFDHLDNVNYKDKYFMDVVFNPLHTKLHEYFGKKGAKIIDGLWVLIFQGIEAFSLWSDK
FT                   INDGKYFFSKDDVVLIHTFLEGKIKGK"
FT   gene            436172..437008
FT                   /locus_tag="SPy_0535"
FT                   /old_locus_tag="SPy0535"
FT   CDS_pept        436172..437008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0535"
FT                   /old_locus_tag="SPy0535"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = sp|Q58707|YD11_METJA HYPOTHETICAL
FT                   PROTEIN MJ1311 >gi|2128782|pir||F64463 hypothetical protein
FT                   MJ1311 - Methanococcus jannaschii
FT                   >gi|1591950|gb|AAB99318.1| (U67571) conserved hypothetical
FT                   protein [Methanococcus jannaschii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33530"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A101"
FT                   /protein_id="AAK33530.1"
FT                   /translation="MTFHITVNLDEISDKLDDSLKFLNRLSIKSCELRMINTKNIIQLS
FT                   DAELINLKERLQKYNITPISIASPLFKWNIEENHLESNLDLYGISANVTLNEQWLYVRK
FT                   IIFIAKFLNIKYVRIFGGIGCSVDDFLNNELFLNLLKETEIIFLIENELGTSVSTADDL
FT                   LKIGHFIDEKSIKNLKIWFDIANYYIVEPQVDKVIPKLKKYIYYIHCKNYVNNDLGIHY
FT                   VELGKGIIDYKTIIHEIHEHFIDLIFSLEVHEKEIDKKAEVVRKSYLTLNEYINGG"
FT   gene            437010..437744
FT                   /locus_tag="SPy_0536"
FT                   /old_locus_tag="SPy0536"
FT   CDS_pept        437010..437744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0536"
FT                   /old_locus_tag="SPy0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||H69002 conserved hypothetical
FT                   protein MTH1019 - Methanobacterium thermoautotrophicum
FT                   (strain Delta H) >gi|2622121|gb|AAB85515.1| (AE000874)
FT                   conserved protein [Methanobacterium thermoautotrophicum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33531"
FT                   /db_xref="GOA:Q9A100"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A100"
FT                   /protein_id="AAK33531.1"
FT                   /translation="MNLSIFGLKNIPYLKEGDSIEKLIEESIKTSEFFIEDNDVLCIAS
FT                   KVVSIAEGQVMSLNEIQVSDVAKEIHRNIPRKDPRIIEIMLNLVNRDLSRLDIKKNYIG
FT                   CRLENGLKLTSGGIDRKSVDEVFLLPNNPDASAKRISEYLKKSLGKNVAVVITDSDGRE
FT                   DKRGATQVAIGIYGIHPLRKTEVIDSQGETIKFQEETLCDMIAACAGLVMGQRGTGIPA
FT                   VLIRGLDYKWSENTSIKEALNE"
FT   gene            437737..438723
FT                   /locus_tag="SPy_0537"
FT                   /old_locus_tag="SPy0537"
FT   CDS_pept        437737..438723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0537"
FT                   /old_locus_tag="SPy0537"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB39036.2| (AL034559)
FT                   ATP-dependent RNA Helicase [Plasmodium falciparum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33532"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z9"
FT                   /protein_id="AAK33532.1"
FT                   /translation="MSRNQDCKNILIIGFGKIGKIKAYKWLSRGYEVYVKDLKFSSMKY
FT                   LNTNSDVLDDLSRQYFTIEICTPTNHHLTLLKTVITRYVYSYISIEKPLCNRLEDLEEM
FT                   KSLVESHPHLAKKIFASEQYFFSKILEKLLQVDCFSLDKIKEITVDFSKDRIEDNENGR
FT                   FLDKEILGYGIEIPHIIAVISYLGISLEEFKKGIFVNAIYIKDLEKHDYSIEILSCINQ
FT                   TVIKIISNLGSFAIREGKIEGGDAKTVRRVTIDDKTILFDPHPKLERYKSELVTGTNTF
FT                   QIHDDMMDTYISLLEGNAIPEDCYINNAIEITKLLINLYSECEKIYL"
FT   gene            438733..439932
FT                   /locus_tag="SPy_0538"
FT                   /old_locus_tag="SPy0538"
FT   CDS_pept        438733..439932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0538"
FT                   /old_locus_tag="SPy0538"
FT                   /product="putative S-adenosylmethionine synthetase"
FT                   /note="Best Blastp hit = sp|Q58605|METK_METJA
FT                   S-ADENOSYLMETHIONINE SYNTHETASE (METHIONINE
FT                   ADENOSYLTRANSFERASE) (ADOMET SYNTHETASE)
FT                   >gi|2129088|pir||G64450 isoleucine-tRNA ligase 5' region
FT                   hypothetical protein 401 homolog - Methanococcus jannaschii
FT                   >gi|1591838|gb|AAB99212.1| (U67562) conserved hypothetical
FT                   protein [Methanococcus jannaschii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33533"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66768"
FT                   /protein_id="AAK33533.1"
FT                   /translation="MDLKITNGFYDPSHLSYEVVERKGLGHPDTLADGIAEQIEIDYSL
FT                   YCLDKFGVIPHHNFDKIIIRGGHSVQDFGGSDFIEPIKIIFLGRASKKCFNSSIPLFKI
FT                   QKKAATKYLNRILPNLDVENYVEFETLTSDFTTKTNWFSPEAIEDLPEYLDVPKANDTA
FT                   TMISYWPLTISEELALMIEGYFYKLDKNELPTPRFTKMGGDIKVMVVRNDLEYSIRINF
FT                   PLISKFFNNDIESQLYVDKHVEKIKKYIEQKYKNISFSIDYHYYLTTTGSCIDFGEEGA
FT                   VGRGNKTHGIISSFRPNTMEAPAGKNCTYFVGKVWGFLSDTIAKEIYEAFNTPCQIIMQ
FT                   LNIGSKLYRPTHLFIQTEESVDQERVLEIVNRHLNNGKQNTNLILSTQHFIPKTNVYDG
FT                   "
FT   gene            439916..440884
FT                   /locus_tag="SPy_0539"
FT                   /old_locus_tag="SPy0539"
FT   CDS_pept        439916..440884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0539"
FT                   /old_locus_tag="SPy0539"
FT                   /product="hypothetical gene"
FT                   /note="Best Blastp hit = gi|10954876 Hypothetical gene
FT                   [Agrobacterium tumefaciens] >gi|6498229|dbj|BAA87681.1|
FT                   (AB016260) Hypothetical gene [Agrobacterium tumefaciens]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33534"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z7"
FT                   /protein_id="AAK33534.1"
FT                   /translation="MSMMDKTVLYFGLVEISFDVPDFIFQKIKEQNNKIRYYSKSINIL
FT                   GSVKFINSNQQFIEYDGNGNILVYGRLKYFKEGISLYYIGEYLAECLLIEHSDTLLIHA
FT                   AAVYNPLSGHSILLLGDKGAGKTTVAIRLCIEHGYHLIGNDQVIFGSNSGILLTYAGTS
FT                   FFKIRRTAVLSDNLLFKLFSKFFNRSLQFNKASWDDKISIFPKELGIRTCNFSTEISKI
FT                   YYIKTDKKEKQIYHSIWSDSLASLYLNELLGRHISGQVACFQSDNGKYFSTMPLINYEK
FT                   NNRVREQIVKGIFAKQKLFKITAATPAKIAEAIIENVKKNS"
FT   gene            440939..441928
FT                   /locus_tag="SPy_0540"
FT                   /old_locus_tag="SPy0540"
FT   CDS_pept        440939..441928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0540"
FT                   /old_locus_tag="SPy0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||F72278 conserved hypothetical
FT                   protein - Thermotoga maritima (strain MSB8)
FT                   >gi|4981783|gb|AAD36304.1|AE001779_6 (AE001779) conserved
FT                   hypothetical protein [Thermotoga maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33535"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z6"
FT                   /protein_id="AAK33535.1"
FT                   /translation="MFVIGIPTLNEADNISRLVKQIDEYAVNLGKEIIIINSDSKSTDG
FT                   TPQIFLETKTYNTKVSIVSEAKGKGYNVRNIFEYAINHVPNFSGLILIDGDVVSMKKMW
FT                   LEKMFIAIESGNDLIIPNYARKSFEGNATNHFIYPMLVKIFKRDMPYQCISGDFGFSRG
FT                   LIKDLTLKCNWHKYTLGYGIDIFLTLTAILKSYKIKEIDLQSKIHKKSFEKIEKIFLEV
FT                   SQSFFETINDNSLNQDKLRLNINFESHSRQFIKSSDILSSNDIENLKLRALFLLQEEKQ
FT                   YLHGLSEVEWDGILSNTINNIYRYSSEEHSLYLLPLYLLRVYNYLKYN"
FT   gene            442621..443778
FT                   /locus_tag="SPy_0542"
FT                   /old_locus_tag="SPy0542"
FT   CDS_pept        442621..443778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0542"
FT                   /old_locus_tag="SPy0542"
FT                   /product="putative nucleotide sugar dehydrogenase"
FT                   /note="Best Blastp hit = dbj|BAB07427.1| (AP001519)
FT                   nucleotide sugar dehydrogenase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33536"
FT                   /db_xref="GOA:Q9A0Z5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z5"
FT                   /protein_id="AAK33536.2"
FT                   /translation="MKITVVGIGYVGLSIGLLLAKEHDVTFFDIDNKKIDLINKRQSPL
FT                   KEAAINKLLCKAKNINATSSEELAYKDATFIILSLPTNLKFNKLDTSIIEISVSNILKI
FT                   NKKATIVIKSTVPIGFTEYLRNRFHYNDIIFSPEFLREGSTIHDQLYPSRTIVGNESRN
FT                   SQLFLDILTDISVEKDSPSLLVGSSEAEAIKLFSNAYLAQKIAFFNELDTFAEMQNLDS
FT                   KKIIEAMGYDQRIGNSHNNPSFGFGGYCLPKDIKQLEYHFKEIPAPIITSISESNLLRK
FT                   IHIAKMILNSSAKTIGIYRINSKKDSDNCRESSTIDVAKLLKSSGKDVIIFEPLINQKK
FT                   FLGCPLINDFNEFIKYSDIIVANRIDDALRKCNSKVFTRDIFQYD"
FT   gene            443863..445071
FT                   /locus_tag="SPy_0543"
FT                   /old_locus_tag="SPy0543"
FT   CDS_pept        443863..445071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0543"
FT                   /old_locus_tag="SPy0543"
FT                   /product="putative efflux protein"
FT                   /note="Best Blastp hit = pir||H72265 hypothetical protein
FT                   TM1336 - Thermotoga maritima (strain MSB8)
FT                   >gi|4981896|gb|AAD36408.1|AE001788_3 (AE001788) permease,
FT                   putative [Thermotoga maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33537"
FT                   /db_xref="GOA:Q9A0Z4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z4"
FT                   /protein_id="AAK33537.1"
FT                   /translation="MNNRKKNIQYLVYSKVIYRIGDVMFDFANNTFLAGLNPASLSLVA
FT                   VYQSLESVIGVLFNLFGGVIADSFKRKKIIITTNILCGTACLVLSFLTKEQWLVYAIVL
FT                   TNVILAFMSAFSSPSYKAFTKEIVKKDSISQLNSLLETTSTVIKVTVPMVAIFLYKLLG
FT                   IHGVLLLDGLSFLIAALLISFILPVNDEVVIKEKVTIREIFNDLKIGFKYVYSHKSIFI
FT                   ITVLSALVNFFLAAYNLLLPYSNQMFGEISTGLYGTFLTAEAIGGFIGAILSGFVNKEL
FT                   SSMRLILFLSLSGLMLMLAPPFYIMFHNAIILALSPALFSLFLSIFNIQFFSLVQKDVD
FT                   NDFLGRVFGIIFTITILFMPIGTGFFSVALNPNNSFNLFIIGSCITTLSLVFRILFKKY
FT                   NIR"
FT   gene            complement(445174..445383)
FT                   /locus_tag="SPy_0544"
FT                   /old_locus_tag="SPy0544"
FT   CDS_pept        complement(445174..445383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0544"
FT                   /old_locus_tag="SPy0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB58317.1| (AL121855)
FT                   putative transcriptional regulator [Streptomyces coelicolor
FT                   A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33538"
FT                   /db_xref="GOA:Q9A0Z3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z3"
FT                   /protein_id="AAK33538.1"
FT                   /translation="MRFSYNKLWKLLIDKGWTKTKLRQEAGISSSTIAKLGKGENITTD
FT                   ILLEICIALDCKIEDIVEIVDNNI"
FT   gene            complement(445373..446218)
FT                   /locus_tag="SPy_0545"
FT                   /old_locus_tag="SPy0545"
FT   CDS_pept        complement(445373..446218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0545"
FT                   /old_locus_tag="SPy0545"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||T27066 hypothetical protein
FT                   Y51A2B.6a - Caenorhabditis elegans
FT                   >gi|3881031|emb|CAA16394.1| (AL021493) predicted using
FT                   Genefinder; contains similarity to Pfam domain: PF02206
FT                   (Domain of unknown function), Score=52.9, E-value=2.3e-12,
FT                   N=1 [Caenorhabditis elegans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33539"
FT                   /db_xref="InterPro:IPR018760"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z2"
FT                   /protein_id="AAK33539.1"
FT                   /translation="MDISIEFGLYPTESDLTELQQYFPDTNLKKLYEVEAYHKKLETIL
FT                   DSEFSTERESLIAEIDELESQLTTLNQELQELGNIPNLSSEYLENYSKLTATINALKEQ
FT                   NEAYLKESGLSKEKSETDADLKRSTEDILLDLEVKINSKMREVNNILYPDIRKAPQINL
FT                   NAHNSYSFYTPDDDGTGTKFKGMIVFDLVMLYLTNLPALAHDSLLLSNVSYQATEALLK
FT                   LYDQSRSLNKQVFLVFDKASSYSPDANQLLSENTVLRLSSNGNELYGISWNKGENSDEI
FT                   "
FT   gene            complement(446303..447031)
FT                   /locus_tag="SPy_0546"
FT                   /old_locus_tag="SPy0546"
FT   CDS_pept        complement(446303..447031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0546"
FT                   /old_locus_tag="SPy0546"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = prf||1703265K cytochrome oxidase I
FT                   intronic ORF 9 [Podospora anserina]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33540"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z1"
FT                   /protein_id="AAK33540.1"
FT                   /translation="MLIEMWSPVFKKHGEIREPICFHHGLNVIMGMDLADNSIGKSSSL
FT                   LAIDFIFGGNSYLKSIAVKKLGDHPIYFCFQFEKKFYFSRDTANPDIILVCDKSYSPTG
FT                   ETMDLGIFLNKLKKRYHLDSPELSFRLAMSGFFRIAGKSNQNTDFPLQVYSSQKSSESI
FT                   TTLIQLFNLYDNIARYKERLKDKSDQLTTFRNARRYAFISNLVGGKKQFEANVSEIKRL
FT                   EYDLAHLQDTHQDKIDSDDI"
FT   gene            complement(447022..447246)
FT                   /locus_tag="SPy_0547"
FT                   /old_locus_tag="SPy0547"
FT   CDS_pept        complement(447022..447246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0547"
FT                   /old_locus_tag="SPy0547"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33541"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Z0"
FT                   /protein_id="AAK33541.1"
FT                   /translation="MQLPNKLYSYQKSTLAYLPRVLNEIKSRNSNVKDIFHAISEELDD
FT                   PTDFLSIMDCLYALNAIEMSNEGEVKLCL"
FT   gene            complement(447246..448340)
FT                   /locus_tag="SPy_0549"
FT                   /old_locus_tag="SPy0549"
FT   CDS_pept        complement(447246..448340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0549"
FT                   /old_locus_tag="SPy0549"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33542"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y9"
FT                   /protein_id="AAK33542.1"
FT                   /translation="MTQLKTQYPSLIIDASFITLAANATVKPQDKTYNTVNLLNRFFLI
FT                   WLDVASRGLSHHHVLSHPFKDWMTNMLDFPYHHEFIEFLGRWTHILIALPKRHHGQVDT
FT                   AIPRYLLVTIREKTGIVKLTTVQNTAFTTQSNQLKKQYGQFLLTESNNCCACPGCDRPL
FT                   ILTSGNLAAENYEVSAIEKDKDAEALNLIALCPDGFLTYQADRRKKIVTTLKNVKKILV
FT                   SAHNSQQAISDMKLDSGIVSVLTSLNKLKCDEYNISYDSKQLTDKISPENNRTLYQLVK
FT                   NQVIDNYLTIQKIIVNLDKQGKIDYEKIQYQTRSMYKKLKAAKHNNLAIFNTISEKLHL
FT                   ATLQDIYFCQMIVSYFIQKCEVLE"
FT   gene            448359..448688
FT                   /locus_tag="SPy_0550"
FT                   /old_locus_tag="SPy0550"
FT   CDS_pept        448359..448688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0550"
FT                   /old_locus_tag="SPy0550"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF96232.1| (AE004370)
FT                   DNA-damage-inducible protein J [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33543"
FT                   /db_xref="GOA:Q9A0Y8"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y8"
FT                   /protein_id="AAK33543.2"
FT                   /translation="MSLQKRRITMAKTGTLNLRVDDSVKSAADDILKRLGIPMSTAIDM
FT                   FLNQIILTGGIPFDVSLPEAPQRVNVDYMSQEKFYDKLITSFEDAKTGNRQDVREFLFQ
FT                   LKENA"
FT   gene            448688..448993
FT                   /locus_tag="SPy_0552"
FT                   /old_locus_tag="SPy0552"
FT   CDS_pept        448688..448993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0552"
FT                   /old_locus_tag="SPy0552"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||G70393 conserved hypothetical
FT                   protein aq_1088 - Aquifex aeolicus
FT                   >gi|2983568|gb|AAC07141.1| (AE000722) hypothetical protein
FT                   [Aquifex aeolicus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33544"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y7"
FT                   /protein_id="AAK33544.2"
FT                   /translation="MKEYQVTMSDDAKADLLSIYHYVRDELCAPQAADDLLERLSQGML
FT                   SLSIFPERCAIIEDLIGKGYTFRQLIVKKYRIVYHVLEDEVIIVAVVYGSRHMNNW"
FT   gene            449012..449284
FT                   /locus_tag="SPy_0553"
FT                   /old_locus_tag="SPy0553"
FT   CDS_pept        449012..449284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0553"
FT                   /old_locus_tag="SPy0553"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33545"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y6"
FT                   /protein_id="AAK33545.1"
FT                   /translation="MELVKTIQIGDDIYPPIPDLFGIQENQEFNLYKSTDGTLVLSPSD
FT                   SKLSADHQSISSDEQMTTAVEQARLDEIATSVLSRHLDAFKELTE"
FT   gene            449389..449841
FT                   /locus_tag="SPy_0555"
FT                   /old_locus_tag="SPy0555"
FT   CDS_pept        449389..449841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0555"
FT                   /old_locus_tag="SPy0555"
FT                   /product="putative portal protein-phage associated"
FT                   /note="Best Blastp hit = pir||T13514 hypothetical protein
FT                   25 - Bacillus phage phi-105 >gi|4126611|dbj|BAA36631.1|
FT                   (AB016282) ORF25 [bacteriophage phi-105]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33546"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y5"
FT                   /protein_id="AAK33546.1"
FT                   /translation="MGLLDLIGRKRARDKPQNSYEGQDFSYLFGRTTSGENVDEFKTMQ
FT                   TTAVYACVRVLAEAVASLPIHIYERTENGKEKKLDHPLYFLLHDEPNPEMSSFIFRETI
FT                   MSHLLIWGNAYVQIIRDKSGMVSLLLKQKASVLIRKLLLIIWQRMP"
FT   gene            449883..450221
FT                   /locus_tag="SPy_0556"
FT                   /old_locus_tag="SPy0556"
FT   CDS_pept        449883..450221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0556"
FT                   /old_locus_tag="SPy0556"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAC08463.1| (AJ295852)
FT                   penicillin binding protein 1A [Streptococcus mitis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33547"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y4"
FT                   /protein_id="AAK33547.1"
FT                   /translation="MTVSSSAWMPRLISQQILSEYVKSLEVEADKVVIPGQNTPVFSWD
FT                   RDGNGNLSIDTPLLKVRGESLATQADLTTISLTPGPKGELWQTSVERLDIKVDKHISLT
FT                   FKNGVRID"
FT   gene            450635..450976
FT                   /locus_tag="SPy_0558"
FT                   /old_locus_tag="SPy0558"
FT   CDS_pept        450635..450976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0558"
FT                   /old_locus_tag="SPy0558"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF91172.1| (AF199409)
FT                   merozoite surface protein 1 [Plasmodium vivax]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33548"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y3"
FT                   /protein_id="AAK33548.1"
FT                   /translation="MMKPPFTVTNTMLNKVVEISKIIGNLELQVQKDLKLRKENRIQSI
FT                   HSSLAIEQNSLTVEQITAIIDGKRVLGNPREIREVKNAYEAYEEILTLTPYDESHFFKM
FT                   KKFQQYIYR"
FT   gene            451000..451824
FT                   /locus_tag="SPy_0559"
FT                   /old_locus_tag="SPy0559"
FT   CDS_pept        451000..451824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0559"
FT                   /old_locus_tag="SPy0559"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||D75212 asparagine-tRNA ligase
FT                   (EC 6.1.1.22) PAB2203 - Pyrococcus abyssi (strain Orsay)
FT                   >gi|5457656|emb|CAB49147.1| (AJ248283) ASPARAGINYL-TRNA
FT                   SYNTHETASE (EC 6.1.1.22) (ASPARAGINE-TRNA LIGASE) (ASNRS)
FT                   [Pyrococcus abyssi]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33549"
FT                   /db_xref="GOA:Q9A0Y2"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y2"
FT                   /protein_id="AAK33549.1"
FT                   /translation="MGLGSDSLPVKISLFDVDTYLADSMQFHLEYILRLFPKSGVHYLM
FT                   PTFRGEAVDHRHLSQFYHSECEIEGDLHYVMNLVDRYIKFLVSEILRECRDSIFAITKD
FT                   VSHLESFIDRKIPIITFEEACTILENEIDSLEYNDEHHFYVLTDVGEKKLMEHFEGVVW
FT                   VKNYPCKSVPFYQRFSTDHLFAYNADLLLGIGETVGCGERCETYEEVVENMNYLQVDAS
FT                   EYSWYLEMKKTRPMKSSGFGLGVERLIAWILKCDDVRKVQLISRENGIDYLP"
FT   gene            451802..453085
FT                   /locus_tag="SPy_0560"
FT                   /old_locus_tag="SPy0560"
FT   CDS_pept        451802..453085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0560"
FT                   /old_locus_tag="SPy0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P39641|YWFE_BACSU HYPOTHETICAL
FT                   52.3 KD PROTEIN IN ROCC-PTA INTERGENIC REGION
FT                   >gi|629090|pir||S39738 ywfE protein - Bacillus subtilis
FT                   >gi|414007|emb|CAA51639.1| (X73124) ipa-83d [Bacillus
FT                   subtilis] >gi|2636307|emb|CAB15798.1| (Z99123) alternate
FT                   gene name: ipa-83d [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33550"
FT                   /db_xref="GOA:Q9A0Y1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Y1"
FT                   /protein_id="AAK33550.1"
FT                   /translation="MGLIIYHKGGRKMKKNILIVGGGPEITICYDLINNSTEYNFFSVS
FT                   EIPTMYPELFVETIETSFRNFGKTIEQIKELKYSIDAVACWDEALTHIADDISKELGLN
FT                   PISSLDSQSFRFKDRMRMVCEAGGLKMPKYKIINQFSDTNKIINWKYPLIVKPTSFLAS
FT                   IGVKKVYNFSELQQAVSQMLNVKFPVYIASGVYELGELYNLEPRVLVEEFIDGEEYSLE
FT                   SVVRNGIYTPLGITKKIVDEKLFMDEIGHIFPSNLNKEEKSRVYSWAEKLHQILQLNHI
FT                   TTHTEFRIGRNGDIILIEIGARIGGDCIPNLMKNSFIVKGFDFYNTYLKARLGLQEELN
FT                   TDTNKFSGIVFFRLNPENYGKIFNGVSYDAPKTSLIFEEKIYKKEGTVLPNPINWSNER
FT                   VGYVCLENKEYAVLEKEMKEILKSLSIE"
FT   gene            452907..454029
FT                   /locus_tag="SPy_0561"
FT                   /old_locus_tag="SPy0561"
FT                   /note="This gene contains several frameshift and point
FT                   mutations near the proposed start. However, it is possible
FT                   that the gene is actually transcribed from an internal
FT                   start site; Best Blastp hit = sp|Q47511|MCCF_ECOLI MICROCIN
FT                   C7 SELF-IMMUNITY PROTEIN MCCF >gi|682770|emb|CAA40814.1|
FT                   (X57583) mccF [Escherichia coli]"
FT   gene            454042..455261
FT                   /locus_tag="SPy_0563"
FT                   /old_locus_tag="SPy0563"
FT                   /note="This gene contains several frameshift and point
FT                   mutations near the proposed start. However, it is possible
FT                   that the gene is actually transcribed from an internal
FT                   start site; Best Blastp hit = sp|Q9ZK27|SYH_HELPJ
FT                   HISTIDYL-TRNA SYNTHETASE (HISTIDINE-TRNA LIGASE) (HISRS)
FT                   >gi|7437812|pir||D71847 histidine-tRNA ligase (EC 6.1.1.21)
FT                   - Helicobacter pylori (strain J99)
FT                   >gi|4155714|gb|AAD06696.1| (AE001539) HISTIDYL-TRNA
FT                   SYNTHETASE [Helicobacter pylori J99]"
FT   gene            complement(455714..456750)
FT                   /gene="tnpA"
FT                   /locus_tag="SPy_0565"
FT                   /old_locus_tag="SPy0565"
FT                   /note="This gene contains several frameshift and point
FT                   mutations near the proposed start. ; Best Blastp hit =
FT                   gb|AAB01067.1| (U23813) transposase [Lactococcus lactis]"
FT   gene            457055..457852
FT                   /locus_tag="SPy_0567"
FT                   /old_locus_tag="SPy0567"
FT   CDS_pept        457055..457852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0567"
FT                   /old_locus_tag="SPy0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P75809|YBJI_ECOLI PROTEIN YBJI"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33552"
FT                   /db_xref="GOA:Q9A0X9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X9"
FT                   /protein_id="AAK33552.1"
FT                   /translation="MIKLIATDMDGTFLAEDGTYNQEQLAALLPKLAEKGILFAVSSGR
FT                   SLLAIDQLFEPFLDQIAVIAENGSVVQYRGEILFADMMTKEQYTEVAKKILANPHYVET
FT                   GMVFSGQKAAYILKGASEEYIQKTKHYYANVKVINGFEDMENDAIFKVSTNFTGHTVLE
FT                   GSDWLNQALPYATAVTTGFDSIDIILKEVNKGFGMEHLCQALGIKKAETIAFGDNFNDY
FT                   QMLEFAGRAIATENARPEIKVISDQVIGHCNDGAVLTYLKGLV"
FT   gene            457856..458680
FT                   /locus_tag="SPy_0568"
FT                   /old_locus_tag="SPy0568"
FT   CDS_pept        457856..458680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0568"
FT                   /old_locus_tag="SPy0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAA62048.1| (L10328) f270
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33553"
FT                   /db_xref="GOA:Q9A0X8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X8"
FT                   /protein_id="AAK33553.1"
FT                   /translation="MNIRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGR
FT                   PLKAIGNLLEELDLLDHDDYSITFNGGLVQRNTGEVLDKSSLSFDQVCQIQQALEAVGL
FT                   PTDIISGGDVYSIPSKDGRHSQYHLANPLLTFIEVTSVAELPKDITYNKIVTVTDPDFL
FT                   DQQIIKLSPSLFEDFEAFKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEA
FT                   NDFAMLEWAGLGVAMANGVSGAKADADAVTTLTNDESGVAEAVKTFILEEES"
FT   gene            458680..460230
FT                   /gene="ftsY"
FT                   /locus_tag="SPy_0569"
FT                   /old_locus_tag="SPy0569"
FT   CDS_pept        458680..460230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="SPy_0569"
FT                   /old_locus_tag="SPy0569"
FT                   /product="putative signal recognition particle (docking
FT                   protein)"
FT                   /note="Best Blastp hit = emb|CAB13468.1| (Z99112) signal
FT                   recognition particle (docking protein) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33554"
FT                   /db_xref="GOA:Q9A0X7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X7"
FT                   /protein_id="AAK33554.1"
FT                   /translation="MGLFDRLFGKKETPKVAEEKLEENLLTETTQKEELSEKANEQDKI
FT                   EAVQQEDVSSEGAGSVENGPEAASVNALVEEETGDNSNHPSEDTNEFAADKTDLKVSEL
FT                   SQSTASEPKDLVDQPVVEQFPTKQAQADASNDSANEEAVDTSKEQSSSQQVMEDYYRRK
FT                   AALEKSLQEKAAATVPVMPEEVPQENQASTSAEASQNKATHDTIPETDQEKYKRSLKKT
FT                   RTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKP
FT                   DALKRVIVEKLVDIYEKDGRYNEAINYQDGLTVMLFVGVNGVGKTTSIGKLAYRYKQEG
FT                   KKVMLVAADTFRAGAVAQLVEWGRRVDVPVITGPEKADPASVVFDGMEKAVAKGVDILL
FT                   IDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITP
FT                   LTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGLLEGIL"
FT   gene            complement(460284..461651)
FT                   /locus_tag="SPy_0570"
FT                   /old_locus_tag="SPy0570"
FT   CDS_pept        complement(460284..461651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0570"
FT                   /old_locus_tag="SPy0570"
FT                   /product="putative drug resistance protein"
FT                   /note="Best Blastp hit = pir||E69652 lincomycin-resistance
FT                   protein lmrB - Bacillus subtilis
FT                   >gi|2415718|dbj|BAA22228.1| (AB000617) LmrB [Bacillus
FT                   subtilis] >gi|2632553|emb|CAB12061.1| (Z99105) drug-export
FT                   protein [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33555"
FT                   /db_xref="GOA:Q9A0X6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X6"
FT                   /protein_id="AAK33555.1"
FT                   /translation="MSHHQQTVSKQTIMAIIAIALIGFSGILSETSMNVTFPTLMSVYQ
FT                   LPLNSLQWMTTIYLLAVAIMMTTSATLKKNVRERPLFFMATGLFTFGTILAVLTQSFAI
FT                   MLLARIFQGIGTGLVMPQMFNIILERVPMHKVGLFMGFAGLIISLAPAFGPTYGGFMIS
FT                   HFSWQWIFICILPVPLIAGILAYYYLEDSPVSEKVPFDWLAFIALSISLTSALLAITSL
FT                   ENGSVNLYYLGLFILSFILFLYKNLTAKQPFLDIRILKIPSLTFGLIPFFVFQLINLGI
FT                   NFLTPNFIVMEKIANSSQAGMVLLPGTLLGALLAPAFGKLYDQKGARLSLYLGNALFSL
FT                   SLIIMTLQTRHFMLLPFTLLYILFTFGRNMGFNNSLATAIRELPAEKNADATAIFQMMQ
FT                   QFAGALGTAMASLIANSQAEFTSGVQSVYLLFTIFALLDFIFFFAMFYHLGKKGLA"
FT   gene            461979..462821
FT                   /gene="licT"
FT                   /locus_tag="SPy_0571"
FT                   /old_locus_tag="SPy0571"
FT   CDS_pept        461979..462821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /locus_tag="SPy_0571"
FT                   /old_locus_tag="SPy0571"
FT                   /product="putative transcription antiterminator"
FT                   /note="Best Blastp hit = sp|P39805|LICT_BACSU TRANSCRIPTION
FT                   ANTITERMINATOR LICT >gi|628995|pir||S47216 transcription
FT                   antiterminator licT - Bacillus subtilis
FT                   >gi|534045|emb|CAA82194.1| (Z28340) antiterminator
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33556"
FT                   /db_xref="GOA:Q9A0X5"
FT                   /db_xref="InterPro:IPR001550"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X5"
FT                   /protein_id="AAK33556.1"
FT                   /translation="MLIKRVLNHNAAISTNHQGLDILLMGKGITFGKKVGDSIELNAIE
FT                   TSFVLKNSDNMNRFTELFITVPQEVVACSERIINLGKIKLGKTLDEILYINLTDHIHSA
FT                   IERHEQGMLIHNPLRWEIQRYYPDEYSLGVKALELIERNLGVTLAIDEAAFIAMHFVNA
FT                   SLDTPFKEPHRLTEIVSYIEQKIKTDFKTELDDTSIDYYRFMTHIKLFAQRVLSQMSYD
FT                   DDDAELLLVVKTKYPKEYRCVLDISEEIKKRYNYHLNSSELLYLTVHVKRLVKHLKET"
FT   gene            462823..464685
FT                   /locus_tag="SPy_0572"
FT                   /old_locus_tag="SPy0572"
FT   CDS_pept        462823..464685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0572"
FT                   /old_locus_tag="SPy0572"
FT                   /product="beta-glucoside permease IIABC component"
FT                   /note="Best Blastp hit = sp|P40739|PTBA_BACSU PTS SYSTEM,
FT                   BETA-GLUCOSIDES-SPECIFIC IIABC COMPONENT (EIIABC-BGL)
FT                   (BETA-GLUCOSIDES-PERMEASE IIABC COMPONENT)
FT                   (PHOSPHOTRANSFERASE ENZYME II, ABC COMPONENT) (EII-BGL)
FT                   >gi|2126898|pir||I40406 beta-glucoside permease - Bacillus
FT                   subtilis >gi|505576|emb|CAA84286.1| (Z34526) beta-glucoside
FT                   permease [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33557"
FT                   /db_xref="GOA:Q9A0X4"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X4"
FT                   /protein_id="AAK33557.1"
FT                   /translation="MTYQETAKAILAAVGGKTNIQRVTHCVTRLRLVLKNDEKVKDQQV
FT                   KAISNVIGVMRKNGQYQIILGNDVNNYYQAFLSLGHFDNQDEDHSSKAKGSILERLIET
FT                   IAGVITPLIPALLGGGMLKVVGILLPMLGLASADSQTVAFINFFGDAAYYFMPVMIAYS
FT                   AAARFKVTPVLAATIAGILLHPAFVAMVAEGKPLTLFGAPVTPASYGSSVIPILMMVYL
FT                   MQYIEKWVNRLVPSVMKSFLQPTLIILISGFLALVVVGPLGVIIGQGLSNTMLAIYHVA
FT                   PWLALAILGAIMPLVVMTGMHWAFAPIFLAASVATPDVLILPAMLASNLAQGAASLAVA
FT                   FKTKQKQTRQVALAAGISALLAGITEPALYGVTLKFKKPLYAAMISGGLVGAFIGFVNI
FT                   ASYTFVVPSIIGLPQYINPSGGANFTNALIAGTATIVLAFSLTWFMGIDEESPKQVSVA
FT                   ADMSQVKSGLSTKQTLYAPMTGEMLFLSEVPDETFSSKLLGEGFAILPSEGEVYAPFDG
FT                   EVITFFPTKHAVALKNTRGVEVLIHVGIDTVELKGQGFEQLVSVGDVVKRGQALLKMDI
FT                   DFITSKGYSLISPVVVTNSAEQLEIIIQDDKKMVTKEDALLVIL"
FT   gene            464704..466128
FT                   /gene="bglA"
FT                   /locus_tag="SPy_0574"
FT                   /old_locus_tag="SPy0574"
FT   CDS_pept        464704..466128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="SPy_0574"
FT                   /old_locus_tag="SPy0574"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="Best Blastp hit = gb|AAF89979.1|AF206272_5
FT                   (AF206272) beta-glucosidase [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33558"
FT                   /db_xref="GOA:Q9A0X3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X3"
FT                   /protein_id="AAK33558.1"
FT                   /translation="MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWT
FT                   DSPTSDNLTLEAIDFYHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQF
FT                   YDDLFDELLNYGIEPLVTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKV
FT                   KYWLTFNEVNSILHMPFTSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDV
FT                   KVGCMILAMPAYPMTSDPRDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIV
FT                   FEDGDKELLAEHTVDFLSFSYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQI
FT                   DPIGLRLVLNQYYDRYQIPLFIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQV
FT                   AKAIEDGVEVMGYTSWGCIDCVSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWY
FT                   RQVIQTNGRYLEDNFS"
FT   gene            complement(466227..467042)
FT                   /locus_tag="SPy_0575"
FT                   /old_locus_tag="SPy0575"
FT   CDS_pept        complement(466227..467042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0575"
FT                   /old_locus_tag="SPy0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF09593.1| (AF142677) unknown
FT                   [Bacillus megaterium]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33559"
FT                   /db_xref="GOA:Q9A0X2"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X2"
FT                   /protein_id="AAK33559.1"
FT                   /translation="MIRFLILAGYFELTMYLQLSGKLDQYINVRYSYLAYISMILSFIL
FT                   ALVQLYTWMKNIKVHSHLTGKIARLTSPFILVFPVLIGLLVPTVTLDSTTVSAKGYTFP
FT                   LAAGASKTGVSDDGTTIQYLKPDTSLYFTKSAYQKEMRQELHKYKGKKPVTITTENYME
FT                   VMELIYLYPDEFLDRDIQYTGFVYNEPGHDNYQFLFRFGIIHCIADSGVYGLLTTGNQT
FT                   SYPNNTWLTVKGRLHMEYDKNLEQHLPVLQLAEVHQTKEPNNPYVYRVF"
FT   gene            complement(467042..467944)
FT                   /locus_tag="SPy_0576"
FT                   /old_locus_tag="SPy0576"
FT   CDS_pept        complement(467042..467944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0576"
FT                   /old_locus_tag="SPy0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB05237.1| (AP001512) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33560"
FT                   /db_xref="GOA:Q9A0X1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X1"
FT                   /protein_id="AAK33560.1"
FT                   /translation="MSLFSNLPPSVLQWFAIFMSIIIEALPFVLLGTILSGCIEVFVTP
FT                   ELVQKYLPKQKCLRILFGTFVGFVFPSCECGIIPIINRFLEKKVPSYTAVPFLATAPII
FT                   NPIVLFATYSAFGNSLRFLILRLVGAALVAITLGVMLAFIVDDNILKDNAQPVHFHDYS
FT                   HESLPKRIYLALVHAIDEFFDTGRYLVFGTLIASAMQIYVPTRVLTTIGHNPLTAILIM
FT                   MLMAFILSLCSEADAFIGASLLSTFGVAPVLAFLLIGPMVDIKNLMMMVKAFKGRFIVQ
FT                   FIGVSVLMIAVYCLLVGVL"
FT   gene            468078..468275
FT                   /locus_tag="SPy_0578"
FT                   /old_locus_tag="SPy0578"
FT   CDS_pept        468078..468275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0578"
FT                   /old_locus_tag="SPy0578"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33561"
FT                   /db_xref="GOA:Q9A0X0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0X0"
FT                   /protein_id="AAK33561.1"
FT                   /translation="MRQTSYGLLGFVCSVVFSLVASLPSVLTSKGLSKLGIDAKPASIF
FT                   SSSSFFLWVIAISMTFFHSR"
FT   gene            complement(468092..468247)
FT                   /locus_tag="SPy_0577"
FT                   /old_locus_tag="SPy0577"
FT   CDS_pept        complement(468092..468247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0577"
FT                   /old_locus_tag="SPy0577"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33562"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0W9"
FT                   /protein_id="AAK33562.1"
FT                   /translation="MAITHKKNDELEKMLAGFASIPSFDKPLEVNTDGKLATKEKTTEQ
FT                   TKPSKP"
FT   gene            468481..470613
FT                   /locus_tag="SPy_0580"
FT                   /old_locus_tag="SPy0580"
FT   CDS_pept        468481..470613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0580"
FT                   /old_locus_tag="SPy0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB04250.1| (AP001508) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33563"
FT                   /db_xref="GOA:Q9A0W8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0W8"
FT                   /protein_id="AAK33563.1"
FT                   /translation="MENNNNHNIAEALSVSLHQIEQVLALTAQGNTIPFIARYRKEVTG
FT                   NLDEVVIKSIIDMDKSLTTLNERKATILAKIEEQGKLTDQLRTSIEATEKLADLEELYL
FT                   PYKEKRRTKATIAREAGLFPLARLILQNAQNLETAAEPFVTEGFASPQEALAGAVDILV
FT                   EAMSEDAKLRSWTYNEIWQYSRLVSTLKDEQLDEKKVFQIYYDFSDQVSNMQGYRTLAL
FT                   NRGEKLGILKVSFEHNLEKMQRFFSVRFKETNPYIEEVINQTIKKKIVPAMERRVRSEL
FT                   SDAAEDGAIHLFSENLRHLLLVSPLKGKMVLGFDPAFRTGAKLAIVDQTGKLLTTQVIY
FT                   PVAPASQTKIQAAKETLTQLIETYQIDIIAIGNGTASRESEAFVADVLKDFPNTSYVIV
FT                   NESGASVYSASELARHEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGVGQYQHDV
FT                   SQKKLSENLGFVVDTVVNQVGVNVNTASPSLLAHVSGLNKTISENIVKYREENGALTSR
FT                   ADIKKVPRLGAKAFEQAAGFLRIPGAKNILDNTGVHPESYPAVKELFKVLGIQDLDDAA
FT                   KATLAAVQVPQMAETLAIGQETLKDIIADLLKPGRDLRDDFEAPILRQDILDLKDLEIG
FT                   QKLEGTVRNVVDFGAFVDIGVHEDGLIHISEMSKTFVNHPSQVVSVGDLVTVWVSKIDL
FT                   DRHKVNLSLLPPRDTH"
FT   gene            470600..471037
FT                   /locus_tag="SPy_0581"
FT                   /old_locus_tag="SPy0581"
FT   CDS_pept        470600..471037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0581"
FT                   /old_locus_tag="SPy0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAA90855.1| (AB031213) YdcK
FT                   [Bacillus halodurans] >gi|10173145|dbj|BAB04251.1|
FT                   (AP001508) unknown conserved protein in B. subtilis
FT                   [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33564"
FT                   /db_xref="GOA:Q9A0W7"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0W7"
FT                   /protein_id="AAK33564.1"
FT                   /translation="MTLTNYVQEVSLADFGKPLHHKAYWNKRLKTTGGRFFPKDGHLDF
FT                   NPRMLEEHGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLLAQVNGLRYVPTSSKS
FT                   KTNHHYSCQTCGQVYQRKRRINLAKYVCGNCHGKLMEKNQS"
FT   gene            471101..471373
FT                   /locus_tag="SPy_0583"
FT                   /old_locus_tag="SPy0583"
FT   CDS_pept        471101..471373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0583"
FT                   /old_locus_tag="SPy0583"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||B72287 conserved hypothetical
FT                   protein - Thermotoga maritima (strain MSB8)
FT                   >gi|4981705|gb|AAD36232.1|AE001773_1 (AE001773) conserved
FT                   hypothetical protein [Thermotoga maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33565"
FT                   /db_xref="GOA:Q9A0W6"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0W6"
FT                   /protein_id="AAK33565.1"
FT                   /translation="METKFYKQRKNRLVAGVIAGLADKYGWDLALARVLAALLIYGTGF
FT                   GVLLYILLAIFLPYKEDLLEERYGRGPRRRKDADVLNEEEDGWFW"
FT   gene            471738..472670
FT                   /gene="ptsK"
FT                   /locus_tag="SPy_0584"
FT                   /old_locus_tag="SPy0584"
FT   CDS_pept        471738..472670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="SPy_0584"
FT                   /old_locus_tag="SPy0584"
FT                   /product="Hpr kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="Best Blastp hit = dbj|BAA77782.1| (AB027460) Hpr
FT                   kinase [Streptococcus bovis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33566"
FT                   /db_xref="GOA:P68898"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68898"
FT                   /protein_id="AAK33566.1"
FT                   /translation="MTVTVKMLVQKVKLDVVYATDNLLSKEITTSDISRPGLEMTGYFD
FT                   YYAPERLQLFGMKEWSYLTQMTSHNRYSVLKEMFKKDTPAVVVSRNLAIPKEMVQAAKE
FT                   EGISLLSSRVSTSRLAGEMSYFLDASLAERTSVHGVLMDIYGMGVLIQGDSGIGKSETG
FT                   LELVKRGHRLVADDRVDVYAKDEETLWGEPAEILRHLLEIRGVGIIDVMSLYGASAVKD
FT                   SSQVQLAIYLENFEAGKVFDRLGNGNEEITFSGVRIPRIRIPVKTGRNVSVVIEAAAMN
FT                   HRAKEMGFDATKTFEDRLTQLITKNEVSQ"
FT   gene            472667..473446
FT                   /gene="lgt"
FT                   /locus_tag="SPy_0585"
FT                   /old_locus_tag="SPy0585"
FT   CDS_pept        472667..473446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="SPy_0585"
FT                   /old_locus_tag="SPy0585"
FT                   /product="putative prolipoprotein diacylglycerol
FT                   transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="Best Blastp hit = sp|P72482|LGT_STRMU PROLIPOPROTEIN
FT                   DIACYLGLYCERYL TRANSFERASE >gi|7433975|pir||T11569
FT                   prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) -
FT                   Streptococcus mutans >gi|4583534|gb|AAC80171.3| (U75480)
FT                   putative prolipoprotein diacylglycerol transferase
FT                   [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33567"
FT                   /db_xref="GOA:P60965"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60965"
FT                   /protein_id="AAK33567.1"
FT                   /translation="MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDA
FT                   IFDFILIAFPLAIVGARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAY
FT                   CYNKVLNPIHFLDIAAPSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEG
FT                   SYRIPTFLYESLWNLLGFVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSL
FT                   MFLGIRISQYVSALLIIIGLIFVIKRRRQKGISYYQE"
FT   gene            473468..473875
FT                   /locus_tag="SPy_0587"
FT                   /old_locus_tag="SPy0587"
FT   CDS_pept        473468..473875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0587"
FT                   /old_locus_tag="SPy0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||T11570 hypothetical protein 1
FT                   - Streptococcus mutans >gi|4321110|gb|AAD15621.1| (U75480)
FT                   unknown [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33568"
FT                   /db_xref="GOA:Q9A0W3"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0W3"
FT                   /protein_id="AAK33568.1"
FT                   /translation="MDLVGISLMIIALAFVALVIFLIIVLKKVSETIDEAKKTISVLTS
FT                   DVNVTLHQTNDILAKANILVEDVNGKVATIDPLFVAIADLSESLSDLNSQARHFGQKAT
FT                   NATGNVSKAGKLALVGKVASKVFGKKGEKHE"
FT   gene            473868..474296
FT                   /locus_tag="SPy_0588"
FT                   /old_locus_tag="SPy0588"
FT   CDS_pept        473868..474296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0588"
FT                   /old_locus_tag="SPy0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||T11571 hypothetical protein 2
FT                   - Streptococcus mutans >gi|4321111|gb|AAD15622.1| (U75480)
FT                   unknown [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33569"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0W2"
FT                   /protein_id="AAK33569.1"
FT                   /translation="MNKSFKNLVIGAVSGVAAAYFLSTEKGKALKNRAEKAYQAYKESP
FT                   DDYHQFAKEKGSEYSHLARDTFYDVKDKLASGDLTKEDMLDLLKDKTTAFVQKTKETLA
FT                   EVEAKEKQDDVIIDLNEEDIIIDYTEQDEPVSDTLDKH"
FT   gene            complement(474456..474740)
FT                   /locus_tag="SPy_0589"
FT                   /old_locus_tag="SPy0589"
FT   CDS_pept        complement(474456..474740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0589"
FT                   /old_locus_tag="SPy0589"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33570"
FT                   /db_xref="GOA:Q9A0W1"
FT                   /db_xref="InterPro:IPR021688"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0W1"
FT                   /protein_id="AAK33570.1"
FT                   /translation="MPAPLKKHNSVEQDDSYQESQSKFRDFQEFNGQSAKLKELVFFAR
FT                   IASFSLITVLFAFVLLVMNLAPMFAFLFASIISLGITSLFAKVIKSLLM"
FT   gene            474939..475865
FT                   /locus_tag="SPy_0590"
FT                   /old_locus_tag="SPy0590"
FT   CDS_pept        474939..475865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0590"
FT                   /old_locus_tag="SPy0590"
FT                   /product="putative protease"
FT                   /note="Best Blastp hit = pir||G69979 proteinase homolog
FT                   yrrN - Bacillus subtilis >gi|2635181|emb|CAB14677.1|
FT                   (Z99117) similar to protease [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33571"
FT                   /db_xref="GOA:Q9A0W0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0W0"
FT                   /protein_id="AAK33571.1"
FT                   /translation="MEKIIITATAESIEQVKALLAAGVDRIYVGEANYGLRLPHNFSYD
FT                   ELRQIAKLVHDAGKELTVACNALMHQDMMDQIKPFLDLMIEIAVDYLVVGDAGVFYVNK
FT                   RDGYNFKLIYDTSVFVTSSRQVNFWGQHGAVESVLAREIPSAELFTLAENLEFPAEVLV
FT                   YGASVIHHSKRPLLENYYHFTKIDDEVSRERGLFLAEPGDASSHYSIYEDNHGTHIFIN
FT                   NDIDMMSKLGELYAHGLTHWKLDGIYCPGDDFVAITKLFIQAKTLLEAGQFTQEEAEKL
FT                   DQAVHAHHPAGRGLDTGFYEFDPKTVK"
FT   gene            475956..477242
FT                   /locus_tag="SPy_0591"
FT                   /old_locus_tag="SPy0591"
FT   CDS_pept        475956..477242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0591"
FT                   /old_locus_tag="SPy0591"
FT                   /product="putative protease"
FT                   /note="Best Blastp hit = dbj|BAB04993.1| (AP001511)
FT                   protease [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33572"
FT                   /db_xref="GOA:Q9A0V9"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V9"
FT                   /protein_id="AAK33572.1"
FT                   /translation="MSHMKKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRAG
FT                   NFSMEELQEGIDYAHARGAKVYVAANMVTHEGNEIGAGEWFRQLRDMGLDAVIVSDPAL
FT                   IVICSTEAPGLEIHLSTQASSTNYETFEFWKAMGLTRVVLAREVNMAELAEIRKRTDVE
FT                   IEAFVHGAMCISYSGRCVLSNHMSHRDANRGGCSQSCRWKYDLYDMPFGGERRSLKGEI
FT                   PEDYSMSSVDMCMIDHIPDLIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVGAYMESPE
FT                   AFYAIKEELIDELWKVAQRELATGFYYGIPTENEQLFGARRKIPQYKFVGEVVAFDSAS
FT                   MTATIRQRNVIMEGDRIECYGPGFRHFETVVKDLHDADGQKIDRAPNPMELLTISLPRE
FT                   VKPGDMIRACKEGLVNLYQKDGTSKTVRT"
FT   gene            477452..477664
FT                   /locus_tag="SPy_0593"
FT                   /old_locus_tag="SPy0593"
FT   CDS_pept        477452..477664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0593"
FT                   /old_locus_tag="SPy0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|O83371|Y352_TREPA HYPOTHETICAL
FT                   PROTEIN TP0352 >gi|7519496|pir||F71333 hypothetical protein
FT                   TP0352 - syphilis spirochete >gi|3322644|gb|AAC65352.1|
FT                   (AE001215) T. pallidum predicted coding region TP0352
FT                   [Treponema pallidum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33573"
FT                   /db_xref="GOA:Q9A0V8"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V8"
FT                   /protein_id="AAK33573.1"
FT                   /translation="MAEFTFNIEEHLLTLSENDKGWTKELNRVSFNGAEAKWDIRTWSP
FT                   DHTKMGKGITLTNEEFKTILDAFRK"
FT   gene            complement(478037..479530)
FT                   /gene="lysS"
FT                   /locus_tag="SPy_0595"
FT                   /old_locus_tag="SPy0595"
FT   CDS_pept        complement(478037..479530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SPy_0595"
FT                   /old_locus_tag="SPy0595"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Best Blastp hit = sp|Q53638|SYK_STAAU LYSYL-TRNA
FT                   SYNTHETASE (LYSINE-TRNA LIGASE) (LYSRS)
FT                   >gi|567884|gb|AAA53114.1| (L36472) lysyl-tRNA synthetase
FT                   [Staphylococcus aureus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33574"
FT                   /db_xref="GOA:Q9A0V7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0V7"
FT                   /protein_id="AAK33574.1"
FT                   /translation="MSNQHIEELNDQQIVRREKMTALAEQGIDPFGKRFDRTANSAELK
FT                   EKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVGEDNY
FT                   EIFKKADLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRK
FT                   RHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADY
FT                   LDIMNLTEGIIQHAAKAVRGDGPIDYQGTEIRINEPFKRVHMVDAIKEVTGADFWPEMT
FT                   VEEAIALAKEKQVPLEKHFISVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNP
FT                   EDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMKP"
FT   gene            479704..480606
FT                   /locus_tag="SPy_0596"
FT                   /old_locus_tag="SPy0596"
FT   CDS_pept        479704..480606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0596"
FT                   /old_locus_tag="SPy0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||E69814 conserved hypothetical
FT                   protein yfnB - Bacillus subtilis
FT                   >gi|2116760|dbj|BAA20111.1| (D86418) YfnB [Bacillus
FT                   subtilis] >gi|2633046|emb|CAB12552.1| (Z99107) similar to
FT                   hypothetical proteins [Bacillus subtilis]
FT                   >gi|2633057|emb|CAB12562.1| (Z99108) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33575"
FT                   /db_xref="GOA:Q9A0V6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V6"
FT                   /protein_id="AAK33575.1"
FT                   /translation="MITAIVFDVDDTIYDQQAPYRIAMEKCFPDFDMSVMNQAYIRFRH
FT                   YSDVGFPRVMAGEWTTEYFRFWRCKETLLEFGYREIDEAAGVHFQEVYEHELENITMLD
FT                   EMRMTLDFLKSKNVPMGIITNGPTEHQLKKVRKLGLYDYIDAKRVIVSQATGFQKPEKE
FT                   IFNLAAEQFDMNPQTTLYVGDSYDNDIMGAFNGGWHSMWFNHRGRQLKPGTKPVYDVAI
FT                   DNFEQLFGAVKVLFDLPDNKFIFDVNDKKNPILQMGINNGLMMAAERLLESNMSIDKVV
FT                   ILLRLTKQQEKVLRLKYAR"
FT   gene            complement(480714..481337)
FT                   /locus_tag="SPy_0598"
FT                   /old_locus_tag="SPy0598"
FT   CDS_pept        complement(480714..481337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0598"
FT                   /old_locus_tag="SPy0598"
FT                   /product="putative phosphoglycerate mutase"
FT                   /note="Best Blastp hit = pir||A75400 probable
FT                   phosphoglycerate mutase - Deinococcus radiodurans (strain
FT                   R1) >gi|6459150|gb|AAF10964.1|AE001985_1 (AE001985)
FT                   phosphoglycerate mutase, putative [Deinococcus
FT                   radiodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33576"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V5"
FT                   /protein_id="AAK33576.1"
FT                   /translation="MKLYFVRHGKTLWNLEGRFQGAGGDSPLLEEAKDEIHLLGKELAK
FT                   VAFDAVYTSDLQRAMATAAIILDAFDQQPKLYHTDQLREWRLGKLEGAKIATMAAIYPQ
FT                   QMLAFRENLAQFKPDQFEAESIYQTTQRVCHLIQSFKDKHYQNVLIVGHGANLTATIRS
FT                   LLGFEPALLLAKGGLDNASLTILETKDYLTYDCLIWNDKSFLEV"
FT   gene            complement(481678..482157)
FT                   /locus_tag="SPy_0599"
FT                   /old_locus_tag="SPy0599"
FT   CDS_pept        complement(481678..482157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0599"
FT                   /old_locus_tag="SPy0599"
FT                   /product="putative transcription regulator"
FT                   /note="Best Blastp hit = pir||D69849 transcription
FT                   regulation homolog yjdI - Bacillus subtilis
FT                   >gi|2633560|emb|CAB13063.1| (Z99110) similar to
FT                   transcription regulation [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33577"
FT                   /db_xref="GOA:Q9A0V4"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V4"
FT                   /protein_id="AAK33577.1"
FT                   /translation="MAKKTKLKKTLVEQILDKANIAHQGLKLNALEGDFPDDLQPSDIY
FT                   KTLALTGDQTGPLIGIIPLTEHLSEKQLAKVSGNKKVSMVPQKDLQKTTGYIHGANNPV
FT                   GIRQKHSYPIFIDQTALEKGQIIVSAGEVGRSIKISSQALADFVGASFADLKKRK"
FT   gene            complement(482248..482811)
FT                   /locus_tag="SPy_0600"
FT                   /old_locus_tag="SPy0600"
FT   CDS_pept        complement(482248..482811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0600"
FT                   /old_locus_tag="SPy0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB04549.1| (AP001510) unknown
FT                   conserved protein in B. subtilis [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33578"
FT                   /db_xref="GOA:Q9A0V3"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V3"
FT                   /protein_id="AAK33578.1"
FT                   /translation="MSPNTNVKYLIEAAIFAALAMTLSFIPDFAGWFSPSYGAIALVIF
FT                   SLRRGLKYGMLAGLIWGLLHFVLGKVYYLSMSQVFIEYILAFTSMGLAGSFSDSLIKTL
FT                   RRQQTFFAVFLAIMASLLAVTVRYLWHFLAGIIFWGSYAPKGMSAVWYSFSVNGTAGVL
FT                   TFLITCLALMIALPIHPQLFDPKD"
FT   gene            complement(483080..483928)
FT                   /locus_tag="SPy_0601"
FT                   /old_locus_tag="SPy0601"
FT   CDS_pept        complement(483080..483928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0601"
FT                   /old_locus_tag="SPy0601"
FT                   /product="putative endolysin, phage associated"
FT                   /note="Best Blastp hit = pir||JC5911 lysin - Lactobacillus
FT                   phage phi-gle"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33579"
FT                   /db_xref="GOA:Q9A0V2"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V2"
FT                   /protein_id="AAK33579.1"
FT                   /translation="MRRKIKPIVVLVFFILLAMVLIIGKRQANHAKQKEVEDAKSHIPI
FT                   ATSNPGKAKTSTSETEDFILNPIVDVSGWQLPEEIDYDTLSRHISGAIVRVYGGSQITA
FT                   HNNAAFTTGIDKSFKTHIKEFQKRNVPVAVYSYALGRSTKEMKEEARAFYKNAAPYNPT
FT                   YYWIDVEEATMKDMNKGVTAFREELKKLGAENVGLYIGTYFMAEQDISTKGFDSVWIPT
FT                   YGSDSGYYEAAPNTTLDYDLHQYTSQGYLSGFNNALDLNQIAVTKDTKKTFEKLFGNSN
FT                   N"
FT   gene            484253..484756
FT                   /locus_tag="SPy_0603"
FT                   /old_locus_tag="SPy0603"
FT   CDS_pept        484253..484756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0603"
FT                   /old_locus_tag="SPy0603"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF94735.1| (AE004235) NADH
FT                   dehydrogenase, putative [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33580"
FT                   /db_xref="GOA:Q9A0V1"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V1"
FT                   /protein_id="AAK33580.1"
FT                   /translation="MSAKLMSRIAIMSALCVVLRMVFSSLPNVQPVTAFLLSYLLYFGL
FT                   AEAVLVMMLCLFLSAFLLGFGPWVFWQVTCFVLVLLLWRFVLYPLSQQFPKYQLGCQAF
FT                   LVALCGLLYGVLIDTCFAYLYSMPWWSYVLAGMPFNIAHALSTLVFFPVVMMLFRRLIG
FT                   EQKI"
FT   gene            484740..485126
FT                   /locus_tag="SPy_0604"
FT                   /old_locus_tag="SPy0604"
FT   CDS_pept        484740..485126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0604"
FT                   /old_locus_tag="SPy0604"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = sp|P38537|SLAP_BACSH SURFACE-LAYER
FT                   125 KD PROTEIN PRECURSOR >gi|98190|pir||A33856
FT                   surface-layer 125K protein precursor - Bacillus sphaericus
FT                   >gi|556012|gb|AAA50256.1| (M28361) surface layer protein
FT                   [Bacillus sphaericus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33581"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0V0"
FT                   /protein_id="AAK33581.1"
FT                   /translation="MNKRFKTGFLALVAMLLVACSQGTKQIQTTPSVPKADHHVRLVVK
FT                   EDTNTVDEKVSFGKGDTVLEVLKDNYEVKEKDGFITAIDGIEQDTKANKYWLFKVNGKM
FT                   ADKGADQITVKDGDSIEFYQEVFN"
FT   gene            complement(485172..485651)
FT                   /gene="bsaA"
FT                   /locus_tag="SPy_0605"
FT                   /old_locus_tag="SPy0605"
FT   CDS_pept        complement(485172..485651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaA"
FT                   /locus_tag="SPy_0605"
FT                   /old_locus_tag="SPy0605"
FT                   /product="putative glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="Best Blastp hit = dbj|BAA75395.1| (AB013377) BsaA
FT                   [Bacillus halodurans] >gi|10175451|dbj|BAB06549.1|
FT                   (AP001516) glutathione peroxidase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33582"
FT                   /db_xref="GOA:Q9A0U9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U9"
FT                   /protein_id="AAK33582.1"
FT                   /translation="MPNLYDFTVKAQDGSDISLVDYKEKVVLVVNTATKCGLTPQYQAL
FT                   QALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDAD
FT                   PLFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG"
FT   gene            complement(485644..487443)
FT                   /gene="pepF"
FT                   /locus_tag="SPy_0606"
FT                   /old_locus_tag="SPy0606"
FT   CDS_pept        complement(485644..487443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="SPy_0606"
FT                   /old_locus_tag="SPy0606"
FT                   /product="putative oligopeptidase"
FT                   /note="Best Blastp hit = pir||T44581 thimet oligopeptidase
FT                   (EC 3.4.24.15) [imported] - Bacillus licheniformis
FT                   >gi|1651216|dbj|BAA13561.1| (D88209) Pz-peptidase [Bacillus
FT                   licheniformis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33583"
FT                   /db_xref="GOA:Q9A0U8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U8"
FT                   /protein_id="AAK33583.1"
FT                   /translation="MELKKRSEFPENELWDLTALYKDRQDFLLAIEKALQDIDLFKRNY
FT                   EGRLTSVDDFTQALIEIEHIYIQMSHIGTYAFMPQTTDFSDESFAQIAQAGDDFMTKAS
FT                   VALSFFDTALANADLDVLDTLEKNPYFSAAIRMAKIQKEHLLSPDVEKALANLREVINA
FT                   PYDIYTKMRAGDFDMDDFEVDGKTYKNSFVSYENFYQNHENAEIREKAFRSFSKGLRKH
FT                   QNTAAAAYLAKVKSEKLLADMKGYASVFDYLLAEQEVDRSLFDRQIDLIMTEFGPVAQK
FT                   FLKHVAQVNGLEKMTFADWKLDIDNDLNPEVSIDGAYDLVMKSLAPLGQEYTKEIERYQ
FT                   TERWVDFAANANKDSGGYAADPYKVHPYVLMSWTGRMSDVYTLIHEIGHSGQFIFSDNH
FT                   QSYFNTHMSTYYVEAPSTFNELMLSDYLEHQFDDPRQKRFALAHRLTDTYFHNFITHLL
FT                   EAAFQRKVYTLIEEGGTFGADQLNAMMKEVLTDFWGDAVDIDDDAALTWMRQAHYYMGL
FT                   YSYTYSAGLVISTAGYLNLKHNPNGAKEWLDFLKSGGSRTPLDTAMLIGADIATEKPLR
FT                   DTIQFLSDTVDQIISYTEDMSHA"
FT   gene            487638..490400
FT                   /gene="ppc"
FT                   /locus_tag="SPy_0608"
FT                   /old_locus_tag="SPy0608"
FT   CDS_pept        487638..490400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="SPy_0608"
FT                   /old_locus_tag="SPy0608"
FT                   /product="putative phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="Best Blastp hit = sp|O32483|CAPP_RHOPA
FT                   PHOSPHOENOLPYRUVATE CARBOXYLASE (PEPCASE) (PEPC)
FT                   >gi|2339975|dbj|BAA21835.1| (D89668) phosphoenolpyruvate
FT                   carboxylase [Rhodopseudomonas palustris]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33584"
FT                   /db_xref="GOA:Q9A0U7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0U7"
FT                   /protein_id="AAK33584.2"
FT                   /translation="MPLKKLESSNNQDIIAEEVALLKEMLENITRRMIGDDAFTVIESI
FT                   MVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTDTD
FT                   YLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRD
FT                   AKAGVINLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTT
FT                   EYKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDEL
FT                   AALYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTN
FT                   QPAARMSSSVGLNTSAWSSPASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGD
FT                   LREVMQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLLQQ
FT                   LMEEPRTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELA
FT                   IMLKEVGLVDQQRARVQIVPLFETIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIML
FT                   GYSDSNKDGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITS
FT                   QPFGSIKDRIRLTEQGEIIENKYGNKDVAYYHLEMLISASINRMVTQMITDPNEIDSFR
FT                   EIMDSIVADSNIIYRKLVFDNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLR
FT                   AIPWVFSWSQNRIMFPGWYGVGSAFKRYIDRAQGNLERLQHMYQTWPFFHSLLSNVDMV
FT                   LSKSNMNIAFQYAQLAERQDVRDVFYEILDEWQLTKNVILAIQDHDDLLEDNPSLKHSL
FT                   KSRLPYFNVLNYIQIELIKRWRNNQLDENDEKLIHTTINGIATGLRNSG"
FT   gene            490540..491844
FT                   /gene="ftsW"
FT                   /locus_tag="SPy_0609"
FT                   /old_locus_tag="SPy0609"
FT   CDS_pept        490540..491844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SPy_0609"
FT                   /old_locus_tag="SPy0609"
FT                   /product="putative cell division protein"
FT                   /note="Best Blastp hit = sp|Q47866|FTSW_ENTHR PROBABLE CELL
FT                   DIVISION PROTEIN FTSW >gi|1469784|gb|AAB39929.1| (U58049)
FT                   putative cell division protein ftsW [Enterococcus hirae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33585"
FT                   /db_xref="GOA:Q9A0U6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U6"
FT                   /protein_id="AAK33585.1"
FT                   /translation="MIISRSRGKTMKIDKRHLLNYSILLPYLILSVIGLIMVYSTTSVS
FT                   LIQAHANPFKSVINQGVFWIISLVAITFIYKLKLNFLTNTRVLTVVMLGEAFLLIIARF
FT                   FTTAIKGAHGWIVIGPVSFQPAEYLKIIMVWYLALTFAKIQKNISLYDYQALTRRKWWP
FT                   TQWNDLRDWRVYSLLMVLLVAAQPDLGNASIIVLTAIIMFSISGIGYRWFSAILVMITG
FT                   LSTVFLGTIAVIGVERVAKIPVFGYVAKRFSAFFNPFHDLTDSGHQLANSYYAMSNGGW
FT                   FGQGLGNSIEKRGYLPEAQTDFVFSVVIEELGLIGAGFILALVFFLILRIMNVGIKAKN
FT                   PFNAMMALGVGGMMLMQVFVNIGGISGLIPSTGVTFPFLSQGGNSLLVLSVAVGFVLNI
FT                   DASEKRDDIFKEAELSYRKDTRKENSKVVNIKQFQ"
FT   gene            492198..493394
FT                   /gene="tufA"
FT                   /locus_tag="SPy_0611"
FT                   /old_locus_tag="SPy0611"
FT   CDS_pept        492198..493394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="SPy_0611"
FT                   /old_locus_tag="SPy0611"
FT                   /product="putative translation elongation factor EF-Tu"
FT                   /note="Best Blastp hit = sp|P33170|EFTU_STROR ELONGATION
FT                   FACTOR TU (EF-TU) >gi|320486|pir||F60663 translation
FT                   elongation factor EF-Tu - Streptococcus oralis"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33586"
FT                   /db_xref="GOA:P69952"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69952"
FT                   /protein_id="AAK33586.1"
FT                   /translation="MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVN
FT                   QPKDYASIDAAPEERERGITINTAHVEYETATRHYAHIDAPGHADYVKNMITGAAQMDG
FT                   AILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSE
FT                   YDFPGDDLPVIQGSALKALEGDTKFEDIIMELMDTVDSYIPEPERDTDKPLLLPVEDVF
FT                   SITGRGTVASGRIDRGTVRVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLAGDNVGI
FT                   LLRGVQRDEIERGQVIAKPSSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQFYFRTT
FT                   DVTGSIELPAGTEMVMPGDNVTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA"
FT   gene            493635..494393
FT                   /gene="tpi"
FT                   /locus_tag="SPy_0613"
FT                   /old_locus_tag="SPy0613"
FT   CDS_pept        493635..494393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /locus_tag="SPy_0613"
FT                   /old_locus_tag="SPy0613"
FT                   /product="putative triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="The N-terminal amino acid sequence of this ORF has
FT                   been determined from a spot isolated by 2-D gel
FT                   electrophoresis from another strain of S. pyogenes. Hogan,
FT                   D. A., Whitton, M. M., Rogers, J. and R. A. VanBogelen.
FT                   2000. Two-dimensional gel electrophoresis map of
FT                   Streptococcus pyogenes proteins. Unpublished data.; Best
FT                   Blastp hit = sp|O32757|TPIS_LACDE TRIOSEPHOSPHATE ISOMERASE
FT                   (TIM) >gi|7437339|pir||T09635 triose-phosphate isomerase
FT                   (EC 5.3.1.1) - Lactobacillus delbrueckii
FT                   >gi|2624193|emb|CAA04016.1| (AJ000339) triosephosphate
FT                   isomerase [Lactobacillus delbrueckii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33587"
FT                   /db_xref="GOA:P69887"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69887"
FT                   /protein_id="AAK33587.1"
FT                   /translation="MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPA
FT                   VDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFH
FT                   ETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASL
FT                   VLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKD
FT                   YMACPDVDGALVGGASLEADSFLALLDFLN"
FT   gene            complement(494492..495727)
FT                   /gene="murN"
FT                   /locus_tag="SPy_0615"
FT                   /old_locus_tag="SPy0615"
FT   CDS_pept        complement(494492..495727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murN"
FT                   /locus_tag="SPy_0615"
FT                   /old_locus_tag="SPy0615"
FT                   /product="putative peptidoglycan branched peptide synthesis
FT                   protein, alanine adding enzyme"
FT                   /note="Best Blastp hit = emb|CAB89121.1| (AJ277485)
FT                   beta-lactam resistance factor [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33588"
FT                   /db_xref="GOA:Q9A0U5"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U5"
FT                   /protein_id="AAK33588.1"
FT                   /translation="MALIEISQEQFDHYCHSLVHHSFIQTSEMASLMAKRGAKPQFLGL
FT                   EKDGELKVAAMVFSQKVAGGWRMELNAGPNTNHPEELEHFYTQLKDYAKQKDVIELILK
FT                   PYDNYQSFDTDGIPISRPNTDLISLLTALGYKHDGLKTGYPEGEPVWHYVKKLEGIDSS
FT                   RLTRSFSKKGKALIKKANTFGIKLRQLKRDELHHFKEITEATSDRRDYLDKSLSYYQDF
FT                   YDSFGDSCEFMVATLNFEDYLNNLKQRQLQLATSINKVKGDLGKNPHSEKKQNRLKELS
FT                   SQFETFQVRISEALHFLEEYGTKDVFLAGSLFIYTEQEAVYLFSGSYPKFNKFYSPALL
FT                   QEHAMLKAIHKGIKQYNFLGITGKFDGSDGVLRFKQNFNGFILQKPGTFRCYPFPIKYH
FT                   FIRLAKKLLNRY"
FT   gene            complement(495714..496940)
FT                   /gene="murM"
FT                   /locus_tag="SPy_0616"
FT                   /old_locus_tag="SPy0616"
FT   CDS_pept        complement(495714..496940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murM"
FT                   /locus_tag="SPy_0616"
FT                   /old_locus_tag="SPy0616"
FT                   /product="putative peptidoglycan branched peptide synthesis
FT                   protein, serine/alanine adding enzyme"
FT                   /note="Best Blastp hit = emb|CAB89535.1| (AJ250764) MurM
FT                   protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33589"
FT                   /db_xref="GOA:Q9A0U4"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U4"
FT                   /protein_id="AAK33589.1"
FT                   /translation="MYTYKIGISPEEHDQFVLAQPQAGLLQSSKWGKVKDNWKHERISF
FT                   YENGVQVAAAACLIRKLPLGFTMIYIPRGPIMDYANFELLDFVIKTLKTFGKSKRALFI
FT                   KIDPSLVIKQTLEGKESKENDVTLSIIAFLKKLGVEWSGRTKELEDTIQPRIQANIYAK
FT                   DFDFDSLPKKAKQSIRTATNKGVNVTIGGSELLDDFSALMKKTENRKGIILRGKSYYQK
FT                   LLGIYAGQSYITMASLDLPEQKKLLIQQLDKALAEQARLTDKSKPSKVAENQKTIARLQ
FT                   KDLTILSEQLATGQTRIPLAATLTLIYGETSENLYAGMDDDYRNYQAPLLTWYETAKEA
FT                   FKRGCRWHNLGGVENQQDGGLYHFKARLNPTIEEFAGEFNIPVGLVSSLAILTYNLRKK
FT                   LRSTTNGTN"
FT   gene            complement(496940..497749)
FT                   /locus_tag="SPy_0617"
FT                   /old_locus_tag="SPy0617"
FT   CDS_pept        complement(496940..497749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0617"
FT                   /old_locus_tag="SPy0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P09997|YIDA_ECOLI HYPOTHETICAL
FT                   29.7 KD PROTEIN IN IBPA-GYRB INTERGENIC REGION
FT                   >gi|7429213|pir||QQECGB hypothetical 29.7K protein,
FT                   ibpA-gyrB intergenic region - Escherichia coli (strain
FT                   K-12) >gi|2367265|gb|AAC76720.1| (AE000446) orf,
FT                   hypothetical protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33590"
FT                   /db_xref="GOA:Q9A0U3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U3"
FT                   /protein_id="AAK33590.1"
FT                   /translation="MSIKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGR
FT                   PIAGVISLLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLG
FT                   VHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLD
FT                   AAIKQIPQHFFDKYTIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAEN
FT                   DRAMLEVVANPVVMENGVPELKKIAKYITKSNNDSGVAHAIRKWVLN"
FT   gene            complement(497900..498133)
FT                   /locus_tag="SPy_0619"
FT                   /old_locus_tag="SPy0619"
FT   CDS_pept        complement(497900..498133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0619"
FT                   /old_locus_tag="SPy0619"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33591"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U2"
FT                   /protein_id="AAK33591.1"
FT                   /translation="MEFYALFLSLGSQKFRVTSLPVLTPLLPQQKAAVLAHVTRRNKKS
FT                   VVKSAEQFMLFEHQTGFVSILRLKKEYFLQSF"
FT   gene            complement(498205..499506)
FT                   /locus_tag="SPy_0621"
FT                   /old_locus_tag="SPy0621"
FT   CDS_pept        complement(498205..499506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0621"
FT                   /old_locus_tag="SPy0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|P39651|YWFO_BACSU HYPOTHETICAL
FT                   51.0 KD PROTEIN IN PTA 3'REGION >gi|7450837|pir||G70056
FT                   ywfO protein - Bacillus subtilis
FT                   >gi|1561567|emb|CAB02494.1| (Z80355) Unknown [Bacillus
FT                   subtilis] >gi|2636296|emb|CAB15787.1| (Z99123) alternate
FT                   gene name: ipa-93d; similar to hypothetical proteins
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33592"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U1"
FT                   /protein_id="AAK33592.1"
FT                   /translation="MNEKVFRDPVHNYIHIDNPLIYDLINTKEFQRLRRIKQVPTTAFT
FT                   FHGAEHSRFSHCLGVYEIARRVTAIFEEKYADIWNKDESLVTMTAALLHDIGHGAYSHT
FT                   FEVLFHTDHEAFTQEIITNPETEINAILVRHAPDFPDKVASVINHTYPNKQVVQLISSQ
FT                   IDCDRMDYLLRDSYFSAANYGQFDLMRILRVIRPVEDGIVFEHSGMHAVEDYIVSRFQM
FT                   YMQVYFHPASRAVELILQNLLKRAQHLYPEQQAYFQKTAPGLIPFFEKKANLADYIALD
FT                   DGVMNTYFQVWMASEDHILSDLASRFINRKILKSVTFDQDSQGELERLRQLVESVGFDP
FT                   DYYTGIHINFDLPYDIYRPELENPRTQIEMMQKDGSLAELSQLSPIVKALTGTTYGDRR
FT                   FYFPKEMLELDDLFAPSKETFMSYISNGHFHFSQ"
FT   gene            499588..499974
FT                   /locus_tag="SPy_0622"
FT                   /old_locus_tag="SPy0622"
FT   CDS_pept        499588..499974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0622"
FT                   /old_locus_tag="SPy0622"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33593"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0U0"
FT                   /protein_id="AAK33593.1"
FT                   /translation="MKLQLTNHIRFGDETEIIQEIHDCEWREKGGYQYLIYQNTDKEKV
FT                   VIKYNETELTMSRFSNPQSIMKFFAGKKVLIALPTPMGVQQFLTDTSHYHLDCSCQKLD
FT                   LHYHLLQAQTEMLFASYHLELSWD"
FT   gene            500205..502886
FT                   /gene="pacL"
FT                   /locus_tag="SPy_0623"
FT                   /old_locus_tag="SPy0623"
FT   CDS_pept        500205..502886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL"
FT                   /locus_tag="SPy_0623"
FT                   /old_locus_tag="SPy0623"
FT                   /product="putative calcium-transporting ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Best Blastp hit = pir||H69877 calcium-transporting
FT                   ATPase homolog yloB - Bacillus subtilis
FT                   >gi|2337795|emb|CAA74269.1| (Y13937) putative PacL protein
FT                   [Bacillus subtilis] >gi|2633938|emb|CAB13439.1| (Z99112)
FT                   similar to calcium-transporting ATPase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33594"
FT                   /db_xref="GOA:Q9A0T9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T9"
FT                   /protein_id="AAK33594.1"
FT                   /translation="MSKEQRHEAFYTQSEETVLAQLETSREGLTSAQAKERLAEYGRNE
FT                   LDEGEKRSLFMKFLDQFKDLMIIILIVAALLSVLTEGMEGLTDAIIILAVVILNAAFGV
FT                   YQEGQAEAAIEALKSMSSPLARIRRDGHVTEIDSKELVPGDIVLLEAGDVVPADLRLLE
FT                   ANSLKIEEAALTGESVPVEKDLSTAVSEDAGIGDRVNMGYQNSNVTYGRGIGVITNTGM
FT                   YTEVGHIAGMLANADETDTPLKQNLDNLSKILTYAILVIAAVTFAVGVFLRGQHPLEGL
FT                   MTSVALAVAAIPEGLPAIVTVVLSLGTQVLAKRNAIIRKLPAVETLGSTEIIASDKTGT
FT                   LTMNQMTVEKVYTNGTLQSSSADIAFDNTTLRVMNFANDTKVDPSGKLIGDPTETALVE
FT                   FGLDHNFDVREAMVAEPRVAELPFDSDRKLMSTIHKQADGKYFIAVKGAPDQLLKRVTQ
FT                   IEENGQIRPITDADKKTILDTNKSLAKQALRVLMMAYKYSDALPTLETEIVEANLVFSG
FT                   LVGMIDPERPEAAQAVKVAKEAGIRPIMITGDHQDTAKAIAKRLGIIEEDGVDHVFTGA
FT                   ELNELSDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNEGKVVAMTGDGVNDAPSLKTAD
FT                   IGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKTIQYLLSANMAEVF
FT                   TIFLATLFGWDVLQPVHLLWINLVTDTLPAIALGVEPAEPGVMKHKPRGRKSSFFDGGV
FT                   KEAILYQGAFQTILVLGVYGFALMFPEHTSYHDVHADALTMAYVTLGLIQLVHAYNVKS
FT                   VYQSIFTVGLFKNKLFNYSIPVAFVALMATVVVPGFNQFFHVTHLTITQWLVVIIGSLL
FT                   MVVLVELVKAVQRSLGQDEKAI"
FT   gene            complement(502970..503965)
FT                   /gene="regR"
FT                   /locus_tag="SPy_0627"
FT                   /old_locus_tag="SPy0627"
FT   CDS_pept        complement(502970..503965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="SPy_0627"
FT                   /old_locus_tag="SPy0627"
FT                   /product="putative transcriptional regulator (LacI family)"
FT                   /note="Best Blastp hit = sp|P50844|KDGR_BACSU KDG OPERON
FT                   REPRESSOR >gi|7442871|pir||B69648 transcription repressor
FT                   of pectin utilization operon kdgR - Bacillus subtilis
FT                   >gi|1146188|gb|AAB38478.1| (L47838) repressor protein
FT                   [Bacillus subtilis] >gi|2634631|emb|CAB14129.1| (Z99115)
FT                   transcriptional regulator (LacI family) [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33595"
FT                   /db_xref="GOA:Q9A0T8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T8"
FT                   /protein_id="AAK33595.1"
FT                   /translation="MQRKVTIKDIAELAKTSKTTVSFYLNGRFDKMSEETKNRISESIK
FT                   ATNYKPSIAARSLNAKSTKLIGVVIGDITNSFSNQIVKGIESKAQEFGYQIIIGNSNYD
FT                   PSREDELIEKMLNLGVDGFIIQPTSNFRKYSRIIDIKKKKVVFFDSQLYEHRTNWVKTN
FT                   NYDAVYDTIQQCIDKGYEHFIMITGNPNLLSTRIERASGFIDVLEANHLTHQEMIIDEN
FT                   QTSSEAIAQFLQGSLTKKSLVFVPNCWALPKVFTAMKSLKFNIPEIGLVGFDNIEWTKF
FT                   SSPTLTTIIQPAYEEGEQATKILIDDIEGHSQEAKQQIFDCQVNWQESTF"
FT   gene            complement(504029..505936)
FT                   /locus_tag="SPy_0628"
FT                   /old_locus_tag="SPy0628"
FT   CDS_pept        complement(504029..505936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0628"
FT                   /old_locus_tag="SPy0628"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||T36084 hypothetical protein
FT                   SCE134.02c - Streptomyces coelicolor
FT                   >gi|4678627|emb|CAB41200.1| (AL049661) hypothetical protein
FT                   [Streptomyces coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33596"
FT                   /db_xref="GOA:Q9A0T7"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T7"
FT                   /protein_id="AAK33596.1"
FT                   /translation="MFFAFARFKETVNPDFCRNYLLDYQTDSYADQKRIADLLLTNTFL
FT                   FEDNWDMEPCHIPYHLDPITWQEAVIDDPEWNFMLNRQTYLQKLILVYLVERDERYLLT
FT                   AKGFILNWIESAIPLDPKGLATRTLDTGIRCFAWVKCLIYLNLFNALTKQEESLILASL
FT                   EKQLQFLHANYLDKYSLSNWGILQTTAILLADAYFGSDLDIAAATAFARKELTQQIALQ
FT                   ILEDGSQFEQSTMYHVEVLKALLELTALVPDYLPQLRPTLLAMSDYLLKMTGPDHKQIP
FT                   LGDSDVTDTRDILTLAATILEEPHLKAAAFPTLDIDSLLLLGEKGVHTFEQLPVQTLPT
FT                   FAHHFEHSGHITINQENYYLFFKNGPIGSSHTHSDQNSLCLYYKGQPLFCDAGRYTYKE
FT                   EPLRYALKSASHHSTAFLEEQLPEQIDSSWAYLSYPKSNYCHLRQNGHVYFIEGSYQTQ
FT                   FSDRNNYQHDRQILILPPGIFLIIDTIQAQGNHCLVSQFILDNHLDVKTDHLSDLRLIS
FT                   DCPFTIEETILSKKYNQYLTSHKLIKRKPFKDKGCTSTLLVPDDTKVTPLTPLQTGKRN
FT                   PIETALSWHLKGKQFDYSICVLQEDLIKGEKLVLLNSHKIRGKVVVINHITNEIIRLKH
FT                   "
FT   gene            complement(506023..506844)
FT                   /gene="agaD"
FT                   /locus_tag="SPy_0629"
FT                   /old_locus_tag="SPy0629"
FT   CDS_pept        complement(506023..506844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaD"
FT                   /locus_tag="SPy_0629"
FT                   /old_locus_tag="SPy0629"
FT                   /product="putative PTS dependent galactosamine IID
FT                   component"
FT                   /note="Best Blastp hit = sp|P42911|PTPD_ECOLI PTS SYSTEM,
FT                   N-ACETYLGALACTOSAMINE-SPECIFIC IID COMPONENT (EIID-AGA)
FT                   (N-ACETYLGALACTOSAMINE-PERMEASE IID COMPONENT)
FT                   (PHOSPHOTRANSFERASE ENZYME II, D COMPONENT)
FT                   >gi|7434458|pir||H65103 pts system,
FT                   n-acetylgalactosamine-specific IID component - Escherichia
FT                   coli (strain K-12) >gi|1789529|gb|AAC76174.1| (AE000395)
FT                   PTS system, N-acetylglucosamine enzyme IID component 1
FT                   [Escherichia coli] >gi|8895756|gb|AAF81092.1|AF228498_12
FT                   (AF228498) AgaD [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33597"
FT                   /db_xref="GOA:Q9A0T6"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T6"
FT                   /protein_id="AAK33597.1"
FT                   /translation="MTGSNKLTKKDYLKTALRAFFLQNGFNYNNYQGIGYANVIYPALK
FT                   KHFGNDKKGLYQALEDNCEFYNTNPHFLPFITSLHLVMLENNRPEEETRNIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASLASDGLVLGPILFFLAMNIILTAIKIGSGLYGYKVGT
FT                   SFIDKLSEQMAVVSRMANIVGVTVIAGLAATSVKITVPITFAAGKVDAANTAQKFVTIQ
FT                   GMLDKIAPALLPALFTLLMYYLIKNKKWTTYKLVILTVIIGVIGSWLGILA"
FT   gene            complement(506831..507613)
FT                   /gene="agaW"
FT                   /locus_tag="SPy_0630"
FT                   /old_locus_tag="SPy0630"
FT   CDS_pept        complement(506831..507613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaW"
FT                   /locus_tag="SPy_0630"
FT                   /old_locus_tag="SPy0630"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-IIC
FT                   component"
FT                   /note="Best Blastp hit = gb|AAF81084.1|AF228498_4
FT                   (AF228498) AgaW [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33598"
FT                   /db_xref="GOA:Q9A0T5"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T5"
FT                   /protein_id="AAK33598.1"
FT                   /translation="MDINLLQALLIGLWTAFCFSGMLLGIYTNRCIILSFGVGIILGDL
FT                   PTALSMGAISELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVTPEAALALSTPI
FT                   AVAIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIWAFAFIGLGLGLLGALS
FT                   MDTLLHLVDYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQI
FT                   PTIGIAIIGIIFALNEFYNKPKQVDATTVQGGQQDDWI"
FT   gene            complement(507632..508120)
FT                   /gene="agaV"
FT                   /locus_tag="SPy_0631"
FT                   /old_locus_tag="SPy0631"
FT   CDS_pept        complement(507632..508120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaV"
FT                   /locus_tag="SPy_0631"
FT                   /old_locus_tag="SPy0631"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-IIB
FT                   component"
FT                   /note="Best Blastp hit = sp|P42904|PTPV_ECOLI PTS SYSTEM,
FT                   N-ACETYLGALACTOSAMINE-SPECIFIC IIB COMPONENT 2 (EIIB-AGA')
FT                   (N-ACETYLGALACTOSAMINE-PERMEASE IIB COMPONENT 2)
FT                   (PHOSPHOTRANSFERASE ENZYME II, B COMPONENT 2)"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33599"
FT                   /db_xref="GOA:Q9A0T4"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="PDB:3P3V"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T4"
FT                   /protein_id="AAK33599.1"
FT                   /translation="MTQPNIIMTRVDERLIHGQGQLWVKFLNCNTVIVANDAVSEDKIQ
FT                   QSLMKTVIPSSIAIRFFSIQKVIDIIHKASPAQSIFIVVKDLQDAKLLVEGGVPITEIN
FT                   IGNIHKTDDKVAITQFISLGETDKSAIRCLAHDHHVVFNTKTTPAGNSASDVDILDYI"
FT   gene            complement(508156..509355)
FT                   /gene="ugl"
FT                   /locus_tag="SPy_0632"
FT                   /old_locus_tag="SPy0632"
FT   CDS_pept        complement(508156..509355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugl"
FT                   /locus_tag="SPy_0632"
FT                   /old_locus_tag="SPy0632"
FT                   /product="putative unsaturated glucuronyl hydrolase"
FT                   /note="Best Blastp hit = dbj|BAB05773.1| (AP001514)
FT                   unsaturated glucuronyl hydrolase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33600"
FT                   /db_xref="GOA:Q9A0T3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0T3"
FT                   /protein_id="AAK33600.1"
FT                   /translation="MARPLKTIALEPIKQPERFTKEDFLSQEDITQALDLALKQVRLNM
FT                   DYFKEDFPTPATKDNQYAIMDNTEWTNAFWTGCLWLAYEYSGDDAIKALAQANDLSFLD
FT                   RVTRDIELDHHDLGFLYTPSCMAEWKLLKTPESREAALKAADKLVQRYQDKGGFIQAWG
FT                   ELGKKEDYRLIIDCLLNIQLLFFASQETGDNRYRDMAINHFYASANHVIRDDASAYHTF
FT                   YFDPETGDPVKGVTRQGYSDDSAWARGQAWGIYGIPLTYRFLKEPELIQLFKGMTHYFL
FT                   NRLPKDQVSYWDLIFGDGSEQSRDSSATAIAVCGIHEMLKTLPDHDPDKKTYEAAMHSM
FT                   LRALIKDYANKDLKPGAPLLLHGVYSWHSGKGVDEGNIWGDYYYLEALLRFYKDWNPYW
FT                   "
FT   gene            complement(509355..509792)
FT                   /gene="agaF"
FT                   /locus_tag="SPy_0634"
FT                   /old_locus_tag="SPy0634"
FT   CDS_pept        complement(509355..509792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaF"
FT                   /locus_tag="SPy_0634"
FT                   /old_locus_tag="SPy0634"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-and
FT                   galactosamine IIA component"
FT                   /note="Best Blastp hit = gb|AAC44682.1| (U65015) PTS
FT                   permease for mannose subunit IIIMan N terminal domain
FT                   [Vibrio furnissii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33601"
FT                   /db_xref="GOA:Q9A0T2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T2"
FT                   /protein_id="AAK33601.1"
FT                   /translation="MIAIIVMGHGHFASGIVSALELIAGKQEKVTAIDFTTEMTAADVQ
FT                   DQLSRALIPEEETLVLCDLLGGTPFKVAATLMESLPNTTCNVLSGLNLAMLIEASFARQ
FT                   TAASFDDLVSGLITCSKEGIVDWKTLSQQEDGATDDELGGI"
FT   gene            510128..510922
FT                   /gene="idnO"
FT                   /locus_tag="SPy_0636"
FT                   /old_locus_tag="SPy0636"
FT   CDS_pept        510128..510922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnO"
FT                   /locus_tag="SPy_0636"
FT                   /old_locus_tag="SPy0636"
FT                   /product="putative 5-keto-D-gluconate 5-reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Best Blastp hit = sp|P39345|IDNO_ECOLI GLUCONATE
FT                   5-DEHYDROGENASE (5-KETO-D-GLUCONATE 5-REDUCTASE)
FT                   >gi|1361067|pir||S56492 hypothetical 27.6K protein
FT                   (pepa-gntv intergenic region) - Escherichia coli
FT                   >gi|537108|gb|AAA97163.1| (U14003) ORF_f254 [Escherichia
FT                   coli] >gi|1790717|gb|AAC77223.1| (AE000497)
FT                   5-keto-D-gluconate 5-reductase [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33602"
FT                   /db_xref="GOA:Q9A0T1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4Z9X"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T1"
FT                   /protein_id="AAK33602.1"
FT                   /translation="MENMFSLQGKIALITGASYGIGFEIAKAYAQAGATIVFNDIKQEL
FT                   VDKGLAAYRELGIEAHGYVCDVTDEAGIQQMVSQIEDEVGAIDILVNNAGIIRRTPMLE
FT                   MAAEDFRQVIDIDLNAPFIVSKAVLPSMIAKGHGKIINICSMMSELGRETVSAYAAAKG
FT                   GLKMLTKNIASEFGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAKTPAA
FT                   RWGTTEDLAGPAVFLASDASNFVNGHILYVDGGILAYIGKQP"
FT   gene            510947..511588
FT                   /locus_tag="SPy_0637"
FT                   /old_locus_tag="SPy0637"
FT   CDS_pept        510947..511588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0637"
FT                   /old_locus_tag="SPy0637"
FT                   /product="sugar-phosphate isomerase"
FT                   /note="Best Blastp hit = pir||H72296 sugar-phosphate
FT                   isomerase - Thermotoga maritima (strain MSB8)
FT                   >gi|4981625|gb|AAD36157.1|AE001768_6 (AE001768)
FT                   sugar-phosphate isomerase [Thermotoga maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33603"
FT                   /db_xref="GOA:Q9A0T0"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0T0"
FT                   /protein_id="AAK33603.1"
FT                   /translation="MKIALINENSQAAKNGIIYDALTTVTDKHGYQVFNYGMYGTEGES
FT                   QLTYVQNGLLASILLTTKAADFVVTGCGTGVGAMLALNSFPGVTCGFASEPTEAYLFSQ
FT                   INGGNALSIPFAKGFGWGAELNLTLIFERLFAEPMGGGYPKERAIPEQRNARILSDLKK
FT                   ITYRDLLAIVKDIDQDFLKETISGAHFQEYFFANAEPSELVTYLKSVLEQ"
FT   gene            511617..512618
FT                   /gene="kdgK"
FT                   /locus_tag="SPy_0638"
FT                   /old_locus_tag="SPy0638"
FT   CDS_pept        511617..512618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="SPy_0638"
FT                   /old_locus_tag="SPy0638"
FT                   /product="putative 2-keto-3-deoxygluconate kinase"
FT                   /note="Best Blastp hit = pir||G72422
FT                   2-keto-3-deoxygluconate kinase - Thermotoga maritima
FT                   (strain MSB8) >gi|4980554|gb|AAD35161.1|AE001693_7
FT                   (AE001693) 2-keto-3-deoxygluconate kinase [Thermotoga
FT                   maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33604"
FT                   /db_xref="GOA:Q9A0S9"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S9"
FT                   /protein_id="AAK33604.1"
FT                   /translation="MSKLLLVGEPLIRVSPNQFQPLTNACEAQLFFGGSEVNIARTLGG
FT                   FGLEARLFTALPDNPVGHAFHQFLKQSGVDMSLTAWQGHRVGLYYLENGFGCRASQVYY
FT                   DRCGSSFSALDKDSLDLAAIFEGISHFHFSGISLALGKKTQDLIEVLVREAKKRDICIS
FT                   FDLNFRSSMIAVADAKRLFSHFAQYADIIFGMEPLLLDSDDFDMFDRKKADTTTIRERL
FT                   AGLYQRYQLQAIYHTERSNDAQGSNHFKAYAYDRQFYESCEVTTPVLQRVGSGDAFVAG
FT                   LLYQLLEGNEKQRNLDFAVATASLKCTVAEDQLYHSVQQVEAVLANQRDIQR"
FT   gene            512623..513258
FT                   /gene="kgdA"
FT                   /locus_tag="SPy_0639"
FT                   /old_locus_tag="SPy0639"
FT   CDS_pept        512623..513258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgdA"
FT                   /locus_tag="SPy_0639"
FT                   /old_locus_tag="SPy0639"
FT                   /product="putative 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="Best Blastp hit = pir||F72422 KHG-KDPG bifunctional
FT                   aldolase TM0066 [similarity] - Thermotoga maritima (strain
FT                   MSB8) >gi|4980553|gb|AAD35160.1|AE001693_6 (AE001693)
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase [Thermotoga
FT                   maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33605"
FT                   /db_xref="GOA:Q9A0S8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S8"
FT                   /protein_id="AAK33605.1"
FT                   /translation="MGKIEILTKLKANRLVLVVRGESSEEALACSLASIEGGIKTIEVT
FT                   YTNPFASEVIGQLAERFKEDPEVLIGAGTVLDDVTARQAILAGAQFIVGPNFNRAVALI
FT                   CHRYSIPYLPGCMTVNEVVTALESGVDMVKIFPGSTVGISFIRAIKSPLPQVEVMVTGG
FT                   VSSDNLKDWLAAGVDVLGIGGEFNQLASQKQYNLITKKAAHYIKSLRQ"
FT   gene            513548..514204
FT                   /locus_tag="SPy_0640"
FT                   /old_locus_tag="SPy0640"
FT   CDS_pept        513548..514204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0640"
FT                   /old_locus_tag="SPy0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|O33513|CBBY_RHOCA CBBY PROTEIN
FT                   >gi|7435099|pir||T10510 cbbY protein - Rhodobacter
FT                   capsulatus >gi|2564976|gb|AAB82052.1| (U23145) CbbY
FT                   [Rhodobacter capsulatus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33606"
FT                   /db_xref="GOA:Q9A0S7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S7"
FT                   /protein_id="AAK33606.1"
FT                   /translation="MLMIKGIIFDMDGVLFDTEPFYLRRREDFFKTKGIPIDHLNSKDF
FT                   IGGNLQELWKELLGKNRDDAIVKAITTDYDAYKQAHKPPYQKLLITEVNSCLEQLEKQG
FT                   IKLAVASNSKRQDVLLALETTQIKDYFEIILAREDVSRGKPYPDIYNKAVQKLGLQKKQ
FT                   LLVVEDSQKGIAAAKAANLTVFAITDYRYGIDQSQADHKIDHLGQLCVKIGCFGS"
FT   gene            514845..516020
FT                   /locus_tag="SPy_0642"
FT                   /old_locus_tag="SPy0642"
FT   CDS_pept        514845..516020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0642"
FT                   /old_locus_tag="SPy0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||E69820 conserved hypothetical
FT                   protein yhbA - Bacillus subtilis
FT                   >gi|1903044|emb|CAB07527.1| (Z93102) hypothetical 48.5 kd
FT                   protein [Bacillus subtilis] >gi|2633214|emb|CAB12719.1|
FT                   (Z99108) alternate gene name: ygaP; similar to hypothetical
FT                   proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33607"
FT                   /db_xref="GOA:Q9A0S6"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S6"
FT                   /protein_id="AAK33607.1"
FT                   /translation="MSFFFLEVLTYFDYDSSMTIKAEIKALAKEIGISKIGFTTADNFD
FT                   YLEKSLRASVEEGRNSGFEHKVIEDRIYTERLLESAKTIISIGVAYPHKLPQQPQKTPY
FT                   KRGKITPSSWGLDYHYVVGEKLDRLSKGIEELCRDFPLQQKAMVDTGALVDTAVAQRAG
FT                   IGFIGKNGLVISKEYGSYMFLGELITNLEIEPDKPVDYDCGDCRRCLDACPTSCLIGDG
FT                   SMNAKRCLSFQTQDKGMMDIEFRKKIKTVIYGCDICQICCPYNKGINNSPATEIDPELA
FT                   QPELIPFLSLSNGKFKEKFGMIAGSWRGKNILQRNAIIALANAHDKTAVVKLIEIIDKN
FT                   NNPIHTATAIWALGEIVKKPNDEILAFMSHLTLKDEDSRKELELIRHKWQF"
FT   gene            516174..517187
FT                   /gene="prfB"
FT                   /locus_tag="SPy_0643"
FT                   /old_locus_tag="SPy0643"
FT   CDS_pept        516174..517187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="SPy_0643"
FT                   /old_locus_tag="SPy0643"
FT                   /product="putative peptide chain release factor 2"
FT                   /note="There is an ATG start codon with a strong RBS
FT                   consensus site located in an alternate reading frame
FT                   upstream of the predicted start codon. The alternate start
FT                   codon would put this ORF in good agreement with the peptide
FT                   chain release factor 2 of Bacillus subtilis. No evidence of
FT                   sequencing error was indicated in this region; Best Blastp
FT                   hit = sp|P28367|RF2_BACSU PEPTIDE CHAIN RELEASE FACTOR 2
FT                   (RF-2) >gi|7428985|pir||JN0146 translation releasing factor
FT                   RF-2 - Bacillus subtilis >gi|2331287|gb|AAC97534.1|
FT                   (AF013188) release factor 2 [Bacillus subtilis]
FT                   >gi|2618874|gb|AAC67303.1| (AF017113) putative peptide
FT                   chain release factor RF-2 [Bacillus subtilis]
FT                   >gi|2636055|emb|CAB15546.1| (Z99122) peptide chain release
FT                   factor 2 [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33608"
FT                   /db_xref="GOA:Q9A0S5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S5"
FT                   /protein_id="AAK33608.1"
FT                   /translation="MEEEIALLENHMTEPDFWNDNIAAQKTSQELNELKGKYDTFHNMQ
FT                   ELSDETELLLEMLDEDDSLKEELEENLMQLDKIMGAYEMTLLLSEPYDHNNAILEIHPG
FT                   SGGTEAQDWGDLLLRMYTRFGNANGFKIEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKS
FT                   EMGVHRLVRISPFDSAKRRHTSFASVEVMPELDDTIEVEVRDDDIKMDTFRSGGAGGQN
FT                   VNKVSTGVRLTHIPTGIVVSSTVDRTQYGNRDRAMKMLQAKLYQLEQEKKAQEVDALKG
FT                   DKKEITWGSQIRSYVFTPYTMVKDHRTNFELAQVDKVMDGEINGFIDAYLKWRIED"
FT   gene            517206..517898
FT                   /gene="ftsE"
FT                   /locus_tag="SPy_0644"
FT                   /old_locus_tag="SPy0644"
FT   CDS_pept        517206..517898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SPy_0644"
FT                   /old_locus_tag="SPy0644"
FT                   /product="putative cell-division ATP-binding protein"
FT                   /note="Best Blastp hit = pir||D69627 cell-division
FT                   ATP-binding protein ftsE - Bacillus subtilis
FT                   >gi|2618833|gb|AAC67262.1| (AF017113) cell division
FT                   ATP-binding protein [Bacillus subtilis]
FT                   >gi|2636052|emb|CAB15543.1| (Z99122) cell-division
FT                   ATP-binding protein [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33609"
FT                   /db_xref="GOA:Q9A0S4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S4"
FT                   /protein_id="AAK33609.1"
FT                   /translation="MALIEMSGVTKKYRRSTTALRDVNVSVNQGEFVYLVGPSGAGKST
FT                   FIKLLYREEQLTTGKLYVGEFNLTKLKARDVPILRRHIGVVFQDYKLLPRKTVFENVAY
FT                   AMEVIGEKRRHIKKRVPEVLDLVGLKHKMRSFPSQLSGGEQQRVAIARAIVNNPKLLIA
FT                   DEPTGNLDPEISWEIMQLLERINVQGTTILMATHNSHIVNTFRHRVVAIEDGRIVRDEE
FT                   KGDYGYDD"
FT   gene            517882..518820
FT                   /gene="ftsX"
FT                   /locus_tag="SPy_0645"
FT                   /old_locus_tag="SPy0645"
FT   CDS_pept        517882..518820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="SPy_0645"
FT                   /old_locus_tag="SPy0645"
FT                   /product="putative cell-division protein"
FT                   /note="Best Blastp hit = sp|O34876|FTSX_BACSU CELL DIVISION
FT                   PROTEIN FTSX HOMOLOG >gi|7474494|pir||G69627 cell-division
FT                   protein ftsX - Bacillus subtilis >gi|2618835|gb|AAC67264.1|
FT                   (AF017113) cell division protein [Bacillus subtilis]
FT                   >gi|2636051|emb|CAB15542.1| (Z99122) cell-division protein
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33610"
FT                   /db_xref="GOA:Q9A0S3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S3"
FT                   /protein_id="AAK33610.1"
FT                   /translation="MVTMIRYFFRHIWESIKNLKRNFWMTFASVSMVAVTLTLVGVFAA
FT                   TLLNIQRVASGVENNVHINTYLQVDSTDAAKVIQNTAGEPVNNDNYHSVYDKIAQIKGV
FT                   KKITFSSKDEQLKKLQETLGDVWNMYDQDTNPLQDIYLIETQTPKQVKAITKKIRTIEG
FT                   VEAADYGGINSDKLFKFSTLIQTWGLIGTAMLLFVAVFLISNTIRMTIMSRKRDIEIMR
FT                   LVGAKNSYIRGPFFFEGAWVGLLGAVLPSLLIYYGYDLVYKHFAQELQRNNLSMYPLDP
FT                   YVYYLIGALFVIGIMIGSLGSVLSMRRYLKF"
FT   gene            complement(519130..519828)
FT                   /locus_tag="SPy_0646"
FT                   /old_locus_tag="SPy0646"
FT   CDS_pept        complement(519130..519828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0646"
FT                   /old_locus_tag="SPy0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06539.1| (AP001516) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33611"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S2"
FT                   /protein_id="AAK33611.1"
FT                   /translation="MPFIFRYSFFNKVLIFWYTILMKIYKTINHIAGENTYYLVNDQAV
FT                   ILIDPGSNGQEIIAKIKSFEKPLVAILLTHTHYDHIFSLDLVRDAFDHPPVYVSEKEAA
FT                   WLSSPDDNLSGLGRHDDIITVIARPAENFFKLKQPYQLNGFEFTVLPTSGHSWGGVSFV
FT                   FHSDELVVTGDALFRETIGRTDLPTSNFEDLITGIRQELFTLPNHYRVYPGHGPSTTIC
FT                   HEKNANPFFH"
FT   gene            519996..520757
FT                   /locus_tag="SPy_0647"
FT                   /old_locus_tag="SPy0647"
FT                   /note="acetion reductase (budC)"
FT   gene            520868..523369
FT                   /gene="dinG"
FT                   /locus_tag="SPy_0649"
FT                   /old_locus_tag="SPy0649"
FT   CDS_pept        520868..523369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="SPy_0649"
FT                   /old_locus_tag="SPy0649"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="Best Blastp hit = dbj|BAB05410.1| (AP001512)
FT                   ATP-dependent DNA helicase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33612"
FT                   /db_xref="GOA:Q9A0S1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006310"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S1"
FT                   /protein_id="AAK33612.1"
FT                   /translation="MFCFIDIACYNRLTMTQKKLRKYAVVDLEATGAGPNASIIQVGIV
FT                   IIQGNKIIDSYETDVNPHESLDEHIVHLTGITDKQLAKAPDFGQVAHHIYQLIEDCIFV
FT                   AHNVKFDANLLAEALFLEGYELTIPRVDTVELAQLFFPRFEKYNLSHLSRQLNIDLAEA
FT                   HTAIADARATAILFLRLLQKIESLPIECLESLLVYSDSLLFETAMVIQEGLAKAKPYDP
FT                   NKYIKIRQILLPKGSKALKPYQISKSFPINMALLGLEERPKQTQFAQLIDEDYHQGVAS
FT                   FIEAQTGIGKTYGYLLPLLAKEDQNQIIVSVPTKLLQDQLMAGEVAAIQEQFHIACHSL
FT                   KGPANYLKLDSFADSLDQNDQNRLVNRYKMQLLVWLLETKTGDLDEIKQKQRFAAYFEQ
FT                   LKHDGDIKQSSEFYDYDFWRVSYEKAKTARLLITNHAYFLHRVQDDKDFARNKVLVFDE
FT                   AQKLMLQLDQLSRHQLNLTVFLQTIQAKLSNPLPLLEKRLLESLSFELGQVSSDYYQNK
FT                   EHQLAHDWSRIAGYAKELTGADYQELQAFFATSDGDYWLSSEKQEEKRVTYLNSASKAF
FT                   IHFQQLLPETVKTYFVSATLTISSEVTLADLLGFEEYLYHVIEKDKKQDQLVLVDQEAP
FT                   IVTEVSDQIYVEAIAKRIESLKQEGYPILVLFNSKKHLLLVSDYLDQWQVPHLAQEKNG
FT                   TAYNIKKRFDQGEQTILLGLGSFWEGVDFIQADRMITLIARLPFDNPEDFFVKKMSHYL
FT                   LEKGKNPFRDYFLPMTILRLKQAIGRTMRRQDQKSVVIILDRRLLTKSYGQVILEGLGQ
FT                   EFLISQQNFHDCLVETDCFLI"
FT   gene            523704..524897
FT                   /gene="aspC"
FT                   /locus_tag="SPy_0650"
FT                   /old_locus_tag="SPy0650"
FT   CDS_pept        523704..524897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="SPy_0650"
FT                   /old_locus_tag="SPy0650"
FT                   /product="putative aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="Best Blastp hit = gb|AAF12702.1|AF035157_1
FT                   (AF035157) aspartate aminotransferase [Lactococcus lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33613"
FT                   /db_xref="GOA:Q9A0S0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0S0"
FT                   /protein_id="AAK33613.1"
FT                   /translation="MPKLSKRVLEMKESVTLAAGARAKALKAQGRDVLNLTLGEPDFFT
FT                   PKHIQDKAIESIQNGTASFYTNASGLPELKAAIATYLKNQYGYHLSPDQIVAGTGAKFI
FT                   LYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGLEENQFKVTVDQLERART
FT                   SKTKVVLINSPSNPTGMIYGAEELRAIGEWAVHNDILILADDIYGSLVYNGNQFVPIST
FT                   LSEAIRRQTITVNGVAKSYAMTGWRVGFAAGEPEIISAMSKIIGQTTSNLTTVSQYAAI
FT                   EAFCGSQSSLEEMRLAFEERLNITYPLLCQVPGFEVVKPQGAFYFFPNVKKAMEMTGFS
FT                   DVTSFANAILEEVGLAVVSGAGFGAPENVRLSYATDIETLKEAVRRLHVFMESNEIN"
FT   gene            524918..526264
FT                   /gene="asnS"
FT                   /locus_tag="SPy_0651"
FT                   /old_locus_tag="SPy0651"
FT   CDS_pept        524918..526264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="SPy_0651"
FT                   /old_locus_tag="SPy0651"
FT                   /product="putative asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="Best Blastp hit = dbj|BAB05415.1| (AP001512)
FT                   asparaginyl-tRNA synthetase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33614"
FT                   /db_xref="GOA:P67575"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67575"
FT                   /protein_id="AAK33614.1"
FT                   /translation="MSKKLISIVDVKDYVGQEVTIGAWVANKSGKGKIAFVQLRDGSAF
FT                   FQGVAFKPNFIEKYGEESGLEKFDVIKRLNQETSVYVTGIVKEDERSKFGYELDITDLE
FT                   IIGESHEYPITPKEHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKF
FT                   DSPILSENAAEDSTELFETDYFGKPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVLDRAPQALDILERDVEALKRY
FT                   ITEPFKRVSYDDAITLLQEHEADEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAKMDELGMDKSEY
FT                   DFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRIRP"
FT   gene            526678..527568
FT                   /locus_tag="SPy_0652"
FT                   /old_locus_tag="SPy0652"
FT   CDS_pept        526678..527568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0652"
FT                   /old_locus_tag="SPy0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = sp|O06973|YVCJ_BACSU HYPOTHETICAL
FT                   33.9 KD PROTEIN IN CRH-TRXB INTERGENIC REGION
FT                   >gi|7430187|pir||H70031 conserved hypothetical protein yvcJ
FT                   - Bacillus subtilis >gi|1945650|emb|CAB08057.1| (Z94043)
FT                   hypothetical protein [Bacillus subtilis]
FT                   >gi|2635990|emb|CAB15482.1| (Z99121) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33615"
FT                   /db_xref="GOA:P67113"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67113"
FT                   /protein_id="AAK33615.1"
FT                   /translation="MSDKHINLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPALVPKF
FT                   LELIEQTNENRRVALVVDMRSRLFFKEINSTLDSIESNPSIDFRILFLDATDGELVSRY
FT                   KETRRSHPLAADGRVLDGIRLERELLSPLKSMSQHVVDTTKLTPRQLRKTISDQFSEGS
FT                   NQASFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYQVELREKTGLDEDVFNYVMSHPE
FT                   SEVFYKHLLNLIVPILPAYQKEGKSVLTVAIGCTGGQHRSVAFAHCLAESLATDWSVNE
FT                   SHRDQNRRKETVNRS"
FT   gene            527565..528542
FT                   /locus_tag="SPy_0653"
FT                   /old_locus_tag="SPy0653"
FT   CDS_pept        527565..528542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0653"
FT                   /old_locus_tag="SPy0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB96620.1| (AJ400630)
FT                   hypothetical protein [Streptococcus pneumoniae
FT                   bacteriophage MM1] >gi|8953589|emb|CAB96623.1| (AJ400631)
FT                   hypothetical protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33616"
FT                   /db_xref="GOA:Q9A0R7"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0R7"
FT                   /protein_id="AAK33616.1"
FT                   /translation="MKNPKMTVIGGGTGISIILKSLRNEAVDITAVVTVADDGGSSGEL
FT                   RNAMQLAPPGDLRNVLLAMSDMPKFYERVFQYRFNESDGALAGHPLGNLIIAGISEMQG
FT                   STYNAIQILTKFFHITGKIYPSSEQALTLHAVFKDGHEVAGESSIAKYPGMIDHVYVTN
FT                   TYNDQKPQASRKVVEAILESDMIVLGPGSLFTSILPNLVIPEIKEALRQTKAEVVYICN
FT                   IMTQYGETEQFSDADHVAVLNQHLGRDLIDTVLVNVAKVPQAYMNSNKFDEYLVQVDHD
FT                   FAGLCRAAKRVISSYFLRLENGGAFHDGNLVVEELMNLVRIVKQ"
FT   gene            528539..529450
FT                   /locus_tag="SPy_0654"
FT                   /old_locus_tag="SPy0654"
FT   CDS_pept        528539..529450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0654"
FT                   /old_locus_tag="SPy0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAB96619.1| (AJ400630)
FT                   hypothetical protein [Streptococcus pneumoniae
FT                   bacteriophage MM1] >gi|8953588|emb|CAB96622.1| (AJ400631)
FT                   hypothetical protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33617"
FT                   /db_xref="GOA:Q9A0R6"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0R6"
FT                   /protein_id="AAK33617.1"
FT                   /translation="MSFTTKVKEELIHLSTGDNNELAAIIKLSGSLGLAHQSLHLSITT
FT                   ENAKIARYIYSLIEDAYVIVPEIRYHQKTNLRKNRVYTVYVEQGVETILADLKLADSFF
FT                   GLETGIEPQVLSDDNAGRSYLKGAFLAAGSIRDPESGKYQLEIYSVYLDHAQDLAQLMQ
FT                   KFMLDAKTIEHKSGAVTYLQKAEDIMDFLIIIGAMSCKEDFEAIKLLREARNDINRANN
FT                   AETANIAKTISASMKTINNIIKIMDTIGLESLPIELQQVAQLRVKHPDYSIQQVADALE
FT                   FPITKSGVNHRLRKINKIADDL"
FT   misc_feature    529587..529602
FT                   /note="bacteriophage 370.1 - attP-L"
FT   gene            complement(529627..531042)
FT                   /gene="int1"
FT                   /locus_tag="SPy_0655"
FT                   /old_locus_tag="SPy0655"
FT   CDS_pept        complement(529627..531042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int1"
FT                   /locus_tag="SPy_0655"
FT                   /old_locus_tag="SPy0655"
FT                   /product="putative integrase; bacteriophage 370.1"
FT                   /note="Best Blastp hit = gb|AAD26564.1|AF124258_1
FT                   (AF124258) site-specific integrase [bacteriophage phi-FC1]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33618"
FT                   /db_xref="GOA:Q9A0R5"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0R5"
FT                   /protein_id="AAK33618.1"
FT                   /translation="MRKVAIYSRVSTINQAEEGYSIQGQIEALTKYCEAMEWKIYKNYS
FT                   DAGFSGGKLERPAITELIEDGKNNKFDTILVYKLDRLSRNVKDTLYLVKDVFTANNIHF
FT                   VSLKENIDTSSAMGNLFLTLLSAIAEFEREQIKERMQFGVMNRAKSGKTTAWKTPPYGY
FT                   RYNKDEKTLSVNELEAANVRQMFDMIISGCSIMSITNYARDNFVGNTWTHVKVKRILEN
FT                   ETYKGLVKYREQTFSGDHQAIIDEKTYNKAQIALAHRTDTKTNTRPFQGKYMLSHIAKC
FT                   GYCGAPLKVCTGRAKNDGTRRQTYVCVNKTESLARRSVNNYNNQKICNTGRYEKKHIEK
FT                   YVIDVLYKLQHDKEYLKKIKKDDNIIDITPLKKEIEIIDKKINRLNDLYINDLIDLPKL
FT                   KKDIEELNHLKDDYNKAIKLNYLDKKNEDSLGMLMDNLDIRKSSYDVQSRIVKQLIDRV
FT                   EVTMDNIDIIFKF"
FT   gene            complement(531163..531528)
FT                   /locus_tag="SPy_0656"
FT                   /old_locus_tag="SPy0656"
FT   CDS_pept        complement(531163..531528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0656"
FT                   /old_locus_tag="SPy0656"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T13290 hypothetical protein 2
FT                   - Streptococcus phage phi-O1205 >gi|2444082|gb|AAC79518.1|
FT                   (U88974) ORF2 [Streptococcus thermophilus temperate
FT                   bacteriophage O1205]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33619"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0R4"
FT                   /protein_id="AAK33619.1"
FT                   /translation="MTLKQLLKSKNLGEYFEAKNNAEKMNEIENRGLKQVMKNSVRQTQ
FT                   LNSEIKQVIKKEKEAVRCPKCKSTNVGFMQQGKKTFSVKKAVAGTLLIGGTVMGFLGEK
FT                   GKKQWHCNECSCIFETK"
FT   gene            complement(531555..532316)
FT                   /locus_tag="SPy_0657"
FT                   /old_locus_tag="SPy0657"
FT   CDS_pept        complement(531555..532316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0657"
FT                   /old_locus_tag="SPy0657"
FT                   /product="putative cI-like repressor, phage associated"
FT                   /note="Best Blastp hit = gi|9632965 orf127 gp
FT                   [Streptococcus thermophilus bacteriophage Sfi21]
FT                   >gi|2292761|emb|CAA64934.1| (X95646) cI-like repressor
FT                   [Streptococcus thermophilus bacteriophage Sfi21]
FT                   >gi|5524046|gb|AAD44098.1|AF115103_28 (AF115103) orf127 gp
FT                   [Streptococcus thermophilus bacteriophage Sfi21]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33620"
FT                   /db_xref="GOA:Q9A0R3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0R3"
FT                   /protein_id="AAK33620.1"
FT                   /translation="MRTNSEIISLIQSKVEERKMSMSELARNVGIAKSTMSRYFNKTRE
FT                   FPLNRADDFAKALNISTEFLLGIDLNSEVDGSELLGIYRELEEQRRVIVLDTAKEQLEE
FT                   QTKIINFSDKKTDIEDIFEVKGTTFAAAASGFGRGFEADDYDTYTVYTDEEPPHYDYAI
FT                   GIRGDSMLPKYEQGDMLYIVDKGMSTYSGQLCIVVHNGNTYFKKVYTEHDGLRLVSLNK
FT                   KYSDIFIGYPPAEDTYIKIYDVVGSFTPIEF"
FT   gene            532500..532730
FT                   /locus_tag="SPy_0658"
FT                   /old_locus_tag="SPy0658"
FT   CDS_pept        532500..532730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0658"
FT                   /old_locus_tag="SPy0658"
FT                   /product="putative Cro-like protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAA73340.1| (Y12813)
FT                   hypothetical protein [Lactobacillus casei bacteriophage A2]
FT                   >gi|6599315|emb|CAB63661.1| (AJ251789) Cro protein
FT                   [Lactobacillus casei bacteriophage A2]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33621"
FT                   /db_xref="GOA:Q9A0R2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0R2"
FT                   /protein_id="AAK33621.1"
FT                   /translation="MTINLKRLKAERIASGMTQCEVAQSMGWKTRTPYAKRENGIVSIG
FT                   ADELAKITLIFGLPIEKIAIFFDKDVPVMER"
FT   gene            532799..532936
FT                   /locus_tag="SPy_0659"
FT                   /old_locus_tag="SPy0659"
FT   CDS_pept        532799..532936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0659"
FT                   /old_locus_tag="SPy0659"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33622"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0R1"
FT                   /protein_id="AAK33622.1"
FT                   /translation="MKNKKEQWTPKVHCFRKDGSQCEPENITVPISFAGYYQILLELGV
FT                   "
FT   gene            532938..533063
FT                   /locus_tag="SPy_0660"
FT                   /old_locus_tag="SPy0660"
FT   CDS_pept        532938..533063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0660"
FT                   /old_locus_tag="SPy0660"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0R0"
FT                   /protein_id="AAK33623.1"
FT                   /translation="MKLLDFIFTKPKKQEPIKHDTKRLSSEKQYDAFHAYMRKKV"
FT   gene            533060..533287
FT                   /locus_tag="SPy_0661"
FT                   /old_locus_tag="SPy0661"
FT   CDS_pept        533060..533287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0661"
FT                   /old_locus_tag="SPy0661"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAB73573.1| (AL139079)
FT                   putative oxidoreductase [Campylobacter jejuni]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33624"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q9"
FT                   /protein_id="AAK33624.1"
FT                   /translation="MKQQLINDNEFLRDENRRLNNELAEHYFVVTAKANLLDVIIASDF
FT                   ILKSTLDKCIAELDEIDQIALLKAWNKGEL"
FT   gene            533287..534606
FT                   /locus_tag="SPy_0663"
FT                   /old_locus_tag="SPy0663"
FT   CDS_pept        533287..534606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0663"
FT                   /old_locus_tag="SPy0663"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||A64465 hypothetical protein
FT                   MJ1322 - Methanococcus jannaschii
FT                   >gi|1591962|gb|AAB99331.1| (U67572) purine NTPase
FT                   [Methanococcus jannaschii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q8"
FT                   /protein_id="AAK33625.1"
FT                   /translation="MSITINKLEIENVKRIKAVKIEPSATGLTIIGGNNNQGKTSVLDA
FT                   IAWALGGNKYKPSQAMREGSQVPPTLKITMSNGLIVERKGKNASLKVIDPNGQKGGQQL
FT                   LDSFVEELAINLPKFMDSTPKEKADVLLEIIGVGDQLAELELKEKEIYNQRHAIGVIAD
FT                   QKEKFAKEMTYYPDAPKQLVSISELIQQHQAILAKNGENAQKRQNVERIRYDYNQSILE
FT                   VDRLRKLLADAEAKTNKLSEDLKIANTDAMDLHDESTAEIEANIADIDEVNRKVRANFD
FT                   KDKAEEDAKQQREQYNILTNDIESIRQQKRDLLINADLPLEGLSVDDGKLLYLGQEWDN
FT                   MSGSQQLIVATAIVRKLKPDCGFVLIDKLEQMDNITLEQFGKRLEQEGLQAIATRVSIG
FT                   EECAIIIEDGYSVENKAHNFKTAEGGNFAETVAPTWKGEF"
FT   gene            534621..535712
FT                   /locus_tag="SPy_0664"
FT                   /old_locus_tag="SPy0664"
FT   CDS_pept        534621..535712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0664"
FT                   /old_locus_tag="SPy0664"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = gi|9632922 orf233 gp
FT                   [Streptococcus thermophilus bacteriophage Sfi19]
FT                   >gi|4049993|gb|AAC97920.1| (AF077306) gp233 [Streptococcus
FT                   thermophilus bacteriophage Sfi19]
FT                   >gi|5524017|gb|AAD44070.1|AF115102_29 (AF115102) orf233 gp
FT                   [Streptococcus thermophilus bacteriophage Sfi19]
FT                   >gi|7523582|gb|AAF63084.1|AF158601_12 (AF158601) gp233
FT                   [Streptococcus thermophilus bacteriophage SFi18]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33626"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q7"
FT                   /protein_id="AAK33626.1"
FT                   /translation="MQITRGKRARAQRVIIYGPEGIGKSSFAANFPEPLFIDTEGSTDN
FT                   MDVARMDKPTSYTMLKNQIAWIKANPTCCKTLVIDTIDWAESLIVDDVCAQHGKKGIED
FT                   FGWGNGYTYTKEEVGRFLNMLQELIELGINIVLTAHAQMRKFEQPDEMGAYDRWELKLG
FT                   KKTSSQTAPLVKEWADMVLFANYKTVVMTSESKKKKATGGQRVLYTQHHPAWDAKNRHG
FT                   LPDEMPLDYAVIAHLFAQVPTQPVPQTPPVQETPASQTAHESVHEQAEKAPEQPPMQPT
FT                   SAPVAYPPSMPKALTDLMSAEQVTPDELVAVANIRGHFPPMTPIENFPSDYWNMIVANW
FT                   LATLEVIKTQVRTVEPPFTVEGA"
FT   gene            535752..536174
FT                   /locus_tag="SPy_0665"
FT                   /old_locus_tag="SPy0665"
FT   CDS_pept        535752..536174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0665"
FT                   /old_locus_tag="SPy0665"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T15692 hypothetical protein
FT                   C28G1.4 - Caenorhabditis elegans >gi|1086705|gb|AAA82353.1|
FT                   (U41026) Similar to zinc finger [Caenorhabditis elegans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33627"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q6"
FT                   /protein_id="AAK33627.1"
FT                   /translation="MNKTIKLDLSAIGEGGLQEKVDKELEKVFDNILDPNTETKVARKV
FT                   TITLTMKPDDARQTVSTAMEVKSTLAPQTGVATTVLVGQKDGKVYANELKSAMPGQTYF
FT                   DDEAVLRTDIGEPIDHLEKGINEDVIDFNKQKKVGN"
FT   gene            536176..536910
FT                   /locus_tag="SPy_0666"
FT                   /old_locus_tag="SPy0666"
FT   CDS_pept        536176..536910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0666"
FT                   /old_locus_tag="SPy0666"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAB82814.1| (AL162459)
FT                   putative protein [Arabidopsis thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33628"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q5"
FT                   /protein_id="AAK33628.1"
FT                   /translation="MTENIKEALEYAVNTAHEKPKTILGSDGKEYYDRNKYSLVELKTK
FT                   YYPKTLNLNTLDSLIDYLKSDMNNINSKRLMVIVEGPREVIVCEEDDDDLNRNVLVTVE
FT                   AIIPNVQFGHYDSPSDFNISLQSLFVNADDRNTVIEFASALKIENGSEIVDDGIGQTAT
FT                   IKQGVASLAKAKAPNPVTLRPYRTFSEVEQPSSEFIFRINQLANMALFEADGGKWRLDA
FT                   INNIANYLKEELADQTNITILA"
FT   gene            536932..537567
FT                   /locus_tag="SPy_0667"
FT                   /old_locus_tag="SPy0667"
FT   CDS_pept        536932..537567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0667"
FT                   /old_locus_tag="SPy0667"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33629"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q4"
FT                   /protein_id="AAK33629.1"
FT                   /translation="MTEYNNNFDRELGWDDEITQDSVGFVQLVPGDYQFTVTNMERARH
FT                   TPNPKSPGKLPACNKAVVTIQIETSEGIAQLTHNLFLHTTTEGMLSAFFGAIGQKKHGE
FT                   PLKMNWNTVIGAKGVARINKRKGTGDYADREYDNIKSMIYADEVDWTKVLNKDVAQPQQ
FT                   MTHQQSAQPTYQGQQAQGTNFAQQPATQSYQQGQMQTPQQPQGGWGGF"
FT   gene            537567..539150
FT                   /locus_tag="SPy_0669"
FT                   /old_locus_tag="SPy0669"
FT   CDS_pept        537567..539150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0669"
FT                   /old_locus_tag="SPy0669"
FT                   /product="putative DEAD box family helicase, phage
FT                   associated"
FT                   /note="Best Blastp hit = pir||T40328 DEAD box family
FT                   helicase - fission yeast (Schizosaccharomyces pombe)
FT                   >gi|2995347|emb|CAA18301.1| (AL022244) DEAD box family
FT                   helicase [Schizosaccharomyces pombe]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33630"
FT                   /db_xref="GOA:Q9A0Q3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q3"
FT                   /protein_id="AAK33630.1"
FT                   /translation="MQLRPYQEEARSAVQHEWEDGKKRTLLVLPTGCGKTIVFSKIIED
FT                   RVRLGERVLVLAHRSELLEQASDKLMTATGLGTALEKAENTSLGSWFRVVVGSVQTMQR
FT                   EKRLSKFPTNHFDTIIIDEAHHAISDGYQRVLQHFDSSNVLGVTATPDRGDKQNLGKYF
FT                   DSLAYEYSLVDAIKSGYLSKITAVTIPLTLDLSTVSQQAGDFKASEIGTALDPYLEQIA
FT                   DEMVKQCANRKTVVFLPLVKTSQKFRDILNQKGFKAAEVNGESKDRAEVLEDFDNDKYN
FT                   VLCNSMLLTEGWDCPTVDCVVVLRPTKVRALYSQMVGRGTRLAPGKENLLLLDFLWHTE
FT                   RHELCRPAHLIAKTPEVAQKMVDNMTEETEVTFELLEAEEVASKDVVAEREEALAKQLA
FT                   EMRKRKRALVDPLQFEMSINAEDLVDYVPEFGWEMAPVSDKQKNALEKFGIFTDDIGNA
FT                   GKATKLLERLAKRRETGLTTPKQIRMLERYGFKNVGMWKFEVASNMINRIAASGWRLPK
FT                   GINAREYQPE"
FT   gene            539160..539789
FT                   /locus_tag="SPy_0670"
FT                   /old_locus_tag="SPy0670"
FT   CDS_pept        539160..539789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0670"
FT                   /old_locus_tag="SPy0670"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = gi|9635666 Orf78 [Pseudomonas
FT                   phage D3] >gi|8895176|gb|AAF80834.1| (AF165214) Orf78
FT                   [Pseudomonas phage D3]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33631"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q2"
FT                   /protein_id="AAK33631.1"
FT                   /translation="MGEYCHLKELDGLRFGSLTVINRNRNNSKGGNARWNCLCDCGNKT
FT                   VVIGSKLRSGYTKSCGCARKNDNAKGYSSTRLYRIWKGMMNRCYNHKNDNYKYYGGKGI
FT                   SICDEWLTFINFRTWSLSNGYKESLTIDRINPKGNYTPLNCRWVSMKMQQNNKTNNRYL
FT                   SYLGQEYTIAEFSEKLNVTYWTVINQLKLGWSVERIVEEARMKNDR"
FT   gene            539779..542052
FT                   /locus_tag="SPy_0671"
FT                   /old_locus_tag="SPy0671"
FT   CDS_pept        539779..542052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0671"
FT                   /old_locus_tag="SPy0671"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAB75598.1| (AJ271879)
FT                   putative DNA helicase [uncultured eubacterium]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33632"
FT                   /db_xref="GOA:Q9A0Q1"
FT                   /db_xref="InterPro:IPR014819"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q1"
FT                   /protein_id="AAK33632.1"
FT                   /translation="MTDDKFDLLPLLDYIDPSKLSYQDWVNVGFALKHEGYTAMDWDIW
FT                   SQSDSRYKKGECFAKWDSFQGNGLGTVTGATITQLAKENGWTSDYRTSDEAHELDWDST
FT                   IDRDYKIIDKNWIEAKEIREPTNWSPVHDLITYINTLFESTDKVGYVTETYPIEIDKGI
FT                   IYKPTKGAYDRTAGQLIQELQKNPNDIGAVLGDYKEEAGAWIRFNPLDGNGVKNDNVTD
FT                   FRYALVESDSMELGKQYALFKELELPIATLVHSGKKSLHAIVKVDAKDYQEYRKRVDYI
FT                   YQICKKNGLDIDTQNRNPSRLSRMPGIMRNGHKQFLIDTNIGKTNYEEWYQWIEDLNDD
FT                   LPEPETLADEWDNLPELAPELIKGVLRQGHKMLIAGPSKAGKSFALIELSIALAEGQKW
FT                   LGWQCEQGKVLYVNLELDRPSALHRFKDVYDAMGLPPANVANIDIWNLRGKTVPMDKLA
FT                   PKLIRRSLKKNYQAVIIDPIYKVLTGDENSADQMAHFTNQFDKVATELGCSVIYCHHHS
FT                   KGSQGGKKSMDRASGSGVFARDPDALIDLVELELTEDLIKARSEKAAAKIYQQALQEKA
FT                   LGYYQQEVTLDDLESRYQMQQHFDKAIKDIMVKQPYLEAVKKAQHEVEIATAWRVDGTL
FT                   REFAKFQPVNMWFSYPKHEVDTTGVLADIQLEDSKPLWKKAKEARKSKEENLKERNQKL
FT                   ETAYSALFDGSTPVTVQEIREYLDLKSNKSVENYIKEHDGYDVKKGVVFQISDNKETEK
FT                   KENN"
FT   gene            542330..542548
FT                   /locus_tag="SPy_0672"
FT                   /old_locus_tag="SPy0672"
FT   CDS_pept        542330..542548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0672"
FT                   /old_locus_tag="SPy0672"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAC13148.1| (AJ400623) MADS
FT                   box protein [Gerbera hybrida]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33633"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0Q0"
FT                   /protein_id="AAK33633.1"
FT                   /translation="MEIYKQRMIEEYKQLKKRAEKLSIVLNRYYLDELDFELSCPIELL
FT                   QTQWHIMGAYLKILEQRFLVEGIYFND"
FT   gene            542541..542936
FT                   /locus_tag="SPy_0673"
FT                   /old_locus_tag="SPy0673"
FT   CDS_pept        542541..542936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0673"
FT                   /old_locus_tag="SPy0673"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = gb|AAF74082.1| (AF212845) ORF129
FT                   [Lactococcus lactis bacteriophage ul36]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33634"
FT                   /db_xref="GOA:Q9A0P9"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P9"
FT                   /protein_id="AAK33634.1"
FT                   /translation="MIEFFLPMDKIPTTTHQQKKVTVINGKPHFYEPESLKNARDKFTS
FT                   LLAQHVPPSKLDGPIRLTVKWLFPKIKGSTNGQYKTTKPDTDNLQKLLKDCMTELGFWN
FT                   DDAQVASEIIEKFWADTVGIYVKVEEL"
FT   gene            542933..543154
FT                   /locus_tag="SPy_0674"
FT                   /old_locus_tag="SPy0674"
FT   CDS_pept        542933..543154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0674"
FT                   /old_locus_tag="SPy0674"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33635"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P8"
FT                   /protein_id="AAK33635.1"
FT                   /translation="MKIDYINFFEQVVPDWMRESNVKMQEVGFNTEAYWQWANQSIVAI
FT                   CEKYGNDSLINGQFHLIWEWLEDKANGG"
FT   gene            543431..544066
FT                   /locus_tag="SPy_0676"
FT                   /old_locus_tag="SPy0676"
FT   CDS_pept        543431..544066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0676"
FT                   /old_locus_tag="SPy0676"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = gb|AAB18697.1| (U38906) ORF22
FT                   [Bacteriophage r1t]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33636"
FT                   /db_xref="GOA:Q99Q98"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q99Q98"
FT                   /protein_id="AAK33636.1"
FT                   /translation="MIKIDEIHRILGIDEVYKAPKRLTDILFDKDSREDIFRQFLKYET
FT                   DVSYDWFMQYFEEEQADRKNKKQDFTPKSVSTLLSKIISGNQYYEVAVGTGGILIQAWQ
FT                   EQRLNDSPFTYRPSKYWYHVEELSDKAVPFLLFNMSIRGINGVVVHGDSLTRQVKNIYF
FT                   LQNTKDDMLSFSDINVMPRTQDIEREFNVKEWIGDGIEHIENPLIEWI"
FT   gene            544339..544773
FT                   /locus_tag="SPy_0677"
FT                   /old_locus_tag="SPy0677"
FT   CDS_pept        544339..544773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0677"
FT                   /old_locus_tag="SPy0677"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T13313 hypothetical protein
FT                   24 - Streptococcus phage phi-O1205
FT                   >gi|2444104|gb|AAC79540.1| (U88974) ORF24 [Streptococcus
FT                   thermophilus temperate bacteriophage O1205]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33637"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P7"
FT                   /protein_id="AAK33637.1"
FT                   /translation="MTFFPEIDIQKTKSNAKRKLREYPRWRRIANDVDTQKVTATYSFE
FT                   PRQSHGVPSKPVERLALNRVSAEQELDAIEQAVSMILEPERRRILYDKYLAPYKKADKV
FT                   IYTELCMSESFYYDTLDIALLAFAELYREGVLLVEEGVFS"
FT   gene            545083..546249
FT                   /locus_tag="SPy_0679"
FT                   /old_locus_tag="SPy0679"
FT   CDS_pept        545083..546249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0679"
FT                   /old_locus_tag="SPy0679"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = dbj|BAB07254.1| (AP001519) unknown
FT                   [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33638"
FT                   /db_xref="GOA:Q9A0P6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P6"
FT                   /protein_id="AAK33638.1"
FT                   /translation="MEFVDKKLSEITPYKNNPRNNDEAVGPVAESIKEFGFKVPIVVDK
FT                   NGEIVNGHTRYKAAQKLGLETVPVIVADDLSEEQIKAFRLADNKVGEIAVWDLDLLNEE
FT                   LNDILDLDMSAFGFDVLDNLDDLIEDEKDLDDFTGTVPDEPKSKLGDIYQLGSHKLMCG
FT                   DSTNGADVKKLMNGELADLLLTDPPYNVAYEGKTKDSLTIKNDSMDNDSFRQFLVNAFS
FT                   SANEVMKPGAVFYIWHADSEGYNFRGACFDIGWTVRQCLIWNKNSMVLGRQDYHWKHEP
FT                   CLYGWKDGAGHLWASDRKQTSVIDYEKPQRNGVHPTMKPVGLFDYQIKNNTKGSDIVLD
FT                   LFGGSGTTLIACESNGRHARLMEYDPKYVDVIIKRWEELTGESVIQLN"
FT   gene            546592..547068
FT                   /locus_tag="SPy_0680"
FT                   /old_locus_tag="SPy0680"
FT   CDS_pept        546592..547068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0680"
FT                   /old_locus_tag="SPy0680"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = gi|10879409 similar to smoothelin
FT                   (H. sapiens) [Homo sapiens]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33639"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P5"
FT                   /protein_id="AAK33639.1"
FT                   /translation="MANEDNLIPNSKRTPSELREIAKKGGIASGKARREKANLRKAVEL
FT                   VLGSTVPSALLREQLEQLDISPTNQSAIALKLVENALKGDVRSAELLAKITTTEVKDSL
FT                   DRKEQRQRIKAAELATDEQRTRIELLKVKLDAEKGAKPDTSLMRALLDAVEGGD"
FT   gene            547151..548362
FT                   /locus_tag="SPy_0681"
FT                   /old_locus_tag="SPy0681"
FT   CDS_pept        547151..548362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0681"
FT                   /old_locus_tag="SPy0681"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAB53788.1| (AJ242593)
FT                   putative terminase large subunit [Bacteriophage A118]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33640"
FT                   /db_xref="GOA:Q9A0P4"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P4"
FT                   /protein_id="AAK33640.1"
FT                   /translation="MTPRSGKTTAGHFRYARYLIESEDENHLVTAYNQEQAYRLFIDGD
FT                   GTGLMHIFDGNCEIKHDERGDHLLITTPKGNKRVYYKGGGKVNSVGAITGMSLGSVVFC
FT                   EINLLHMDFIQECFRRTWAAKLRYHLADLNPPAPQHPVIKDVFDVQNTRWTHWTMDDNP
FT                   ILTAERKQNIINSLKKNPYLYKRDVLGQRVMPQGVIYGLFDTEKNVLDALIGEPVEMYF
FT                   CADGGQSDATSMSCNIVTRVRDNGRISFRLNRVAHYYHSGADTGQVKAMSTYALELKVF
FT                   IDWCVKKYQMRYTEVFVDPACKSLREELHKLGVFTLGAPNNSKDVSSKAKGIEVGIERG
FT                   QNIISDGAFYLVNHSEEEYDHYHFLKEIGLYSRDDNGKPIDKDNHAMDEFRYSVNVFVH
FT                   RYYN"
FT   gene            548376..549878
FT                   /locus_tag="SPy_0682"
FT                   /old_locus_tag="SPy0682"
FT   CDS_pept        548376..549878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0682"
FT                   /old_locus_tag="SPy0682"
FT                   /product="putative minor capsid protein, phage associated"
FT                   /note="Best Blastp hit = pir||T13205 minor capsid protein
FT                   R508 - Lactobacillus phage phi-gle
FT                   >gi|1926349|emb|CAA66734.1| (X98106) minor capsid protein
FT                   [Bacteriophage phig1e]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33641"
FT                   /db_xref="InterPro:IPR006432"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P3"
FT                   /protein_id="AAK33641.1"
FT                   /translation="MGVIQKIKNLVTRSKYVMTTQSLTNITDHPKIAISKLEYDRITTN
FT                   LKYYKSDWDSVLYLNTDGETKKRDLNHLPIARTAAKKIASLVFNEQAEIKVDDDAANEF
FT                   ISETLKNDRFNKNFERYLESCLALGGLAMRPYVDGDKVRVAFVQAPVFLPLQSNTQDVS
FT                   SAAVVIKSVKTINGKEVYYTLIEFHEWQSSDDYVISNELYRSDDKAKVGSRVPLSEVYK
FT                   DLKDEAKVTDVTRPIFTYLKTPGMNNKDINSPLGLSIFDNAKTTIDFINTTYDEFMWEV
FT                   KMGQRRVAVPESLTALTVRTADGDVVPRPRFESDQNVYIRMGGRDLDSSAIQDLTTPIR
FT                   ADDYIKAINEGLSLFEMQIGVSAGLFSFDGKSMKTATEIVSENSDTYQMRNSIVTLVEQ
FT                   SLKELVISIFEIAKAYDLYQSEVPSMDNISISLDDGVFTDRDAELDYWIKVVNAGFGTR
FT                   EMAIQKVLNVTEEKAQEIAAEINTGIVDEINQQRTDTHLYGE"
FT   gene            549883..551376
FT                   /locus_tag="SPy_0683"
FT                   /old_locus_tag="SPy0683"
FT   CDS_pept        549883..551376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0683"
FT                   /old_locus_tag="SPy0683"
FT                   /product="putative minor capsid protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAB53790.1| (AJ242593) gp4
FT                   [Bacteriophage A118]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33642"
FT                   /db_xref="GOA:Q9A0P2"
FT                   /db_xref="InterPro:IPR009319"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P2"
FT                   /protein_id="AAK33642.1"
FT                   /translation="MKKKPIKLNDEQLLLEASQLSDMYHQLTLDLFDQVIERIKARGSA
FT                   SLADNPYLWQANKLHDVGLLNADNIKLIAKYSGIAEAQLRYIIKNEGFKIYKNTSEQLE
FT                   EALGRESGVNSTIQDDLSNYARQAIDDVHNLTNTTLPFSVIGAYQGIIQDAVAGVVTGL
FT                   KTPDQAINQTVIKWFKKGFYGFTDKAGRKWRADSYARTVINTTTWRVFNEAKEAPAREF
FT                   GIDTFYYSKKATAREMCAPLQHQIVTTGEAREEGGIKILALSDYGHGEPDGCLGINCKH
FT                   TKTPFVVGVNSKPELPEHLKNITPAQAKANANAQAKQRAIERSIRKSKELLHVAKQLGD
FT                   KELIRQYQSDVRSKQDALNYLINNNAFLHRNQAREKRYNNPYTKTQSEVEVRKEKAKLD
FT                   KRRDVESAIIGVETSEGIPLKITKHLAERAVLRNIAPIDIVDSIKEPLKIAPIKYDNLD
FT                   RPSQKYIGKCVSTVINPIDGNIVTVHATSTRIRKKYGGN"
FT   gene            551376..551603
FT                   /locus_tag="SPy_0684"
FT                   /old_locus_tag="SPy0684"
FT   CDS_pept        551376..551603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0684"
FT                   /old_locus_tag="SPy0684"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33643"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P1"
FT                   /protein_id="AAK33643.1"
FT                   /translation="MKLKSILNDSQIDFVKNELPGLPVDIDVNSEKYDVFCEGIETYYQ
FT                   TESFDEKYNITAKGKLAESIIDLLTDKGYW"
FT   gene            551690..551956
FT                   /locus_tag="SPy_0685"
FT                   /old_locus_tag="SPy0685"
FT   CDS_pept        551690..551956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0685"
FT                   /old_locus_tag="SPy0685"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T25808 hypothetical protein
FT                   K08B12.5 - Caenorhabditis elegans
FT                   >gi|1938422|gb|AAB52260.1| (U97001) Similar to
FT                   serine/threonine-protein kinase; coded for by C. elegans
FT                   cDNA CEESP52F; coded for by C. elegans cDNA yk134e9.5;
FT                   coded for by C. elegans cDNA yk17b9.5; coded for by C.
FT                   elegans cDNA CEESK86FB; coded for by C. elegans cDNA
FT                   yk17b9.3; co>"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0P0"
FT                   /protein_id="AAK33644.1"
FT                   /translation="MNKRIKKKRKLETAVVMLVAENAMQVEAIKNQNKQIMELKSIVQR
FT                   NALATNEELATVKAATLDNQSVIKAIGDTVDYIKKNYKRKWGK"
FT   gene            552082..552696
FT                   /locus_tag="SPy_0686"
FT                   /old_locus_tag="SPy0686"
FT   CDS_pept        552082..552696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0686"
FT                   /old_locus_tag="SPy0686"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33645"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N9"
FT                   /protein_id="AAK33645.1"
FT                   /translation="MHMENVTNENVDQETTDLENNQQEDKAFTQDDLNRVGTKEHSKGY
FT                   NKAVKDLGFDDVESAKDALKAFQEWQESQRSESEKQTEILNAKDKELEEARANNKALNA
FT                   KLAAMSLGVNAESIDDVIALSERLVTDETSIEDAIKTVLGKYPHFGQTKDKAPKITVAG
FT                   NPSADNGQGSVSKEDFAKMSYQEKLDLKLKNKNLYDQLKGN"
FT   gene            552700..553518
FT                   /locus_tag="SPy_0688"
FT                   /old_locus_tag="SPy0688"
FT   CDS_pept        552700..553518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0688"
FT                   /old_locus_tag="SPy0688"
FT                   /product="putative major head protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAA59185.1| (X84706) major
FT                   head protein [Bacteriophage B1]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33646"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N8"
FT                   /protein_id="AAK33646.1"
FT                   /translation="MAVGTTKMAQMLDPEVLADMIDAEVGKAIRFAPLAEVDTTLEGQP
FT                   GTTLTVPKWDYIGDAEDVAEGEAIPMTQLGFKKTTMTIKKAGKGVEITDEAILSGYGDP
FT                   VGQAAKQIVEAIDHKVDADVLDALSKSTQTVEATATVDGVSKALDIFNDEDDAETVIVM
FT                   NPADASTLRLDAAKEWLGATEVGANRVVSGVYGEVLGVQIVRSRKCPKGTAYMVRKGAL
FT                   RIMLKRNTMVETDRDITKAINQIVANKHYGVYLYKAEKAVKITLKDAAKK"
FT   gene            553572..553988
FT                   /locus_tag="SPy_0689"
FT                   /old_locus_tag="SPy0689"
FT   CDS_pept        553572..553988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0689"
FT                   /old_locus_tag="SPy0689"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = sp|Q04774|YG34_BPMV4 HYPOTHETICAL
FT                   15.6 KD PROTEIN IN G34 3'REGION (ORF4)
FT                   >gi|478257|pir||I45691 hypothetical protein 4 [imported] -
FT                   Lactobacillus delbrueckii subsp. bulgaricus phage mv4
FT                   >gi|215250|gb|AAA56849.1| (L02497) ORF4; putative
FT                   [Bacteriophage mv4]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33647"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N7"
FT                   /protein_id="AAK33647.1"
FT                   /translation="MEVVIIAFLTQKEFEDLGFDEVEDFEKMEKRASHAVNLYCRNRYD
FT                   YKDLKKEIALVQKAVKRAIAYQIAYLNDSGVMTAEDKQSFAGISLGRTSISYTVGHGQG
FT                   SQQKTLADRFNLCLDAENELLAVGLGYTGISYDR"
FT   gene            553978..554310
FT                   /locus_tag="SPy_0690"
FT                   /old_locus_tag="SPy0690"
FT   CDS_pept        553978..554310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0690"
FT                   /old_locus_tag="SPy0690"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T13210 minor capsid protein
FT                   R117a - Lactobacillus phage phi-gle
FT                   >gi|1926354|emb|CAA66739.1| (X98106) minor capsid protein
FT                   [Bacteriophage phig1e]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33648"
FT                   /db_xref="InterPro:IPR019612"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N6"
FT                   /protein_id="AAK33648.1"
FT                   /translation="MIDKRLLIDELQVKLVKDKGDYGGFVYDEPFTLSPVRFDRNLATA
FT                   GKDNARQETKPSVIFIYPKYCKTVADRSWVDAVVIDGDTEYTVDKVIPVYHPLTNKIFC
FT                   FEVEVI"
FT   gene            554310..554666
FT                   /locus_tag="SPy_0691"
FT                   /old_locus_tag="SPy0691"
FT   CDS_pept        554310..554666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0691"
FT                   /old_locus_tag="SPy0691"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = gb|AAC00538.1| (L02496) unknown
FT                   protein [Bacteriophage LL-H]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33649"
FT                   /db_xref="InterPro:IPR021080"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N5"
FT                   /protein_id="AAK33649.1"
FT                   /translation="MAKVVVELGGIKRKVSPQALAKGKLIMNNQVMMSMNPYVPYRDGA
FT                   LRGSSRANSVGVTWSGPHARAQFYGGAYNKYKSFKFKKYTTPGTGKRWDKRALANATIV
FT                   KDWEKSLLRGMGFK"
FT   gene            554663..555061
FT                   /locus_tag="SPy_0693"
FT                   /old_locus_tag="SPy0693"
FT   CDS_pept        554663..555061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0693"
FT                   /old_locus_tag="SPy0693"
FT                   /product="putative minor capsid protein, phage associated"
FT                   /note="Best Blastp hit = pir||T13212 minor capsid protein
FT                   R135 - Lactobacillus phage phi-gle
FT                   >gi|1926356|emb|CAA66741.1| (X98106) minor capsid protein
FT                   [Bacteriophage phig1e]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33650"
FT                   /db_xref="InterPro:IPR024411"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N4"
FT                   /protein_id="AAK33650.1"
FT                   /translation="MTNDFATVLRQFVEGLDLGIKPRLDYLTRQEDLAIYPMPGGKVNN
FT                   EYMDGTREISLPFEIAIKTKNQELASTVMWTINSALSNFDLKLPSLNHSYTFISLDVEK
FT                   PFLNDLSDQGFYIYVLDITAHLEIEGNN"
FT   gene            555061..555531
FT                   /locus_tag="SPy_0694"
FT                   /old_locus_tag="SPy0694"
FT   CDS_pept        555061..555531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0694"
FT                   /old_locus_tag="SPy0694"
FT                   /product="putative major tail shaft protein, phage
FT                   associated"
FT                   /note="Best Blastp hit = emb|CAB53798.1| (AJ242593) major
FT                   tail shaft protein [Bacteriophage A118]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33651"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N3"
FT                   /protein_id="AAK33651.2"
FT                   /translation="MRQKNALRGHFIAPYVKGEEKTEVTKEKLLELARWIKDISDDTDE
FT                   KTEDEAYYDGDGTEETTVVGVKGAYTFEGTYDPEDKAQAHIASLKYKLGDERKVWHLIV
FT                   SADGKTQWLGVATVTEIIAGSGAAADFEAFGCKITYNSLPKESKEIIPKKMN"
FT   gene            555584..556018
FT                   /locus_tag="SPy_0695"
FT                   /old_locus_tag="SPy0695"
FT   CDS_pept        555584..556018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0695"
FT                   /old_locus_tag="SPy0695"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAB72529.1| (AL139074)
FT                   hypothetical protein Cj0036 [Campylobacter jejuni]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33652"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N2"
FT                   /protein_id="AAK33652.1"
FT                   /translation="MSGIVVDLKRTGFPVKIGQVELWFDTSQERLIEFFDIETEVNRRL
FT                   NEYEKQVIEANLDNEIEDKGVTKDVAQSALDLEAKYLEINYDLLFGEGTFAQLYAEYPD
FT                   KEALENTLEIVCREIEVKLKELAIEREKIVKQKTKKYKKE"
FT   gene            556022..556603
FT                   /locus_tag="SPy_0696"
FT                   /old_locus_tag="SPy0696"
FT   CDS_pept        556022..556603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0696"
FT                   /old_locus_tag="SPy0696"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = emb|CAB53801.1| (AJ242593) gp15
FT                   [Bacteriophage A118]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33653"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N1"
FT                   /protein_id="AAK33653.1"
FT                   /translation="MKLNDPLVESFEFRGEIYPIDLSFNKVLDVFDVIDDDFLNEAEKC
FT                   FLCLDILLDRTDLPFTYAVDLWVYIKTNFIDAERPEKPQLDIKGNPMPVVKEKEDNKKV
FT                   IDLSLDAEFIYASFRQAYQINLLKEQNRLSWIEFKALLNALPDDTVMQRIIAIRQWEDD
FT                   GEGSKKYRDNMRKLKAKYSLDEREEEDDGS"
FT   gene            556593..559853
FT                   /locus_tag="SPy_0697"
FT                   /old_locus_tag="SPy0697"
FT   CDS_pept        556593..559853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0697"
FT                   /old_locus_tag="SPy0697"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T13329 hypothetical protein
FT                   40 - Streptococcus phage phi-O1205
FT                   >gi|2444119|gb|AAC79555.1| (U88974) ORF40 [Streptococcus
FT                   thermophilus temperate bacteriophage O1205]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33654"
FT                   /db_xref="GOA:Q9A0N0"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0N0"
FT                   /protein_id="AAK33654.1"
FT                   /translation="MAADGKVTILVDVDGKQVKVLNSELDKVAKHGDKGSSSLKKFAVG
FT                   AGVFKLASAAVDLVSQSLGKAITRFDTLEKYPRVMKAMGHSAEYVARSTDKLANGIDGL
FT                   PTTLDEVVGTAQRLTSITKDINKSTNLTLALNNAFLASGASSEAASRGLEQYAQMLSAG
FT                   KVDMQAWKTLQETMPYALQQTAEAFGFAGASAQKDFYEALKNGQITFDQFSNKLIELND
FT                   GVGGFAELAKENSKGIETSFNNIKNAIAKGVANSIKALDDLSKAATGKGIADHFDSLKV
FT                   VINASFSAINASIKASTSLFKLLFSVIGAGISVVKALSPALVGVASGLAAMRAVNETIT
FT                   MIKALNRAWVMASASMSIGATTIKTVTAVQAVSTTMTKADMVARLSQLGVLKASTVIYG
FT                   VMTGAISLSTAATIASTAAVTALKAALVALTGPVGWVVGAIGALVAVGVSLWSWLTKES
FT                   DETKKLKKEQEGLVESNKQLRDSVREGVQERKKGLESVKESTAAHQKLADEIIKLAAKE
FT                   NKTAGEKQNLKNKIDQLNGSIDGLNLAYDKNSNSLSHNADQIKSRISAMEAESTWQTAQ
FT                   QNLLNIEQKRSEVSKKLAENAELRKKWNEEANVSDSVRKEKIAELTEEEGKLKNMQTQL
FT                   QEEYNKTSATQQAAADAMAAAEESGSARQVIAYENMSEAQRTAIDNMRTKYSELLETTT
FT                   SIFDAIEQKTALSVEQMNANLEKNRAATEQWATNLEILAQRGVDQGILEQLRRMGPEGA
FT                   TQTQVFVDATDAELAPLQENFRAATETAKNAMGSVLDSAGVEMPEKVKGMVTNVSTGLQ
FT                   AELQAANFAQLGQEIPNGVSQGISQGAGKASDASVKMGQEVKRSFQGELGIHSPSRVFT
FT                   EYGGHITDGLSNGVTNGTSKVMQTMQSLAQQMSQKGQQIVNDMRSKSNQITDAFSTMSG
FT                   PMHSHGVNAMQGLANGIYAGSGAALAAAQSIAARITATIQSALDIHSPSRVMRDEVGRF
FT                   IPQGIAVGIDADRKVIDSSMQKLKESMTINATPEIASGFGGGVAGIANQTTNNSNNSFT
FT                   LNVKVDESDGNSREKYQRLFREFSWYIQQQQGRLGDVK"
FT   gene            559850..560566
FT                   /locus_tag="SPy_0698"
FT                   /old_locus_tag="SPy0698"
FT   CDS_pept        559850..560566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0698"
FT                   /old_locus_tag="SPy0698"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = gb|AAG18639.1| (AY007505) unknown
FT                   [Streptococcus mitis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33655"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M9"
FT                   /protein_id="AAK33655.1"
FT                   /translation="MTAFIKFDGKKSSDFDLRIINDVEHDSSFYDVDQVKVPGRDGVVL
FT                   KDNKRLEAIERSYPLRLYSKRRLTEVETDISNWLNVKGWKDLELSWEPDYIYKATHITP
FT                   FSIKEVLRNFGRLKINFLIHPIKYLKTGKQEVPLVNGGTLQNPGNVQAKPILKIKGTGN
FT                   GILTINDFETGLENVQSELVIDMERHLVYKDVLSAWDNIVRTERHRMPLFDVGQNKISW
FT                   TGSFTITAVPNWGVKV"
FT   gene            560563..562707
FT                   /locus_tag="SPy_0700"
FT                   /old_locus_tag="SPy0700"
FT   CDS_pept        560563..562707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0700"
FT                   /old_locus_tag="SPy0700"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = gi|9633054 hypothetical protein
FT                   [Lactobacillus bacteriophage phi adh]
FT                   >gi|5730311|emb|CAB52532.1| (AJ131519) hypothetical protein
FT                   [Lactobacillus bacteriophage phi adh]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33656"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M8"
FT                   /protein_id="AAK33656.1"
FT                   /translation="MIPVLYEAKETKFRTFGLGEIADAYEVKATRERNGNYSLYIKYPL
FT                   DGVFASVFKEEMKIKSDAGRRTKWQTFEINRVLRNSKDHIEIFARHISMRTQDIALKPF
FT                   VNGASVGAESALEIWKKNLVGDDKFDVKSDILTLGSFNWEIDKIGNARGALGGVAGSIL
FT                   DVYGGEYEFDNRTIILRKQMGRKAPTVLEYGRNIVSVEEERLLDGNYTSIYPYVRYTPQ
FT                   PKPQEEPPGKPHVGEHKQPEEQLVTLPEFILDGQYLSLYAQRRIQMVDLSSHFNDDKNK
FT                   KEPTIEEIRKLAQKYLKDNNVGAPKVSIEVDYIDLSQTLDYQDFRVMEEVELCDIVPLY
FT                   YPKFGITTESEKVVEIVYDVYTDSNHTIKLGTIGQSISKSLTGGVSERINALENNQKVI
FT                   TNSQKQFELNLPKYLNDLNGKRVWYEKPDDNIEHKIGDYWFEKNGKYQRTWIWDGNQWV
FT                   KVLDTEDLNPNQRAFDAAIAELEKAKKAQEEINQRTDKELEEFRATLKNLALPEEAIKK
FT                   ITEAIKVDDIPSIKQSFDDLKNRVSETSEESRLTAEILGNNGKTRYNKNLLVGEPNRTK
FT                   SYDQDYIEVEANDGGFKRGETYTISFSQTCEPLKKVAITLTQANNKGVKLVLTPTKAKM
FT                   ESQTFDLTKDKEAISVYPFSYTVLVTSDWYKSKQIDLNASEVKELALEMDYKEIADAKG
FT                   ATITGAWSDSPQIILDGGKK"
FT   gene            562704..563717
FT                   /gene="hylP1"
FT                   /locus_tag="SPy_0701"
FT                   /old_locus_tag="SPy0701"
FT   CDS_pept        562704..563717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hylP1"
FT                   /locus_tag="SPy_0701"
FT                   /old_locus_tag="SPy0701"
FT                   /product="hyaluronidase, phage associated"
FT                   /note="Best Blastp hit = sp|Q54699|HYAL_BPH45
FT                   HYALURONOGLUCOSAMINIDASE (HYALURONIDASE)
FT                   >gi|881507|gb|AAA86895.1| (U28144) hyaluronidase
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33657"
FT                   /db_xref="GOA:Q9A0M7"
FT                   /db_xref="InterPro:IPR009860"
FT                   /db_xref="InterPro:IPR041352"
FT                   /db_xref="PDB:2C3F"
FT                   /db_xref="PDB:2DP5"
FT                   /db_xref="PDB:2YVV"
FT                   /db_xref="PDB:2YW0"
FT                   /db_xref="PDB:2YX2"
FT                   /db_xref="PDB:3EKA"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M7"
FT                   /protein_id="AAK33657.1"
FT                   /translation="MSENIPLRVQFKRMKAAEWARSDVILLESEIGFETDTGFARAGDG
FT                   HNRFSDLGYISPLDYNLLTNKPNIDGLATKVETAQKLQQKADKETVYTKAESKQELDKK
FT                   LNLKGGVMTGQLKFKPAATVAYSSSTGGAVNIDLSSTRGAGVVVYSDNDTSDGPLMSLR
FT                   TGKETFNQSALFVDYKGTTNAVNIAMRQPTTPNFSSALNITSGNENGSAMQLRGSEKAL
FT                   GTLKITHENPSIGADYDKNAAALSIDIVKKTNGAGTAAQGIYINSTSGTTGKLLRIRNL
FT                   SDDKFYVKSDGGFYAKETSQIDGNLKLKDPTANDHAATKAYVDKAISELKKLILKK"
FT   gene            563732..565618
FT                   /locus_tag="SPy_0702"
FT                   /old_locus_tag="SPy0702"
FT   CDS_pept        563732..565618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0702"
FT                   /old_locus_tag="SPy0702"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = sp|P15317|YHYA_BPH44 HYPOTHETICAL
FT                   65 KD PROTEIN IN HYALURONIDASE REGION >gi|76370|pir||B30566
FT                   hypothetical protein - Streptococcus pyogenes phage H4489A
FT                   >gi|215054|gb|AAA98102.1| (M19348) ORF [Streptococcus
FT                   pyogenes phage H4489A]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33658"
FT                   /db_xref="InterPro:IPR012892"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M6"
FT                   /protein_id="AAK33658.1"
FT                   /translation="MSRDPTLILDESNLVIGKDGRVHYTFTTEDDNPKVRLASKCLGTA
FT                   HFNQLMIERGDQATSYVAPVVVEGTGNPTGLFKDLKEISLELTDTANSQLWSKIKLTNR
FT                   GMLQEYYDGKIKTEIVNSARGVATRISEDTDKKLALINDTIDGIRREYRDADRKLSASY
FT                   QAGIEGLKATMANDKIGLQAEIKASAQGLSQKYDDELRKLSAKITTTSSGTTEAYESKL
FT                   AGLRAEFTRSNQGTRTELESQISGLRAVQQSTASQISQEIRDREGAVSRVQQSLESYQR
FT                   RMQDAEENYSSLTHTVRGLQSDVGSPTGKIQSRLTQLAGQIEQRVTRDGVMSIISGAGD
FT                   SIKLAIQKAGGINAKMSGNEIISAINLNSYGVTIAGKHIALDGNTTVNGTFTTKIAEAI
FT                   KIRADQIIAGTIDAARIRVINLNASSIVGLDANFIKAKIGYAITDLLEGKVIKARNGAM
FT                   LIDLNTAKMDFNSDATINFNSKNNALVRKDGTHTAFVHFSNATPKGYTGSALYASIGIT
FT                   SSGDGVNSASSGRFAGLRSFRYATGYNHTAAVDQTEIYGDNVLVVDDFNITRGFKFRPD
FT                   KMQKMLDMNDLYAAVVALGRCWGHLANVGWNTAHSNFTSAVNRELNNYITKI"
FT   gene            565630..566061
FT                   /locus_tag="SPy_0703"
FT                   /old_locus_tag="SPy0703"
FT   CDS_pept        565630..566061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0703"
FT                   /old_locus_tag="SPy0703"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33659"
FT                   /db_xref="InterPro:IPR011675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M5"
FT                   /protein_id="AAK33659.1"
FT                   /translation="MQLTIKNKDLNTLYRVLDKIKITNMRANRGRAKLLAKVVDKINEY
FT                   AKDETDLIDMYAAKDKDDKFVIDEHKNIKLADPAKLDELNDLLNELADEEIVIKGGEYS
FT                   KRFIDFLNFLEECEDEFTSSEIILIDNILEQFEESKKGE"
FT   gene            566064..566681
FT                   /locus_tag="SPy_0705"
FT                   /old_locus_tag="SPy0705"
FT   CDS_pept        566064..566681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0705"
FT                   /old_locus_tag="SPy0705"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T13336 hypothetical protein
FT                   47 - Streptococcus phage phi-O1205
FT                   >gi|2444126|gb|AAC79562.1| (U88974) ORF47 [Streptococcus
FT                   thermophilus temperate bacteriophage O1205]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33660"
FT                   /db_xref="InterPro:IPR009796"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M4"
FT                   /protein_id="AAK33660.1"
FT                   /translation="MRNWKVTGKYPQFDSTGAVASTHIIITAEDGSVISQPIKQDLTST
FT                   NDTEIIKATLEEFKKSEYVEIAMGEAVQKVDDLEKISQETAKTAKTAQTAAGLAKVSAE
FT                   RTQRMINLQTIHMLTSGGKIDSDIYKGMLELIEPAQKGEYQAYDVFTVVDSTKEEDGEA
FT                   GEGNLVFVHVNEAFEYDKQTLEELESEAKVTVIKYADLVKQD"
FT   gene            566691..566966
FT                   /locus_tag="SPy_0706"
FT                   /old_locus_tag="SPy0706"
FT   CDS_pept        566691..566966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0706"
FT                   /old_locus_tag="SPy0706"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T07111 MAR binding
FT                   filament-like protein 1 - tomato
FT                   >gi|1771158|emb|CAA69181.1| (Y07861) MFP1 protein
FT                   [Lycopersicon esculentum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0706"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33661"
FT                   /db_xref="GOA:Q99QD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q99QD0"
FT                   /protein_id="AAK33661.1"
FT                   /translation="MATELIFGVGGFILAIVTTYNIFNAKSIKHATDITLLQSEVEHLK
FT                   IVTRQNARRLEEHAEQNKTLITMTEQIKNLTDDVKDLKDMMRGEIK"
FT   gene            566963..567190
FT                   /locus_tag="SPy_0707"
FT                   /old_locus_tag="SPy0707"
FT   CDS_pept        566963..567190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0707"
FT                   /old_locus_tag="SPy0707"
FT                   /product="putative holin, phage associated"
FT                   /note="Best Blastp hit = gi|9635033 putative holin
FT                   [Streptococcus thermophilus bacteriophage Sfi11]
FT                   >gi|7521136|pir||T13643 probable holin - Streptococcus
FT                   phage phi-Sfi11 >gi|3540293|gb|AAC34420.1| (AF158600)
FT                   putative holin [Streptococcus thermophilus bacteriophage
FT                   Sfi11]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33662"
FT                   /db_xref="GOA:Q9A0M3"
FT                   /db_xref="InterPro:IPR006485"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M3"
FT                   /protein_id="AAK33662.1"
FT                   /translation="MINLKLRLQNKVTLMAILGAIFLLAQQLGIKLPSNIADIANTAVT
FT                   LLVLLGVVTDPTTKGLSDSEQALTYHEPKK"
FT   gene            567306..568508
FT                   /locus_tag="SPy_0710"
FT                   /old_locus_tag="SPy0710"
FT   CDS_pept        567306..568508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0710"
FT                   /old_locus_tag="SPy0710"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Best Blastp hit = pir||T13528 hypothetical protein
FT                   39 - Bacillus phage phi-105 >gi|4126625|dbj|BAA36645.1|
FT                   (AB016282) ORF39 [bacteriophage phi-105]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33663"
FT                   /db_xref="GOA:Q9A0M2"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M2"
FT                   /protein_id="AAK33663.1"
FT                   /translation="MTFLDKIKQGCLDGWAKYKILPSLTAAQAILESGWGKHAPHNALF
FT                   GIKADSSWTGKSFDTKTQEEYQAGVVTDIVDRFRAYDSWDESIADHGQFLVDNPRYEAV
FT                   IGETDYKKACYAIKAAGYATASSYVELLIQLIEENDLQSWDREALKNNKEETMTTANEI
FT                   VQYCVNLANSGMGVDKDGAHGTQCCDLPCFVAKNWFGVDLWGNAIDLLDSASAQGWEVH
FT                   RMPTEANPKAGATFVQSVPYHQFGHTGIVIEDSDGYTMRTVEQNIDGNPDALYVGAPAR
FT                   FNTRDFTGVIGWFYPPYQGDTVTQPVSTEPQTSDTIVETAKTGTFTLDVAEINIRRWPS
FT                   LASEVVGIYKQGDTVSFDSEGYANGYYWISYVGGSGMRNYLGIGQTDKDGNRISLWGKL
FT                   N"
FT   gene            complement(568576..569283)
FT                   /gene="speC"
FT                   /locus_tag="SPy_0711"
FT                   /old_locus_tag="SPy0711"
FT   CDS_pept        complement(568576..569283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speC"
FT                   /locus_tag="SPy_0711"
FT                   /old_locus_tag="SPy0711"
FT                   /product="pyrogenic exotoxin C precursor, phage associated"
FT                   /note="Best Blastp hit = pir||A30509 exotoxin C precursor -
FT                   Streptococcus pyogenes >gi|153821|gb|AAA27017.1| (M35514)
FT                   streptococcal pyrogenic exotoxin type C (speC) precursor
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0711"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33664"
FT                   /db_xref="GOA:P0C0I5"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR006177"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0I5"
FT                   /protein_id="AAK33664.1"
FT                   /translation="MKKINIIKIVFIITVILISTISPIIKSDSKKDISNVKSDLLYAYT
FT                   ITPYDYKNCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYI
FT                   LNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKI
FT                   RKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIIN
FT                   MKNFSHFDIYLEK"
FT   gene            complement(569394..570152)
FT                   /gene="mf2"
FT                   /locus_tag="SPy_0712"
FT                   /old_locus_tag="SPy0712"
FT   CDS_pept        complement(569394..570152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mf2"
FT                   /locus_tag="SPy_0712"
FT                   /old_locus_tag="SPy0712"
FT                   /product="putative DNase"
FT                   /note="similar to mitogenic factor; phage associated; Best
FT                   Blastp hit = sp|Q03158|NUCE_STRPN DNA-ENTRY NUCLEASE
FT                   (COMPETENCE-SPECIFIC NUCLEASE) >gi|98025|pir||S10641 endA
FT                   protein - Streptococcus pneumoniae
FT                   >gi|47374|emb|CAA38134.1| (X54225) membrane nuclease
FT                   [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0712"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33665"
FT                   /db_xref="GOA:Q9A0M1"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="PDB:2XGR"
FT                   /db_xref="PDB:2XH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0M1"
FT                   /protein_id="AAK33665.1"
FT                   /translation="MKLSKQKASLLTAVLLLLSLSITTITVDAARVRTYPNVSHANTHY
FT                   KNTVSSKLLPFTANYQLQLGELDNLNRATFSHIQLQDRHETKDVRTKINYDPVGWHNYQ
FT                   FPYGDGSKSSWVMNRGHLVGYQFCGLNDEPRNLVAMTAWLNTGAYSGANDSNPEGMLYY
FT                   ENRLDSWLALHPDFWLDYKVTPIYSGNEVVPRQIELQYVGIDSSGELLTIRLNSNKESI
FT                   DENGVTTVILENSAPNINLDYLNGTATPKN"
FT   gene            570464..571882
FT                   /gene="pepD"
FT                   /locus_tag="SPy_0713"
FT                   /old_locus_tag="SPy0713"
FT   CDS_pept        570464..571882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="SPy_0713"
FT                   /old_locus_tag="SPy0713"
FT                   /product="putative dipeptidase"
FT                   /EC_number="3.4.13.18"
FT                   /note="Best Blastp hit = emb|CAA86210.1| (Z38063)
FT                   dipeptidase [Lactobacillus helveticus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33666"
FT                   /db_xref="GOA:Q9A0M0"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0M0"
FT                   /protein_id="AAK33666.1"
FT                   /translation="MDKKIQRFSCTTILVGKKASYDGSTMVARTEDSQNGDFTPKKMIV
FT                   VKPEDQPRHYRSVQSSFEMDLPDNPMTYTSVPDALGKDGIWAEAGVNEANVAMSATETI
FT                   TTNSRVLGADPLVASGIGEEDMVTLVLPYIRSAREGVLRLGAILEDYGTYESNGVAFSD
FT                   EHDIWWLETIGGHHWIARRVPDDAYVTNPNQFGIDHFEFNNPEDYLCSADLKDFIDTYH
FT                   LDLTYSHEHFNPRYAFGSQRDKDRQYNTPRAWIMQKFLNPEIVQDPRSFALAWCQKPYR
FT                   KITVEDVKYVLSSHYQDTGYDPYGSEGTPVSKKVFRPIGINRTSQTAILHIRPNKPQEI
FT                   AAIQWMAYGSMPFNTMVPFFTQVKTIPDYFANTYENVFTDNFYWTNRLIAALADPHYNH
FT                   HETDLDNYLEETMAKGHAMLHAVEVQLLAGETVDLEEENQKMSDYVQGETQTLLNKILF
FT                   DASNLMTNRFSLSD"
FT   misc_feature    570488..570504
FT                   /gene="pepD"
FT                   /locus_tag="SPy_0713"
FT                   /old_locus_tag="SPy0713"
FT                   /note="bacteriophage 370.1 - attP-L"
FT   gene            572034..573581
FT                   /gene="adcA"
FT                   /locus_tag="SPy_0714"
FT                   /old_locus_tag="SPy0714"
FT   CDS_pept        572034..573581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcA"
FT                   /locus_tag="SPy_0714"
FT                   /old_locus_tag="SPy0714"
FT                   /product="putative adhesion protein"
FT                   /note="Best Blastp hit = emb|CAA96185.1| (Z71552) AdcA
FT                   protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33667"
FT                   /db_xref="GOA:Q9A0L9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0L9"
FT                   /protein_id="AAK33667.2"
FT                   /translation="MKKKILLMMSLISVFFAWQLTQAKQVLAEGKVKVVTTFYPVYEFT
FT                   KGVIGNDGDVFMLMKAGTEPHDFEPSTKDIKKIQDADAFVYMDDNMETWVSDVKKSLTS
FT                   KKVTIVKGTGNMLLVAGAGHDHHHEDADKKHEHNKHSEEGHNHAFDPHVWLSPYRSITV
FT                   VENIRDSLSKAYPEKAENFKANAATYIEKLKELDKDYTAALSDAKQKSFVTQHAAFGYM
FT                   ALDYGLNQISINGVTPDAEPSAKRIATLSKYVKKYGIKYIYFEENASSKVAKTLAKEAG
FT                   VKAAVLSPLEGLTEKEMKAGQDYFTVMRKNLETLRLTTDVAGKEILPEKDTTKTVYNGY
FT                   FKDKEVKDRQLSDWSGSWQSVYPYLQDGTLDQVWDYKAKKSKGKMTAAEYKDYYTTGYK
FT                   TDVEQIKINGKKKTMTFVRNGEKKTFTYTYAGKEILTYPKGNRGVRFMFEAKEADAGEF
FT                   KYVQFSDHAIAPEKAKHFHLYWGGDSQEKLHKELEHWPTYYGSDLSGREIAQEINAH"
FT   gene            573729..574451
FT                   /locus_tag="SPy_0715"
FT                   /old_locus_tag="SPy0715"
FT   CDS_pept        573729..574451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0715"
FT                   /old_locus_tag="SPy0715"
FT                   /product="putative transcriptional regulator (GntR family)"
FT                   /note="Best Blastp hit = dbj|BAB04138.1| (AP001508)
FT                   transcriptional regulator (GntR family) [Bacillus
FT                   halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33668"
FT                   /db_xref="GOA:Q9A0L8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0L8"
FT                   /protein_id="AAK33668.1"
FT                   /translation="MPKEQPLYLQIVDDLEVKIKKSMTENDKLLSERELSDLYGVSRIT
FT                   IRLTLKELELRDLIYKKQGKGTYVSGIKEPATDLSSTYSFTEQMKKMGKTPKTEILSFE
FT                   QYQVTPYLSGLLELDPDTEVFELERLRIADDMPLMFERSYIPAQPFQGLSIADLKRKAL
FT                   YDIFAKDYQETIRLAEEEFYASIALDYEAGLLGIKKGDPVLHIIRKTYNDKNILIELTF
FT                   SIARADQFRYRVQHHPNG"
FT   gene            574470..575669
FT                   /gene="agaS"
FT                   /locus_tag="SPy_0716"
FT                   /old_locus_tag="SPy0716"
FT   CDS_pept        574470..575669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SPy_0716"
FT                   /old_locus_tag="SPy0716"
FT                   /product="putative tagatose-6-phosphate aldose/ketose
FT                   isomerase"
FT                   /note="Best Blastp hit = sp|P42907|AGAS_ECOLI PUTATIVE
FT                   TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE ISOMERASE
FT                   >gi|7465773|pir||D65103 agaS protein - Escherichia coli
FT                   (strain K-12) >gi|606076|gb|AAA57939.1| (U18997) ORF_o384
FT                   [Escherichia coli] >gi|1789525|gb|AAC76170.1| (AE000395)
FT                   putative tagatose-6-phosphate aldose/ketose isomerase
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33669"
FT                   /db_xref="GOA:Q9A0L7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0L7"
FT                   /protein_id="AAK33669.1"
FT                   /translation="MFTKTQEALEALGAAITTKEIKQEPRLWQETMTFFEETRDSLDSF
FT                   LKRVCNSANRNNVHVIFTGAGTSEYIGNTICPYLKKVGNRQRYLFESVASTDLVAAPDY
FT                   YLVEEETVLLVSFARSGNSPESVAAVNLVNQLVPNSYHLTITCAKDGELAKKAQQDERS
FT                   YLYLMPEDANDAGFAMTGSFTCMMLAALLIFDDANSIAQKEAYVTDMILAGQAVIDQER
FT                   RLQELADLGFERLVYLGSAGLAKLTQEAQLKMLELTAGQVATLYESFMGFRHGPKSFIN
FT                   DRTLVIGFVNNDAYVRQYDLDMLEEIQADGIALKILALLQGGDINFSEDQFRLDTRHLL
FT                   PDAYLAFPMILVAQTLALLTAVTLGNSPDTPSATGTVNRVVKGVTIHPYPTSSRQCNKA
FT                   "
FT   gene            complement(575766..576026)
FT                   /gene="rpmE"
FT                   /locus_tag="SPy_0717"
FT                   /old_locus_tag="SPy0717"
FT   CDS_pept        complement(575766..576026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="SPy_0717"
FT                   /old_locus_tag="SPy0717"
FT                   /product="50S ribosomal protein L31"
FT                   /note="Best Blastp hit = sp|Q9ZH28|RL31_LISMO 50S RIBOSOMAL
FT                   PROTEIN L31"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33670"
FT                   /db_xref="GOA:P66202"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66202"
FT                   /protein_id="AAK33670.1"
FT                   /translation="MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFEGETYPLI
FT                   RVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLKDANAAK"
FT   gene            complement(576141..577082)
FT                   /locus_tag="SPy_0720"
FT                   /old_locus_tag="SPy0720"
FT   CDS_pept        complement(576141..577082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0720"
FT                   /old_locus_tag="SPy0720"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06892.1| (AP001518) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0720"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33671"
FT                   /db_xref="GOA:Q9A0L5"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0L5"
FT                   /protein_id="AAK33671.1"
FT                   /translation="MITTFETILDKIKAHQTIIIHRHQNPDPDALGSQAGLKEIIAQNF
FT                   PDKKVLMTGFDEPSLAWISQMDQVTDKDYKEALVIITDTANRPRIDDERYTLGKCLIKI
FT                   DHHPNDDVYGDFYYVDTSASSASEIIADFAFSQNLTLSDKAAKLLYTGIVGDTGRFLYA
FT                   STTSKTLSIASQLRHFEFDFAAISRQMDSFPLKIAKLQSYVFEHLTIDESGAAYVLVSQ
FT                   ETLKHFDVTLAESSAIVCAPGKIDNVQAWAIFVELTDGNYRVRMRSKEKIINGIAKRHG
FT                   GGGHPLASGANSANLEENQAIFRELIAVCQEI"
FT   gene            577476..577925
FT                   /locus_tag="SPy_0721"
FT                   /old_locus_tag="SPy0721"
FT   CDS_pept        577476..577925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0721"
FT                   /old_locus_tag="SPy0721"
FT                   /product="putative flavodoxin"
FT                   /note="Best Blastp hit = sp|O34737|FLAV_BACSU PROBABLE
FT                   FLAVODOXIN 1 >gi|7430912|pir||C69866 flavodoxin homolog
FT                   ykuN - Bacillus subtilis >gi|2632235|emb|CAA10877.1|
FT                   (AJ222587) YkuN protein [Bacillus subtilis]
FT                   >gi|2633786|emb|CAB13288.1| (Z99111) similar to flavodoxin
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33672"
FT                   /db_xref="GOA:Q9A0L4"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0L4"
FT                   /protein_id="AAK33672.1"
FT                   /translation="MALAKIVYASMTGNTEEIADIVANKLQELGHDVDIDECTTVDASE
FT                   FENADIAVVATYTYGDGDLPDEIVDFYEDLQDLDLEGKIYGVVGSGDTFYDYFCKSVDD
FT                   FSEQFALTGAIKGAEPVKVDLAAEDEDIDRLEAFAEQLSQAVNNL"
FT   gene            578101..578385
FT                   /locus_tag="SPy_0722"
FT                   /old_locus_tag="SPy0722"
FT   CDS_pept        578101..578385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0722"
FT                   /old_locus_tag="SPy0722"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||D69207 conserved hypothetical
FT                   protein MTH804 - Methanobacterium thermoautotrophicum
FT                   (strain Delta H) >gi|2621894|gb|AAB85304.1| (AE000858)
FT                   chorismate mutase, subunit A [Methanobacterium
FT                   thermoautotrophicum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33673"
FT                   /db_xref="GOA:Q9A0L3"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR011279"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0L3"
FT                   /protein_id="AAK33673.1"
FT                   /translation="MRLEKIRQEINGIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQ
FT                   ARENQILDRVSYLVKDQAFEPAIHETFKTIMSLSRQYQTQHLTGGDIND"
FT   gene            578378..579640
FT                   /locus_tag="SPy_0723"
FT                   /old_locus_tag="SPy0723"
FT   CDS_pept        578378..579640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0723"
FT                   /old_locus_tag="SPy0723"
FT                   /product="putative transposase"
FT                   /note="Best Blastp hit = dbj|BAA75315.1| (AB011836) similar
FT                   to Bordetella paraperlussis transposase for insertion
FT                   sequence element(27%-identity) [Bacillus halodurans]
FT                   >gi|10173277|dbj|BAB04382.1| (AP001509) unknown conserved
FT                   protein in others [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33674"
FT                   /db_xref="GOA:Q9A0L2"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0L2"
FT                   /protein_id="AAK33674.2"
FT                   /translation="MIKSIATLPKPSLKEVLGLVGLALPIGGAVGVVDVIFGKGLLFLS
FT                   EYRDHHLFLLLPFLALAGLVIVFLYDKLGKEVRQGMGLVFQVGHGQKNQIPPILIPLIL
FT                   FSTWVTHLFGASAGREGVAVQIGATISHYCRRFVTSQEAARHLLIMGMAAGFAGLFQTP
FT                   IAAVVFALEVLLVGTLRYSALLPSLVAAYVASWTSHALGLEKFTIVLEETLTITPLTLV
FT                   KLIGLGLIFGLVGNSFAYLLGWFKPYLSQKLPNPYFRIAFIGALLSICLMIGHVGRYSG
FT                   LGTNLIAAAFSGQTILTYDWLLKMIVTVISLSAGFQGGEVTPLFAIGASLGIVLAPYLG
FT                   LPVLLVAALGYTTVFGSATNTFWAPIFIGIEVFGPENALAYFVTSAAAYMVSHRHSIYS
FT                   YQKVVMINLKDMTVNQMDLKK"
FT   gene            579755..580102
FT                   /gene="rplS"
FT                   /locus_tag="SPy_0724"
FT                   /old_locus_tag="SPy0724"
FT   CDS_pept        579755..580102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="SPy_0724"
FT                   /old_locus_tag="SPy0724"
FT                   /product="50S ribosomal protein L19"
FT                   /note="Best Blastp hit = sp|O34031|RL19_STRTR 50S RIBOSOMAL
FT                   PROTEIN L19 >gi|2444079|gb|AAC01534.1| (U88973) ribosomal
FT                   protein L19 [Streptococcus thermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0724"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33675"
FT                   /db_xref="GOA:P66084"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66084"
FT                   /protein_id="AAK33675.1"
FT                   /translation="MNPLIQSLTEGQLRSDIPNFRPGDTVRVHAKVVEGTRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGIGVERTFPIHTPRVDKIEVIRHGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   gene            580349..580420
FT                   /locus_tag="SPy_t38"
FT   tRNA            580349..580420
FT                   /locus_tag="SPy_t38"
FT                   /product="tRNA-Arg"
FT   gene            complement(580383..580745)
FT                   /locus_tag="SPy_0725"
FT                   /old_locus_tag="SPy0725"
FT                   /note="This sequence contains the C-terminal portion of a
FT                   putative integrase gene"
FT   gene            581114..581674
FT                   /locus_tag="SPy_0726"
FT                   /old_locus_tag="SPy0726"
FT   CDS_pept        581114..581674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0726"
FT                   /old_locus_tag="SPy0726"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||A57362 gyrb protein -
FT                   Streptococcus pneumoniae (fragment)
FT                   >gi|1052803|emb|CAA58770.1| (X83917) orflgyrb
FT                   [Streptococcus pneumoniae] >gi|1490396|emb|CAA91552.1|
FT                   (Z67740) unidentified [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33676"
FT                   /db_xref="GOA:Q9A0L1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0L1"
FT                   /protein_id="AAK33676.1"
FT                   /translation="MNYQDYIWDLGGTLLDNYELSTQAFVQTLAFFSLPGDHDAVYQKL
FT                   KESTAIAVAMFAPNEPEFLHVYRLREADKLAQPIWCLGAKEILGKIATSGSRNFLISHR
FT                   DCQVNQLLEQAGLLIYFTEVVTASNGFARKPNPESLFYLKEKYDINSGLVIGDRLIDKQ
FT                   AGQAAGFNTLLVDGRKNLLEIVT"
FT   gene            581675..583627
FT                   /gene="gyrB"
FT                   /locus_tag="SPy_0727"
FT                   /old_locus_tag="SPy0727"
FT   CDS_pept        581675..583627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SPy_0727"
FT                   /old_locus_tag="SPy0727"
FT                   /product="putative DNA gyrase, subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="Best Blastp hit = emb|CAA91553.1| (Z67740) DNA
FT                   gyrase [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0727"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33677"
FT                   /db_xref="GOA:Q9A0L0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0L0"
FT                   /protein_id="AAK33677.1"
FT                   /translation="MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGL
FT                   HHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVF
FT                   TVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAVVADL
FT                   EVIGTTDVTGTTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGME
FT                   QEEHFLYEGGIGSYVEFLNDKKDVIFETPIYTDGELEGIAVEVAMQYTTSYQETVMSFA
FT                   NNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPN
FT                   PQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRA
FT                   REVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIR
FT                   GKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIR
FT                   TLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSI
FT                   GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPR
FT                   RDFIEENAVYSTLDI"
FT   gene            583995..585719
FT                   /locus_tag="SPy_0728"
FT                   /old_locus_tag="SPy0728"
FT   CDS_pept        583995..585719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0728"
FT                   /old_locus_tag="SPy0728"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB06924.1| (AP001518) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33678"
FT                   /db_xref="GOA:Q9A0K9"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0K9"
FT                   /protein_id="AAK33678.1"
FT                   /translation="MSSGIILLIVAIVLLVIIAYLVGVIIRKRNDSLITSLEERKQALF
FT                   ALPVNDEIEEVKSLHLIGQSQTSFREWNQKWVDLTVNSFADIENHIFEAENLNDTFNFI
FT                   RAKHEINSVESQLNLVEEDIASIREALNILKEQEEKNSARVTHALDLYEKLQASISENE
FT                   DNFGSTMPEIDKQMKNIETEFSQFVALNSSGDPVEASEVLDRAEEHTIALGQITEQIPA
FT                   IVAKLEDDFPDQLDDLETGYRRLLEENYHFPEKNIEARFQEIRESIRANSSELVTLDLD
FT                   RAREENTHIQERIDSLYEVFEREIAAYKVAAKNSKMLPRYLEHVKRNNEQLKDEIARLS
FT                   RKYILSETESLTVKAFEKDIKEIEDSTLAVAEQFGLQEKPFSELQVTFERSIKTLTNVE
FT                   SGQMDVFAAVKDIEKIESQARHNLDVYVTQLHMIKRYMEKRHLPGIPQDFLSAFFTTSS
FT                   QLEALMDELSRGRINIEAVSRLSEVATVAIANLEDLTYQVVQNATLTEQLLQYSNRYRS
FT                   FEAGVQSSFEHALRLFEVENDYQASFDEISYALETVEPGVTDRFVNSYEKTREHIRF"
FT   gene            complement(585851..586309)
FT                   /locus_tag="SPy_0729"
FT                   /old_locus_tag="SPy0729"
FT   CDS_pept        complement(585851..586309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0729"
FT                   /old_locus_tag="SPy0729"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||B70008 hypothetical protein
FT                   yueI - Bacillus subtilis >gi|2635672|emb|CAB15165.1|
FT                   (Z99120) yueI [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33679"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K8"
FT                   /protein_id="AAK33679.1"
FT                   /translation="MTNLEDKLLKGAWGERRLNPEQQRYYLGTYAERVVLSALLDEAQT
FT                   KTVKDYLKRELPSLQLVYQPLHLKISSKLAPQLQILYMKLAKENHLPVTIITETHMTSP
FT                   FAFILHTDHAINLKETRLEVILKQTKNDQLSKQTPEKTKSFWKRFLKK"
FT   gene            586536..587843
FT                   /gene="eno"
FT                   /locus_tag="SPy_0731"
FT                   /old_locus_tag="SPy0731"
FT   CDS_pept        586536..587843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="SPy_0731"
FT                   /old_locus_tag="SPy0731"
FT                   /product="putative enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="The N-terminal amino acid sequence of this ORF has
FT                   been determined from a spot isolated by 2-D gel
FT                   electrophoresis from another strain of S. pyogenes. Hogan,
FT                   D. A., Whitton, M. M., Rogers, J. and R. A. VanBogelen.
FT                   2000. Two-dimensional gel electrophoresis map of
FT                   Streptococcus pyogenes proteins. Unpublished data.; Best
FT                   Blastp hit = dbj|BAA81815.1| (AB029313) enolase
FT                   [Streptococcus intermedius]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33680"
FT                   /db_xref="GOA:P69949"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69949"
FT                   /protein_id="AAK33680.1"
FT                   /translation="MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGE
FT                   HEAVELRDGDKSRYLGLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKG
FT                   KLGANAILGVSIAVARAAADYLEVPLYTYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQ
FT                   EFMIMPVGAPTFKEGLRWGAEVFHALKKILKERGLVTAVGDEGGFAPKFEGTEDGVETI
FT                   LKAIEAAGYEAGENGIMIGFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQVDYLEE
FT                   LVNKYPIITIEDGMDENDWDGWKVLTERLGKRVQLVGDDFFVTNTEYLARGIKENAANS
FT                   ILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSL
FT                   SRTDRIAKYNQLLRIEDQLGEVAQYKGIKSFYNLKK"
FT   gene            complement(588369..588959)
FT                   /locus_tag="SPy_0732"
FT                   /old_locus_tag="SPy0732"
FT   CDS_pept        complement(588369..588959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0732"
FT                   /old_locus_tag="SPy0732"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gb|AAF61316.1| (U96166) unknown
FT                   [Streptococcus cristatus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0732"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33681"
FT                   /db_xref="GOA:Q9A0K7"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K7"
FT                   /protein_id="AAK33681.1"
FT                   /translation="MSAIIRQSTSKRISDKRGIYLVEKLVSLAKQSYFTVTKTSPMIEE
FT                   VRYYAKELLRLSERRQAIFDKMVASAQPLPEDKILRSIPSIVETTATSIIGELGAIRRF
FT                   QSANQINAFIGIDFRHYESGNYLAQEHITKRGNPYAPKILFKCIHDIAFASHTNPCHIA
FT                   DFYEKRKRQSQTASTKPHTIASRHCLVRQCFTS"
FT   gene            complement(589008..589259)
FT                   /locus_tag="SPy_0733"
FT                   /old_locus_tag="SPy0733"
FT   CDS_pept        complement(589008..589259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0733"
FT                   /old_locus_tag="SPy0733"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = sp|Q62925|M3K1_RAT
FT                   MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 1 (MAPK/ERK
FT                   KINASE KINASE 1) (MEK KINASE 1) (MEKK 1)
FT                   >gi|7514007|pir||T10757 MAP kinase kinase (EC 2.7.1.-) 1 -
FT                   rat >gi|1354137|gb|AAC52596.1| (U48596) MAP kinase kinase
FT                   kinase 1 [Rattus norvegicus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33682"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K6"
FT                   /protein_id="AAK33682.1"
FT                   /translation="MRKADKLDTEKLAQSQFILVRKPTYVQEEVYQLLRDLSRFYQNLT
FT                   EDNIVRELRIAFTRSYKSLFLNWNTSYLHQLVSNTGMW"
FT   gene            complement(589626..591161)
FT                   /locus_tag="SPy_0735"
FT                   /old_locus_tag="SPy0735"
FT                   /note="This gene contains a sequence supported frame shift
FT                   mutation"
FT   gene            591675..597812
FT                   /gene="epf"
FT                   /locus_tag="SPy_0737"
FT                   /old_locus_tag="SPy0737"
FT   CDS_pept        591675..597812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epf"
FT                   /locus_tag="SPy_0737"
FT                   /old_locus_tag="SPy0737"
FT                   /product="putative extracellular matrix binding protein"
FT                   /note="Best Blastp hit = pir||T31110 extracellular matrix
FT                   binding protein - Abiotrophia defectiva (fragment)
FT                   >gi|3249003|gb|AAD03320.1| (AF067776) extracellular matrix
FT                   binding protein [Abiotrophia defectiva]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33683"
FT                   /db_xref="GOA:Q9A0K5"
FT                   /db_xref="InterPro:IPR011439"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K5"
FT                   /protein_id="AAK33683.1"
FT                   /translation="MRKVKKVFVSSCMLLTVGLGVAVPTGFSQSNGVMVVKAAEVPATD
FT                   LSRQASDSERVDESSLLQKENLSVDSFKLENLNGWEAENDTAGNLGKFKDPDSSGYQNI
FT                   LTSSGKNISVAVAPKGSGKMNIKVTKRSNFQGGYYVGGLRTQTPVLKLNDVYRYSFTTK
FT                   KLSGNSSEFKTRVKPVESNNKLGKELVIRVDNKNVSTKHDWLPDISDGTHTVDFTGLDK
FT                   KLSVAFRFSPRQTSNVVYEFSNINIKNISPASVPAIPSKVLEGTSVLSGTAISSGDTLE
FT                   KRKSFDGDILRVYKDSKIIARTVIKGNKWDVKLSKPLIAGEKLDFEILHPRSQNVSKKI
FT                   SKQVEAKPFDPASYKEKVIAKLKPVYEATSEKITNDAWLDENAKDLQKQKLEEQYISGK
FT                   VAISEAGTKQEAIDAAYNKYSSQTDPDSLPSQYKQGNKENEQEKGRQDLIQTRDLTLKA
FT                   IQEDKWLTEQEKTIQKEEALKAFETGIESVNQTVSLEQLKQRLIVYKASEKDSEKKEYP
FT                   ESIPNQHIPGKEKEVKAAKQEELKKLHDTTLEKINQDKWLTPDQQAEQLKQAEVTFKKG
FT                   QEAIKSAQTLTQLETDLADYVSENEGKGNSIPDKYKSGNKDDLVNKAEVKLKEAHEATK
FT                   QAIEKDPWLSPEQKKAQKEKAKARLDEGLKALKAADSLEILKVTEEAFVDKEKNPDSIP
FT                   NQHKAGTADQARKQALDSLDKEVQKELESIDNDNTLTTDEKAAAKKKVNDAYDVAKQTA
FT                   MEANSYEDLTTIKDEFLSNLPHKQGTPLKDQQSDAIAELEKKQQEIEKAIEGDKTLPRD
FT                   EKEKQIADSKERLKSDTQKVKDAKNADAIKKAFEEGKVNIPQAHIPGDLNKDKEKLLAE
FT                   LKQKADDTEKAIDVDKTLTEDEKKEQKVKTKAELEKAKTDVKNTQTREELDKKVPELKK
FT                   AIEDTHVKGNLEGVKNKAIEDLKKAHTETVAKINGDDTLDKATKEAQVKEADKALAAGK
FT                   DAITKADDADKVSTAVTEHTPKIKAAHKTGDLKKAQVDANTALDKAAEKERGEINKDAT
FT                   LTTEDKAKQLKEVETALTKAKDNVKAAKTADAINDARDKGVATIDAVHKAGQDLGARKS
FT                   GQVAKLEEAAKATKDKISADPTLTSKEKEEQSKAVDAELKKAIEAVNAADTADKVDDAL
FT                   GEGVTDIKNQHKSGDSIDARREAHGKELDRVAQETKGAIEKDPTLTTEEKAKQVKDVDA
FT                   AKERGMAKLNEAKDADALDKAYGEGVTDIKNQHKSGDPVDARRGLHNKSIDEVAQATKD
FT                   AITADTTLTEAEKETQRGNVDKEATKAKEELAKAKDADALDKAYGDGVTSIKNQHKSGK
FT                   GLDVRKDEHKKALEAVAKRVTAEIEADPTLTPEVREQQKAEVQKELELATDKIAEAKDA
FT                   DEADKAYGDGVTAIENAHVIGKGIEARKDLAKKDLAEAAAKTKALIIEDKTLTDDQRKE
FT                   QLLGVDTEYAKGIENIDAAKDAAGVDKAYSDGVRDILAQYKEGQNLNDRRNAAKEFLLK
FT                   EADKVTKLINDDPTLTHDQKVDQINKVEQAKLDAIKSVDDAQTADAINDALGKGIENIN
FT                   NQYQHGDGVDVRKATAKGDLEKEAAKVKALIAKDPTLTQADKDKQTAAVDAAKNTAIAA
FT                   VDKATTTEGINQELGKGITAINKAYRPGEGVKARKEAAKADLEKEAAKVKALITNDPTL
FT                   TKADKAKQTEAVAKALKAAIAAVDKATTAEGINQELGKGITAINKAYRPGEGVKARKEA
FT                   AKADLEREAAKVREAIANDPTLTKADKAKQTEAVAKALKAAIAAVDKATTAEGINQELG
FT                   KGITAINKAYRPGEGVEAHKEAAKANLEKVAKETKALISGDRYLSETEKAVQKQAVEQA
FT                   LAKALGQVEAAKTVEAVKLAENLGTVAIRSAYVAGLAKDTDQATAALNEAKQAAIEALK
FT                   QAAAETLAKITTDAKLTEAQKAEQSENVSLALKTAIATVRSAQSIASVKEAKDKGITAI
FT                   RAAYVPNKAVAKSSSANHLPKSGDANSIVLVGLGVMSLLLGMVLYSKKKESKD"
FT   gene            598677..598838
FT                   /gene="sagA"
FT                   /locus_tag="SPy_0738"
FT                   /old_locus_tag="SPy0738"
FT   CDS_pept        598677..598838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagA"
FT                   /locus_tag="SPy_0738"
FT                   /old_locus_tag="SPy0738"
FT                   /product="streptolysin S associated protein"
FT                   /note="Best Blastp hit = gb|AAC19115.1| (AF067723)
FT                   streptolysin S associated protein SAGA [Streptococcus
FT                   pyogenes] >gi|3283388|gb|AAC25177.1| (AF067649) SagA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33684"
FT                   /db_xref="InterPro:IPR019891"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAM4"
FT                   /protein_id="AAK33684.1"
FT                   /translation="MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGG
FT                   SGSYTPGK"
FT   gene            599060..600010
FT                   /gene="sagB"
FT                   /locus_tag="SPy_0739"
FT                   /old_locus_tag="SPy0739"
FT   CDS_pept        599060..600010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagB"
FT                   /locus_tag="SPy_0739"
FT                   /old_locus_tag="SPy0739"
FT                   /product="streptolysin S associated ORF"
FT                   /note="Best Blastp hit = gb|AAC25178.1| (AF067649) SagB
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33685"
FT                   /db_xref="GOA:Q7DAM3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAM3"
FT                   /protein_id="AAK33685.1"
FT                   /translation="MSFFTKEQQPKENCPPITVEKARQLFEFNTNHLSLSDYHHQTVLK
FT                   TSKQLVAQHLMPNATDNLSQHFLMNYKANNNYLGFQASIVDFFTDSAVANFSSSYVYES
FT                   QEKIIRLPKPTKISTALSTCIIKRRSHRQFSDRQMPLQDLSNILYYACGVSSQASIRDG
FT                   ASDKITLRNCASGGGLYPIHLVFYARNISKLIDGFYEYLPYQHALRCYRHSSEENVRDF
FT                   AEYGAINAENCNIIIIYVYHYMKNTRKYGNQATAYAFIESGEIAQNIQLTATALTYGSI
FT                   DIGGYNKEYLQELLDLDGLGEHVIHMTLVGTKESQ"
FT   gene            600007..601065
FT                   /gene="sagC"
FT                   /locus_tag="SPy_0740"
FT                   /old_locus_tag="SPy0740"
FT   CDS_pept        600007..601065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagC"
FT                   /locus_tag="SPy_0740"
FT                   /old_locus_tag="SPy0740"
FT                   /product="streptolysin S associated ORF"
FT                   /note="Best Blastp hit = gb|AAC25179.2| (AF067649) SagC
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33686"
FT                   /db_xref="InterPro:IPR019892"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K4"
FT                   /protein_id="AAK33686.1"
FT                   /translation="MKYQLNSNVRVVTFQDTFCFRKGIWDFNEAILDLTQEPQNLKIVY
FT                   QEIVSQLVKGVAIDTETYENTLEPETFANLMEVISGLYYNDMLMLEDDYNLEENVMKIL
FT                   MGNFRFMAQAGHMVSNDPVLFISDSTYVNESAELLAEQLHLQLQVASDDLKMLIQQTDV
FT                   SSRLDALEHRRNMNCLSDALCDYQSIIICQERLNIMMLRHLNEVSVAMKKQLVIGFVDG
FT                   PFLHTCTLNPPHSADFDSLERRVLARLQDSTLYQHFANQVLPATQDVSQAYLPLLNVLM
FT                   NLVVSEAFIIAQTGSSKFEGRLLSIYLPTLEIQVQDILKMSNSQTQGALAKLKYEDQQI
FT                   STREIVKKLLDE"
FT   gene            601085..602443
FT                   /locus_tag="SPy_0741"
FT                   /old_locus_tag="SPy0741"
FT   CDS_pept        601085..602443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0741"
FT                   /old_locus_tag="SPy0741"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = pir||E64436 conserved hypothetical
FT                   protein MJ1094 - Methanococcus jannaschii
FT                   >gi|1499943|gb|AAB99097.1| (U67552) conserved hypothetical
FT                   protein [Methanococcus jannaschii]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33687"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K3"
FT                   /protein_id="AAK33687.1"
FT                   /translation="MLYYYPSFNHIFDELKSLSGNRTGILNQSQVPVCNHPHDVYLKSI
FT                   TGQMPDYHKQFIGELSQVSYHIIGYGSYYEEALIKYLGESIERYATVIAGDLLSDRIVY
FT                   ASYNELKLLHKVMPLEYLQVFTQEQIALSCDLQMMMCDKMVTENDVLGWVKCPMFFEDA
FT                   EMYVPAQMLCVGYKTNETVGERRIIPGFSTGTASHKTLEAAMCNSLIEYIQIDSMMLSW
FT                   YTKKPCPKIIVDDPDIEVILEEARLGKDSLYDIIPIDMTVGEDNPLYTFGIILKNKYDE
FT                   GPYLLFGVQAGLDPKHALLRGIMEASAISYSYYYNLLYQKASLANIECEEPLFLDLDSN
FT                   VFYYAHPKDQDHKWKAFEPLISGEVLLSDLEDHSGKDKKEDLKTLLAYAKKVSPNAVFL
FT                   DITPPEALEKGWYVTRVLMPELLEMCIPAFPFANHPRMRQFGGVTNAFVHPMP"
FT   gene            602418..603089
FT                   /locus_tag="SPy_0742"
FT                   /old_locus_tag="SPy0742"
FT   CDS_pept        602418..603089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0742"
FT                   /old_locus_tag="SPy0742"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = dbj|BAB04194.1| (AP001508) unknown
FT                   conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33688"
FT                   /db_xref="GOA:Q9A0K2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K2"
FT                   /protein_id="AAK33688.1"
FT                   /translation="MPLSIQCLNLCFLLVTFCPSIPMQAIFGKEDSGYAFNLIGFLRAT
FT                   LIYDILALVSIYVLSPQITLSLESIDSKTFFMGLVFCVLIVLIELVFLHGLRCWQKKQW
FT                   LPATFSFVGTTNDWSKIGYPLLLALFEETIYRFLWFNILAFQWHLPTIIVLIVTSFCYA
FT                   LNHLLMGKSIFYAKLVTGIIYGSIYMLTSQLWLVVIMHVGGNLLVECLSHLQTKKKKEV
FT                   T"
FT   gene            603086..603769
FT                   /locus_tag="SPy_0743"
FT                   /old_locus_tag="SPy0743"
FT   CDS_pept        603086..603769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0743"
FT                   /old_locus_tag="SPy0743"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = no blast hits"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33689"
FT                   /db_xref="GOA:Q9A0K1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K1"
FT                   /protein_id="AAK33689.1"
FT                   /translation="MMLLVLLSFLGLTTLWLTSYRRRCLARWHLQWLVALSYQDFLDVL
FT                   LSLFQFVVIILVLFFYSATINLGEVLTFLTQTSWHWQILCYLVLYLMAIIEMTLLVLIL
FT                   IFDVLLQKDSRLLFKKITWLPFRQDKPVLSILLLGTVILVDSLFYLGLLILLGEQSLTS
FT                   LATLILGYGIVKACRYSGWLNVLLAFCLFTIVGLWAVTATLLYGWLVGAMILTVTYLMI
FT                   SCKEY"
FT   gene            603792..604715
FT                   /locus_tag="SPy_0744"
FT                   /old_locus_tag="SPy0744"
FT   CDS_pept        603792..604715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0744"
FT                   /old_locus_tag="SPy0744"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="Best Blastp hit = pir||G69803 ABC transporter
FT                   (ATP-binding protein) homolog yfiL - Bacillus subtilis
FT                   >gi|1817536|dbj|BAA11402.1| (D78508) YfiL [Bacillus
FT                   subtilis] >gi|2633155|emb|CAB12660.1| (Z99108) similar to
FT                   ABC transporter (ATP-binding protein) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33690"
FT                   /db_xref="GOA:Q9A0K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0K0"
FT                   /protein_id="AAK33690.1"
FT                   /translation="MSFVQLTNVVKSYKNGKKAVNDVSLSIEAGNIYGLLGPNGAGKST
FT                   LINLILGLIPLSSGKITVLGQSQKTIRKISSQIGYVPQDIAVYPDLTAYENVELFGSLY
FT                   GLKGAQLKKQVLKSLEFVGLHSQAKQFPSQFSGGMKRRLNIACALVHSPKLIIFDEPTV
FT                   GIDPQSRNHILESIRLLNKEGATVIYTTHYMEEVEALCDYIFIMDHGQVIEEGPKFELE
FT                   KRYVANLANQIIVTLTDSRHLELADKPDWSLIEDGEKLMLKIDNSDMTSVVHQLTQANI
FT                   TFSEIRHNHLNLEEIFLHLTGKKLRD"
FT   gene            604724..605851
FT                   /gene="sagH"
FT                   /locus_tag="SPy_0745"
FT                   /old_locus_tag="SPy0745"
FT   CDS_pept        604724..605851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagH"
FT                   /locus_tag="SPy_0745"
FT                   /old_locus_tag="SPy0745"
FT                   /product="ABC transporter (ATP-binding
FT                   protein)-streptolysin S associated ORF"
FT                   /note="Best Blastp hit = gb|AAD49330.1|AF163682_1
FT                   (AF163682) SagH [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0745"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33691"
FT                   /db_xref="GOA:Q9A0J9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0J9"
FT                   /protein_id="AAK33691.1"
FT                   /translation="MVLFHLIKKESLQIFRNRTALLMMVIFPILMIVILSFAFKSSFNT
FT                   ATTVPKLTIRYQLEGEKTDYQKNFLAFLKVLNQKLHLETKPSNSLEKDRQRVSEGALTA
FT                   VLEVKKNQTIKVITNNINQQNADLINMLVKNYVDNAKTYDSIAALYPQQLNHIRKRSVD
FT                   YVKVSSIQTSKGMTSADYYAISMFTMITFYSMMSAMNLVLSDRQQRITNRIHLTGVSPS
FT                   FLVFGKLIGAMLATTVQLSLLYIFTRFVLRVNWGTNEWMLIGITASLVYLSVAIGIGLG
FT                   ISIKNEAFLTVASNTIIPIFAFLGGSYVPLTTLHSSIINQLSNISPIKWVNDSLFYLIF
FT                   GGQYNPIPVTLIVNISIGTIFIILALIGMRKQVTT"
FT   gene            605848..606966
FT                   /locus_tag="SPy_0746"
FT                   /old_locus_tag="SPy0746"
FT   CDS_pept        605848..606966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0746"
FT                   /old_locus_tag="SPy0746"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="Best Blastp hit = pir||A69804 ABC transporter
FT                   (ATP-binding protein) homolog yfiN - Bacillus subtilis
FT                   >gi|1817538|dbj|BAA11404.1| (D78508) YfiN [Bacillus
FT                   subtilis] >gi|2633157|emb|CAB12662.1| (Z99108) similar to
FT                   ABC transporter (ATP-binding protein) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0746"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33692"
FT                   /db_xref="GOA:Q9A0J8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0J8"
FT                   /protein_id="AAK33692.1"
FT                   /translation="MICFIKTLFVKIKRKKTSYVTFFLMPILTTLLALSLSFSNNNQAK
FT                   IGILDKDNSQISKQFIAQLKQNKKYDIFTKIKKEHIDHYLQDKSLEAVLTIDKGFSDKV
FT                   LQGKSQKLNIRSIANSEITEWVKAQTNYLLENYNIIGDVALGNEDTFNRILQKNQQLNY
FT                   DVKQVTLTDRSRSKAVSSTTTGFLLILMLGSTSVIYSGILADKSSQLYHRLMLSNLSRF
FT                   RYMLSYVCVGFVAFTIQIVIMLSLLKVFNISFFVPTSLLLIIFFLFSLLAIGFGLLIGA
FT                   ITQNSQQSSQLANLIVMPTSMLAGCLWPLSITPSYMQAIGKLLPQNWVLSAIAIFQSGG
FT                   TLSQAWPYLLALMGTALALISFSSLLLKPTKL"
FT   gene            607537..610269
FT                   /locus_tag="SPy_0747"
FT                   /old_locus_tag="SPy0747"
FT   CDS_pept        607537..610269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0747"
FT                   /old_locus_tag="SPy0747"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||T36922 probable large
FT                   secreted protein - Streptomyces coelicolor
FT                   >gi|5420017|emb|CAB46409.1| (AL096743) putative large
FT                   secreted protein [Streptomyces coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0747"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33693"
FT                   /db_xref="GOA:Q9A0J7"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0J7"
FT                   /protein_id="AAK33693.1"
FT                   /translation="MINKKCIIPVSLLTLAITLTSVEEVTSRQNLTYANEIVTQRPKRE
FT                   SVISDKSNFPVISPYLASVDFGERKTPLPTPDKGVKVTTEQSIAQVRKGPEERPYTVTG
FT                   KITSVINGWGGYGFYIQDSEGIGLYVYPQKDLGYSKGDIVQLTGTLTRFKGDLQLQQVT
FT                   AHKKLELSFPTSVKEAVISELETTTPSTLVKLSHVTVGELSTDQYNNTSFLVRDDSGKS
FT                   IVVHIDHRTGVKGADVVTKISQGDLINLTAILSIVDGQLQLRPFSLEQLEVVKKVTSSN
FT                   SDASSRNIVKIGEIQGASHTSPLLKKAVTVEQVVVTYLDDSTHFYVQDLNGDGDLATSD
FT                   GIRVFAKNAKVQVGDVLTISGEVEEFFGRGYEERKQTDLTITQIVAKAVTKTGTAQVPS
FT                   PLVLGKDRIAPANIIDNDGLRVFDPEEDAIDYWESMEGMLVAVDDAKILGPMKNKEIYV
FT                   LPGSSTRPLNNSGGVLLPANSYNTDVIPVLFKKGKQIIKAGDSYKGRLAGPVSYSYGNY
FT                   KVFVDDSKNMPSLMDGHLKPEKTNLQKDLSKLSIASYNIENFSANPSSTKDEKVKRIAE
FT                   SFIHDLNAPDIIGLIEVQDNNGPTDDGTTDATQSAQRLIDAIKKLGGPTYRYVDIAPEN
FT                   NVDGGQPGGNIRTGFLYQPERVSLSDKPKGGARDALTWVNGELNLSVGRIDPTNAAWKD
FT                   VRKSLAAEFIFQGRKVVVVANHLNSKRGDNALYGCVQPVTFKSEQRRHVLANMLAQFAK
FT                   EGAKHQANIVMLGDFNDFEFTKTIQLIEEGDMVNLVSRHDISDRYSYFHQGNNQTLDNI
FT                   LVSRHLLDHYEFDMVHVNSPFMEAHGRASDHDPLLLQLSFSKENDKAESSKQSVKAKKT
FT                   SKGKLLPKTGDSLVYVITLLGTASLLVPILLLTKGKKES"
FT   gene            610547..611047
FT                   /locus_tag="SPy_0749"
FT                   /old_locus_tag="SPy0749"
FT   CDS_pept        610547..611047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0749"
FT                   /old_locus_tag="SPy0749"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = emb|CAA68244.1| (X99978)
FT                   citrulline cluster-linked gene [Lactobacillus plantarum]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0749"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33694"
FT                   /db_xref="GOA:Q9A0J6"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0J6"
FT                   /protein_id="AAK33694.1"
FT                   /translation="MTKLTVHDYVHIGLVAALYVVLTITPPLNAISYGMYQFRISEMMN
FT                   FLAFYHRKYIIAVTLGCMIANFYSFGLIDVFVGGGSTLIFVTLGVILFSKYQKDYLFNG
FT                   IFNKAFVYFSFFFATSMFNVAIELYFFGAPFLLTWFTTALGELVSLLIGSLIIDKLSQR
FT                   ISF"
FT   gene            611241..613199
FT                   /gene="lig"
FT                   /locus_tag="SPy_0751"
FT                   /old_locus_tag="SPy0751"
FT   CDS_pept        611241..613199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="SPy_0751"
FT                   /old_locus_tag="SPy0751"
FT                   /product="putative DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /note="Best Blastp hit = sp|O87703|DNLJ_BACST DNA LIGASE
FT                   (POLYDEOXYRIBONUCLEOTIDE SYNTHASE [NAD+])
FT                   >gi|3688229|emb|CAA09732.1| (AJ011676) DNA ligase [Bacillus
FT                   stearothermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33695"
FT                   /db_xref="GOA:Q9A0J5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9A0J5"
FT                   /protein_id="AAK33695.1"
FT                   /translation="MKKRIKELTDLLNRYRYDYYTKDAPSVSDSDYDKLYRELVTLEQS
FT                   YPEYVLQDSPTQQVGGTILKGFEKYRHQYPLFSLQDAFSREELDAFDKRVKAEFPNATY
FT                   LAELKIDGLSISLSYENGFLQVGATRGDGNIGENITENIKKIKDIPYQLSEPLTITVRG
FT                   EAYMSRQSFKAINEARQENGETEFANPRNAAAGTLRQLDTSVVAKRQLATFLYQEASPT
FT                   ARNQQNEVLAELADLGFSVNPYYQLTSSMDEIWDFIKTIEAKRDQLAYDIDGVVIKVNS
FT                   LAMQEELGFTVKAPRWAIAYKFPAEEKEAEILSVDWTVGRTGVVTPTANLTPVQLAGTT
FT                   VSRATLHNVDYIAEKDIRIGDTVIVYKAGDIIPAVLNVVMSKRNQQEVMLIPKLCPSCG
FT                   SELVHFEDEVALRCINPLCPSLIQRSLEHFASRDAMNITGLGPAIVEKLFLAGFVHDVA
FT                   DIYQLTKEDFMQLDGIKEKSADKLLAAIEASKSNSAEKLLFGLGIRHIGSKVSRLILEV
FT                   YGDISALLTAKEEEIARIDGLGSTIAQSLTQYFEQKTAAILVDELKTAGVNMHYSGQKV
FT                   NSDAALFGLTVVLTGKLNQLNRNEAKDKLEALGAKVTGSVSKKTDLVIAGSDAGSKLEK
FT                   AKSLGIRIEDEDWLRQL"
FT   gene            613213..614235
FT                   /locus_tag="SPy_0752"
FT                   /old_locus_tag="SPy0752"
FT   CDS_pept        613213..614235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPy_0752"
FT                   /old_locus_tag="SPy0752"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = pir||F69795 conserved hypothetical
FT                   protein yerQ - Bacillus subtilis
FT                   >gi|2632986|emb|CAB12492.1| (Z99107) similar to
FT                   hypothetical proteins [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SPy_0752"
FT                   /db_xref="EnsemblGenomes-Tr:AAK33696"
FT                   /db_xref="GOA:Q9A0J4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q9A0J4"
FT                   /protein_id="AAK33696.1"
FT                   /translation="MKKQLRARLIYNPTSGQELMRKSVPEVLDILEGFGYETSAFQTTA
FT                   QKNSALNEARRAAKAGFDLLIAAGGDGTINEVVNGIAPLKKRPKMAIIPTGTTNDFARA
FT                   LKVPRGNPSQAAKLIGKNQTIQMDIGRAKKDTYFINIAAAGSLTELTYSVPSQLKTMFG
FT                   YLAYLAKGVELLPRVSNVPVKITHDKGVFEGQVSMIFAAITNSVGGFEMIAPDAKLDDG
FT                   MFTLILIKTANLFEIVHLLRLILDGGKHITDRRVEYIKTSKIVIEPQCGKRMMINLDGE
FT                   YGGDAPITLENLKNHITFFADTDLISDDALVLDQDELEIEEIVKKFAHEVEDLGQELEE
FT                   "
FT   gene            614628..614825
FT                   /gene="atpE"
FT                   /locus_tag="SPy_0754"
FT                   /old_locus_tag="SPy0754"
FT   CDS_pept        614628..614825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="SPy_0754"
FT                   /old_locus_tag="SPy0754"
FT                   /product="H+-transporting ATP synthase chain C"
FT                   /EC_number="3.6.3.14"
FT                   /note="Best Blastp hit = gb|AAD00920.1| (AF001955) UncE
FT                   [Streptococcus sanguinis]"
FT                   /db_x