(data stored in ACNUC7421 zone)

EMBL: AE004969

ID   AE004969; SV 1; circular; genomic DNA; STD; PRO; 2153922 BP.
XX
AC   AE004969;
XX
PR   Project:PRJNA23;
XX
DT   17-FEB-2005 (Rel. 82, Created)
DT   23-JUN-2016 (Rel. 129, Last updated, Version 9)
XX
DE   Neisseria gonorrhoeae FA 1090, complete genome.
XX
KW   .
XX
OS   Neisseria gonorrhoeae FA 1090
OC   Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales; Neisseriaceae;
OC   Neisseria.
XX
RN   [1]
RP   1-2153922
RA   Lewis L.A., Gillaspy A.F., McLaughlin R.E., Gipson M., Ducey T.F.,
RA   Ownbey T., Hartman K., Nydick C., Carson M.B., Vaughn J., Thomson C.,
RA   Song L., Lin S., Yuan X., Najar F., Zhan M., Ren Q., Zhu H., Qi S.,
RA   Kenton S.M., Lai H., White J.D., Clifton S., Roe B.A., Dyer D.W.;
RT   "The Complete Genome Sequence of Neisseria gonorrhoeae";
RL   Unpublished.
XX
RN   [2]
RP   1-2153922
RA   Lewis L.A., Gillaspy A.F., McLaughlin R.E., Gipson M., Ducey T.F.,
RA   Ownbey T., Hartman K., Nydick C., Carson M.B., Vaughn J., Thomson C.,
RA   Song L., Lin S., Yuan X., Najar F., Zhan M., Ren Q., Zhu H., Qi S.,
RA   Kenton S.M., Lai H., White J.D., Clifton S., Roe B.A., Dyer D.W.;
RT   ;
RL   Submitted (10-MAR-2003) to the INSDC.
RL   Microbiology and Immunology, University of Oklahoma Health Sciences Center,
RL   975 NE 10th St., Oklahoma City, OK 73104, USA
XX
DR   MD5; 00b0701b6ca8456c29436d89fd1ab2f9.
DR   BioSample; SAMN02604088.
DR   EnsemblGenomes-Gn; EBG00001450827.
DR   EnsemblGenomes-Gn; EBG00001450828.
DR   EnsemblGenomes-Gn; EBG00001450829.
DR   EnsemblGenomes-Gn; EBG00001450830.
DR   EnsemblGenomes-Gn; EBG00001450831.
DR   EnsemblGenomes-Gn; EBG00001450832.
DR   EnsemblGenomes-Gn; EBG00001450833.
DR   EnsemblGenomes-Gn; EBG00001450834.
DR   EnsemblGenomes-Gn; EBG00001450835.
DR   EnsemblGenomes-Gn; EBG00001450836.
DR   EnsemblGenomes-Gn; EBG00001450837.
DR   EnsemblGenomes-Gn; EBG00001450838.
DR   EnsemblGenomes-Gn; EBG00001450839.
DR   EnsemblGenomes-Gn; EBG00001450840.
DR   EnsemblGenomes-Gn; EBG00001450841.
DR   EnsemblGenomes-Gn; EBG00001450842.
DR   EnsemblGenomes-Gn; EBG00001450843.
DR   EnsemblGenomes-Gn; EBG00001450844.
DR   EnsemblGenomes-Gn; EBG00001450845.
DR   EnsemblGenomes-Gn; EBG00001450846.
DR   EnsemblGenomes-Gn; EBG00001450847.
DR   EnsemblGenomes-Gn; EBG00001450848.
DR   EnsemblGenomes-Gn; EBG00001450849.
DR   EnsemblGenomes-Gn; EBG00001450850.
DR   EnsemblGenomes-Gn; EBG00001450851.
DR   EnsemblGenomes-Gn; EBG00001450852.
DR   EnsemblGenomes-Gn; EBG00001450853.
DR   EnsemblGenomes-Gn; EBG00001450854.
DR   EnsemblGenomes-Gn; EBG00001450855.
DR   EnsemblGenomes-Gn; EBG00001450856.
DR   EnsemblGenomes-Gn; EBG00001450857.
DR   EnsemblGenomes-Gn; EBG00001450858.
DR   EnsemblGenomes-Gn; EBG00001450859.
DR   EnsemblGenomes-Gn; EBG00001450860.
DR   EnsemblGenomes-Gn; EBG00001450861.
DR   EnsemblGenomes-Gn; EBG00001450862.
DR   EnsemblGenomes-Gn; EBG00001450863.
DR   EnsemblGenomes-Gn; EBG00001450864.
DR   EnsemblGenomes-Gn; EBG00001450865.
DR   EnsemblGenomes-Gn; EBG00001450866.
DR   EnsemblGenomes-Gn; EBG00001450867.
DR   EnsemblGenomes-Gn; EBG00001450868.
DR   EnsemblGenomes-Gn; EBG00001450869.
DR   EnsemblGenomes-Gn; EBG00001450870.
DR   EnsemblGenomes-Gn; EBG00001450871.
DR   EnsemblGenomes-Gn; EBG00001450872.
DR   EnsemblGenomes-Gn; EBG00001450873.
DR   EnsemblGenomes-Gn; EBG00001450874.
DR   EnsemblGenomes-Gn; EBG00001450875.
DR   EnsemblGenomes-Gn; EBG00001450876.
DR   EnsemblGenomes-Gn; EBG00001450877.
DR   EnsemblGenomes-Gn; EBG00001450878.
DR   EnsemblGenomes-Gn; EBG00001450879.
DR   EnsemblGenomes-Gn; EBG00001450880.
DR   EnsemblGenomes-Gn; EBG00001450881.
DR   EnsemblGenomes-Gn; EBG00001450882.
DR   EnsemblGenomes-Gn; EBG00001450883.
DR   EnsemblGenomes-Gn; EBG00001450884.
DR   EnsemblGenomes-Gn; EBG00001450885.
DR   EnsemblGenomes-Gn; EBG00001450886.
DR   EnsemblGenomes-Gn; EBG00001450887.
DR   EnsemblGenomes-Gn; EBG00001450888.
DR   EnsemblGenomes-Gn; EBG00001450889.
DR   EnsemblGenomes-Gn; EBG00001450890.
DR   EnsemblGenomes-Gn; EBG00001450891.
DR   EnsemblGenomes-Gn; EBG00001450892.
DR   EnsemblGenomes-Gn; EBG00001450893.
DR   EnsemblGenomes-Gn; EBG00001450894.
DR   EnsemblGenomes-Gn; EBG00001450895.
DR   EnsemblGenomes-Gn; EBG00001450896.
DR   EnsemblGenomes-Gn; EBG00001450897.
DR   EnsemblGenomes-Gn; EBG00001450898.
DR   EnsemblGenomes-Gn; EBG00001450899.
DR   EnsemblGenomes-Gn; EBG00001450900.
DR   EnsemblGenomes-Gn; EBG00001450901.
DR   EnsemblGenomes-Gn; EBG00001450902.
DR   EnsemblGenomes-Gn; EBG00001450903.
DR   EnsemblGenomes-Gn; EBG00001450904.
DR   EnsemblGenomes-Gn; EBG00001450905.
DR   EnsemblGenomes-Gn; EBG00001450906.
DR   EnsemblGenomes-Gn; NGO_18786.
DR   EnsemblGenomes-Gn; NGO_18791.
DR   EnsemblGenomes-Gn; NGO_18796.
DR   EnsemblGenomes-Gn; NGO_18801.
DR   EnsemblGenomes-Gn; NGO_18806.
DR   EnsemblGenomes-Gn; NGO_18811.
DR   EnsemblGenomes-Gn; NGO_18816.
DR   EnsemblGenomes-Gn; NGO_18821.
DR   EnsemblGenomes-Gn; NGO_18826.
DR   EnsemblGenomes-Gn; NGO_18831.
DR   EnsemblGenomes-Gn; NGO_18836.
DR   EnsemblGenomes-Gn; NGO_18841.
DR   EnsemblGenomes-Gn; NGO_18846.
DR   EnsemblGenomes-Gn; NGO_18851.
DR   EnsemblGenomes-Gn; NGO_18856.
DR   EnsemblGenomes-Gn; NGO_18861.
DR   EnsemblGenomes-Gn; NGO_18866.
DR   EnsemblGenomes-Gn; NGO_18871.
DR   EnsemblGenomes-Gn; NGO_18876.
DR   EnsemblGenomes-Gn; NGO_18881.
DR   EnsemblGenomes-Gn; NGO_18886.
DR   EnsemblGenomes-Gn; NGO_18891.
DR   EnsemblGenomes-Gn; NGO_18896.
DR   EnsemblGenomes-Gn; NGO_18901.
DR   EnsemblGenomes-Gn; NGO_18906.
DR   EnsemblGenomes-Gn; NGO_18911.
DR   EnsemblGenomes-Gn; NGO_18916.
DR   EnsemblGenomes-Gn; NGO_18921.
DR   EnsemblGenomes-Gn; NGO_18926.
DR   EnsemblGenomes-Gn; NGO_18931.
DR   EnsemblGenomes-Gn; NGO_18936.
DR   EnsemblGenomes-Gn; NGO_18941.
DR   EnsemblGenomes-Gn; NGO_18946.
DR   EnsemblGenomes-Gn; NGO_18951.
DR   EnsemblGenomes-Gn; NGO_18956.
DR   EnsemblGenomes-Gn; NGO_18961.
DR   EnsemblGenomes-Gn; NGO_18966.
DR   EnsemblGenomes-Gn; NGO_18971.
DR   EnsemblGenomes-Gn; NGO_18976.
DR   EnsemblGenomes-Gn; NGO_18981.
DR   EnsemblGenomes-Gn; NGO_18986.
DR   EnsemblGenomes-Gn; NGO_18991.
DR   EnsemblGenomes-Gn; NGO_18996.
DR   EnsemblGenomes-Gn; NGO_19001.
DR   EnsemblGenomes-Gn; NGO_19006.
DR   EnsemblGenomes-Gn; NGO_19011.
DR   EnsemblGenomes-Gn; NGO_19016.
DR   EnsemblGenomes-Gn; NGO_19021.
DR   EnsemblGenomes-Gn; NGO_19026.
DR   EnsemblGenomes-Gn; NGO_19031.
DR   EnsemblGenomes-Gn; NGO_19036.
DR   EnsemblGenomes-Gn; NGO_19041.
DR   EnsemblGenomes-Gn; NGO_19046.
DR   EnsemblGenomes-Gn; NGO_19051.
DR   EnsemblGenomes-Gn; NGO_19056.
DR   EnsemblGenomes-Gn; NGO_19061.
DR   EnsemblGenomes-Gn; NGO_19066.
DR   EnsemblGenomes-Gn; NGO_19071.
DR   EnsemblGenomes-Gn; NGO_19076.
DR   EnsemblGenomes-Gn; NGO_19081.
DR   EnsemblGenomes-Gn; NGO_19086.
DR   EnsemblGenomes-Gn; NGO_19091.
DR   EnsemblGenomes-Gn; NGO_19096.
DR   EnsemblGenomes-Gn; NGO_19101.
DR   EnsemblGenomes-Gn; NGO_19106.
DR   EnsemblGenomes-Gn; NGO_19111.
DR   EnsemblGenomes-Gn; NGO_19116.
DR   EnsemblGenomes-Gn; NGO_19121.
DR   EnsemblGenomes-Tr; EBT00001604560.
DR   EnsemblGenomes-Tr; EBT00001604561.
DR   EnsemblGenomes-Tr; EBT00001604562.
DR   EnsemblGenomes-Tr; EBT00001604563.
DR   EnsemblGenomes-Tr; EBT00001604564.
DR   EnsemblGenomes-Tr; EBT00001604565.
DR   EnsemblGenomes-Tr; EBT00001604566.
DR   EnsemblGenomes-Tr; EBT00001604567.
DR   EnsemblGenomes-Tr; EBT00001604568.
DR   EnsemblGenomes-Tr; EBT00001604569.
DR   EnsemblGenomes-Tr; EBT00001604570.
DR   EnsemblGenomes-Tr; EBT00001604571.
DR   EnsemblGenomes-Tr; EBT00001604572.
DR   EnsemblGenomes-Tr; EBT00001604573.
DR   EnsemblGenomes-Tr; EBT00001604574.
DR   EnsemblGenomes-Tr; EBT00001604575.
DR   EnsemblGenomes-Tr; EBT00001604576.
DR   EnsemblGenomes-Tr; EBT00001604577.
DR   EnsemblGenomes-Tr; EBT00001604578.
DR   EnsemblGenomes-Tr; EBT00001604579.
DR   EnsemblGenomes-Tr; EBT00001604580.
DR   EnsemblGenomes-Tr; EBT00001604581.
DR   EnsemblGenomes-Tr; EBT00001604582.
DR   EnsemblGenomes-Tr; EBT00001604583.
DR   EnsemblGenomes-Tr; EBT00001604584.
DR   EnsemblGenomes-Tr; EBT00001604585.
DR   EnsemblGenomes-Tr; EBT00001604586.
DR   EnsemblGenomes-Tr; EBT00001604587.
DR   EnsemblGenomes-Tr; EBT00001604588.
DR   EnsemblGenomes-Tr; EBT00001604589.
DR   EnsemblGenomes-Tr; EBT00001604590.
DR   EnsemblGenomes-Tr; EBT00001604591.
DR   EnsemblGenomes-Tr; EBT00001604592.
DR   EnsemblGenomes-Tr; EBT00001604593.
DR   EnsemblGenomes-Tr; EBT00001604594.
DR   EnsemblGenomes-Tr; EBT00001604595.
DR   EnsemblGenomes-Tr; EBT00001604596.
DR   EnsemblGenomes-Tr; EBT00001604597.
DR   EnsemblGenomes-Tr; EBT00001604598.
DR   EnsemblGenomes-Tr; EBT00001604599.
DR   EnsemblGenomes-Tr; EBT00001604600.
DR   EnsemblGenomes-Tr; EBT00001604601.
DR   EnsemblGenomes-Tr; EBT00001604602.
DR   EnsemblGenomes-Tr; EBT00001604603.
DR   EnsemblGenomes-Tr; EBT00001604604.
DR   EnsemblGenomes-Tr; EBT00001604605.
DR   EnsemblGenomes-Tr; EBT00001604606.
DR   EnsemblGenomes-Tr; EBT00001604607.
DR   EnsemblGenomes-Tr; EBT00001604608.
DR   EnsemblGenomes-Tr; EBT00001604609.
DR   EnsemblGenomes-Tr; EBT00001604610.
DR   EnsemblGenomes-Tr; EBT00001604611.
DR   EnsemblGenomes-Tr; EBT00001604612.
DR   EnsemblGenomes-Tr; EBT00001604613.
DR   EnsemblGenomes-Tr; EBT00001604614.
DR   EnsemblGenomes-Tr; EBT00001604615.
DR   EnsemblGenomes-Tr; EBT00001604616.
DR   EnsemblGenomes-Tr; EBT00001604617.
DR   EnsemblGenomes-Tr; EBT00001604618.
DR   EnsemblGenomes-Tr; EBT00001604619.
DR   EnsemblGenomes-Tr; EBT00001604620.
DR   EnsemblGenomes-Tr; EBT00001604621.
DR   EnsemblGenomes-Tr; EBT00001604622.
DR   EnsemblGenomes-Tr; EBT00001604623.
DR   EnsemblGenomes-Tr; EBT00001604624.
DR   EnsemblGenomes-Tr; EBT00001604625.
DR   EnsemblGenomes-Tr; EBT00001604626.
DR   EnsemblGenomes-Tr; EBT00001604627.
DR   EnsemblGenomes-Tr; EBT00001604628.
DR   EnsemblGenomes-Tr; EBT00001604629.
DR   EnsemblGenomes-Tr; EBT00001604630.
DR   EnsemblGenomes-Tr; EBT00001604631.
DR   EnsemblGenomes-Tr; EBT00001604632.
DR   EnsemblGenomes-Tr; EBT00001604633.
DR   EnsemblGenomes-Tr; EBT00001604634.
DR   EnsemblGenomes-Tr; EBT00001604635.
DR   EnsemblGenomes-Tr; EBT00001604636.
DR   EnsemblGenomes-Tr; EBT00001604637.
DR   EnsemblGenomes-Tr; EBT00001604638.
DR   EnsemblGenomes-Tr; EBT00001604639.
DR   EnsemblGenomes-Tr; NGO_18786-1.
DR   EnsemblGenomes-Tr; NGO_18791-1.
DR   EnsemblGenomes-Tr; NGO_18796-1.
DR   EnsemblGenomes-Tr; NGO_18801-1.
DR   EnsemblGenomes-Tr; NGO_18806-1.
DR   EnsemblGenomes-Tr; NGO_18811-1.
DR   EnsemblGenomes-Tr; NGO_18816-1.
DR   EnsemblGenomes-Tr; NGO_18821-1.
DR   EnsemblGenomes-Tr; NGO_18826-1.
DR   EnsemblGenomes-Tr; NGO_18831-1.
DR   EnsemblGenomes-Tr; NGO_18836-1.
DR   EnsemblGenomes-Tr; NGO_18841-1.
DR   EnsemblGenomes-Tr; NGO_18846-1.
DR   EnsemblGenomes-Tr; NGO_18851-1.
DR   EnsemblGenomes-Tr; NGO_18856-1.
DR   EnsemblGenomes-Tr; NGO_18861-1.
DR   EnsemblGenomes-Tr; NGO_18866-1.
DR   EnsemblGenomes-Tr; NGO_18871-1.
DR   EnsemblGenomes-Tr; NGO_18876-1.
DR   EnsemblGenomes-Tr; NGO_18881-1.
DR   EnsemblGenomes-Tr; NGO_18886-1.
DR   EnsemblGenomes-Tr; NGO_18891-1.
DR   EnsemblGenomes-Tr; NGO_18896-1.
DR   EnsemblGenomes-Tr; NGO_18901-1.
DR   EnsemblGenomes-Tr; NGO_18906-1.
DR   EnsemblGenomes-Tr; NGO_18911-1.
DR   EnsemblGenomes-Tr; NGO_18916-1.
DR   EnsemblGenomes-Tr; NGO_18921-1.
DR   EnsemblGenomes-Tr; NGO_18926-1.
DR   EnsemblGenomes-Tr; NGO_18931-1.
DR   EnsemblGenomes-Tr; NGO_18936-1.
DR   EnsemblGenomes-Tr; NGO_18941-1.
DR   EnsemblGenomes-Tr; NGO_18946-1.
DR   EnsemblGenomes-Tr; NGO_18951-1.
DR   EnsemblGenomes-Tr; NGO_18956-1.
DR   EnsemblGenomes-Tr; NGO_18961-1.
DR   EnsemblGenomes-Tr; NGO_18966-1.
DR   EnsemblGenomes-Tr; NGO_18971-1.
DR   EnsemblGenomes-Tr; NGO_18976-1.
DR   EnsemblGenomes-Tr; NGO_18981-1.
DR   EnsemblGenomes-Tr; NGO_18986-1.
DR   EnsemblGenomes-Tr; NGO_18991-1.
DR   EnsemblGenomes-Tr; NGO_18996-1.
DR   EnsemblGenomes-Tr; NGO_19001-1.
DR   EnsemblGenomes-Tr; NGO_19006-1.
DR   EnsemblGenomes-Tr; NGO_19011-1.
DR   EnsemblGenomes-Tr; NGO_19016-1.
DR   EnsemblGenomes-Tr; NGO_19021-1.
DR   EnsemblGenomes-Tr; NGO_19026-1.
DR   EnsemblGenomes-Tr; NGO_19031-1.
DR   EnsemblGenomes-Tr; NGO_19036-1.
DR   EnsemblGenomes-Tr; NGO_19041-1.
DR   EnsemblGenomes-Tr; NGO_19046-1.
DR   EnsemblGenomes-Tr; NGO_19051-1.
DR   EnsemblGenomes-Tr; NGO_19056-1.
DR   EnsemblGenomes-Tr; NGO_19061-1.
DR   EnsemblGenomes-Tr; NGO_19066-1.
DR   EnsemblGenomes-Tr; NGO_19071-1.
DR   EnsemblGenomes-Tr; NGO_19076-1.
DR   EnsemblGenomes-Tr; NGO_19081-1.
DR   EnsemblGenomes-Tr; NGO_19086-1.
DR   EnsemblGenomes-Tr; NGO_19091-1.
DR   EnsemblGenomes-Tr; NGO_19096-1.
DR   EnsemblGenomes-Tr; NGO_19101-1.
DR   EnsemblGenomes-Tr; NGO_19106-1.
DR   EnsemblGenomes-Tr; NGO_19111-1.
DR   EnsemblGenomes-Tr; NGO_19116-1.
DR   EnsemblGenomes-Tr; NGO_19121-1.
DR   EuropePMC; PMC1138962; 15689189.
DR   EuropePMC; PMC1231103; 16113287.
DR   EuropePMC; PMC1273834; 16239538.
DR   EuropePMC; PMC1307039; 16299348.
DR   EuropePMC; PMC134828; 11807051.
DR   EuropePMC; PMC1392657; 16455901.
DR   EuropePMC; PMC142797; 12533455.
DR   EuropePMC; PMC143252; 12496210.
DR   EuropePMC; PMC1470461; 16719561.
DR   EuropePMC; PMC1482861; 16672599.
DR   EuropePMC; PMC1483004; 16788186.
DR   EuropePMC; PMC151967; 12399486.
DR   EuropePMC; PMC1538595; 16734888.
DR   EuropePMC; PMC1539610; 16861678.
DR   EuropePMC; PMC1636224; 17015660.
DR   EuropePMC; PMC1797815; 17305430.
DR   EuropePMC; PMC1931599; 17615066.
DR   EuropePMC; PMC1951848; 17496077.
DR   EuropePMC; PMC2265139; 18305155.
DR   EuropePMC; PMC2395056; 18390650.
DR   EuropePMC; PMC2493241; 18426887.
DR   EuropePMC; PMC2519523; 18606739.
DR   EuropePMC; PMC2519540; 18586945.
DR   EuropePMC; PMC2519546; 18567658.
DR   EuropePMC; PMC2612434; 18978065.
DR   EuropePMC; PMC2612780; 16824104.
DR   EuropePMC; PMC2667262; 19390608.
DR   EuropePMC; PMC2731217; 19476432.
DR   EuropePMC; PMC2737842; 19528266.
DR   EuropePMC; PMC2753986; 19396954.
DR   EuropePMC; PMC2798252; 19854909.
DR   EuropePMC; PMC2837549; 20093260.
DR   EuropePMC; PMC2838043; 20139191.
DR   EuropePMC; PMC2859308; 19574307.
DR   EuropePMC; PMC2893595; 20525335.
DR   EuropePMC; PMC2896483; 19748342.
DR   EuropePMC; PMC2924362; 20808844.
DR   EuropePMC; PMC305346; 14611665.
DR   EuropePMC; PMC3067668; 21257765.
DR   EuropePMC; PMC3078933; 21533118.
DR   EuropePMC; PMC3080098; 21299643.
DR   EuropePMC; PMC3125207; 21711902.
DR   EuropePMC; PMC3187199; 21856854.
DR   EuropePMC; PMC3256722; 22075591.
DR   EuropePMC; PMC3454330; 23029370.
DR   EuropePMC; PMC3497525; 23002223.
DR   EuropePMC; PMC3553714; 23183436.
DR   EuropePMC; PMC3676050; 23564168.
DR   EuropePMC; PMC3685207; 23760461.
DR   EuropePMC; PMC3811788; 23876804.
DR   EuropePMC; PMC3899283; 24466206.
DR   EuropePMC; PMC3911633; 24198404.
DR   EuropePMC; PMC3941690; 24568221.
DR   EuropePMC; PMC3942440; 24594737.
DR   EuropePMC; PMC400613; 15126492.
DR   EuropePMC; PMC4014563; 24811061.
DR   EuropePMC; PMC406496; 15084227.
DR   EuropePMC; PMC4068544; 24820072.
DR   EuropePMC; PMC4135677; 24837286.
DR   EuropePMC; PMC4176332; 25143534.
DR   EuropePMC; PMC4212839; 25336458.
DR   EuropePMC; PMC4269198; 25566225.
DR   EuropePMC; PMC4329845; 25802857.
DR   EuropePMC; PMC4428587; 19486161.
DR   EuropePMC; PMC4487204; 26122105.
DR   EuropePMC; PMC4549065; 22045584.
DR   EuropePMC; PMC4620152; 26579097.
DR   EuropePMC; PMC4635466; 25701734.
DR   EuropePMC; PMC4685087; 26733970.
DR   EuropePMC; PMC4751805; 26574512.
DR   EuropePMC; PMC4778046; 26939573.
DR   EuropePMC; PMC4862482; 26976873.
DR   EuropePMC; PMC4914677; 27067334.
DR   EuropePMC; PMC4937508; 27141096.
DR   EuropePMC; PMC4966432; 27246574.
DR   EuropePMC; PMC5035231; 27353397.
DR   EuropePMC; PMC5091375; 27638945.
DR   EuropePMC; PMC532417; 15576794.
DR   EuropePMC; PMC5399841; 28431495.
DR   EuropePMC; PMC545610; 15687191.
DR   EuropePMC; PMC5563589; 28652307.
DR   EuropePMC; PMC5610715; 29026659.
DR   EuropePMC; PMC5923098; 29530847.
DR   EuropePMC; PMC6083905; 30087172.
DR   EuropePMC; PMC6107182; 30138416.
DR   EuropePMC; PMC6159555; 30063202.
DR   EuropePMC; PMC6209400; 30397529.
DR   EuropePMC; PMC6365954; 30766523.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01344; CRISPR-DR34.
DR   RFAM; RF01416; NrrF.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01843; neisseria_FSE.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02270; nse_sRNA.
DR   RFAM; RF02274; AniS.
DR   SILVA-LSU; AE004969.
DR   SILVA-SSU; AE004969.
DR   StrainInfo; 118547; 0.
XX
CC   Reannotation of genome was requested by submitter.
CC   Annotation was added by the NCBI Prokaryotic Genome Annotation
CC   Pipeline (released 2013). Information about the Pipeline can be
CC   found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
CC   Annotation modified by submitter.
CC   ##Genome-Annotation-Data-START##
CC   Annotation Provider          :: NCBI
CC   Annotation Date              :: 06/22/2015 16:11:21
CC   Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
CC                                   Pipeline
CC   Annotation Method            :: Best-placed reference protein set;
CC                                   GeneMarkS+
CC   Annotation Software revision :: 2.10
CC   Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
CC                                   repeat_region
CC   Genes                        :: 2,350
CC   CDS                          :: 2,157
CC   Pseudo Genes                 :: 125
CC   rRNAs                        :: 12 (5S, 16S, 23S)
CC   tRNAs                        :: 55
CC   ncRNA                        :: 1
CC   Frameshifted Genes           :: 80
CC   ##Genome-Annotation-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2153922
FT                   /organism="Neisseria gonorrhoeae FA 1090"
FT                   /strain="FA 1090"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:242231"
FT   gene            159..1715
FT                   /locus_tag="NGO_0001"
FT   CDS_pept        159..1715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88774"
FT                   /db_xref="GOA:Q5FAJ2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAJ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002241969.1"
FT                   /protein_id="AAW88774.1"
FT                   /translation="MTLAEFWPLCLRRLHDMLPHGQFAQWIAPLTVGEEGGVWVVYGKN
FT                   QFACNMLKSQFAGKIEAVREELAAGRPAFVFKPGEGVRYEMAAVEGAVEPAEPSLHAGS
FT                   EEMPVQEVLLDELPSEKPVKPAASKTAADILAERMKNLPHEPRQAAGPASRPESAAVAK
FT                   ARTDAQRDAEEARYEQTNLSPDYTFDTLVEGKGNRLAAAAAQAIAENPGQSYNPFFLYG
FT                   STGLGKTHLVQAVGNELLKNRPDAKVRYMHSDDYIRSFMKAVRNNTYDVFKQQYKQYDL
FT                   LIIDDIQFIKGKDRTMEEFFYLYNHFHNEKKQLILTCDVLPAKIEGMDDRLKSRFSWGL
FT                   TLELEPPELEMRIAILQKKAEAAGISIEDEAALFIANLIRSNVRELEGAFNRVGASSRF
FT                   MNRPVIDIDLARTALQDIIAEKHKVITADIIIDAVAKYYRIKISDVLGKKRTRNIARPR
FT                   QVAMSLTKELTTLSLPSIGDSFGGRDHTTVMHGIRAVAKLREEDPELAQDYEKLLILIQ
FT                   N"
FT   gene            1795..2898
FT                   /locus_tag="NGO_0002"
FT   CDS_pept        1795..2898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88775"
FT                   /db_xref="GOA:Q5FAJ1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAJ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003708363.1"
FT                   /protein_id="AAW88775.1"
FT                   /translation="MLILQAERDSLLKPLQAFTGIVERLHTLPILSNVLIEGRGGQTKL
FT                   LATDLEIQIDTAGPEGGAGDFRITTNAKKFQDILRALPAGALVSLDWDDNRLTLKAGKS
FT                   RFALQTLPAADFPMMNVGEDISATFSLGQERFKTMLSQVQYSMAVQDIRYYLNGLLMQV
FT                   EGSQLRLVATDGHRLAYAACAIDADLPRAEVILPRKTVLELFKLLNNPDDPIQIELLDK
FT                   QVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFVLSRAELLGALERVSILANEKFRG
FT                   ARLFLQPGLLSVVCSNNEQEEAREEIEIAYQGGELEVGFNIGYLMDVLRNIHSDDMQLA
FT                   FGDANRSTLFTVPNNPNFKYIVMPMRI"
FT   gene            complement(3047..5104)
FT                   /locus_tag="NGO_0003"
FT   CDS_pept        complement(3047..5104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0003"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88776"
FT                   /db_xref="GOA:Q5FAJ0"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAJ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5FAJ0.1"
FT                   /protein_id="AAW88776.1"
FT                   /translation="MTEQNRILCRELSLLAFNRRVLAQAEDKNVPLLERLRFLCIVSSN
FT                   LDEFFEVRMAWLKRENKLHPRRRPDNGKMPSETIADVTEAARSLIRHQYDLFNNVLQPE
FT                   LARESIHFYRRRNWTGTQKKWIEDYFDRELLPILTPIGLDPSHPFPRPLNKSLNFAVEL
FT                   DGTDAFGRPSGMAIVQAPRILPRVVPLPSELCGGGHGFVFLSSILHAHVGKLFPGMNVK
FT                   GCHQFRLTRDSDLTVDEEDVQNLRAAIQNELHDREYGDGVRLEVADTCPAYIRDFLLAQ
FT                   FRLTDAELYQVKGPVNLVRLNAVPDLVNRPDLKFPPHTPGRLKALGKNSPIFDLVRQSP
FT                   ILLHHPYQSFDPVVDMIREAAADPAVLAVKMTIYRTGTRSELVPALMKAALADKQVTVV
FT                   VELMARFDEANNVNWAKQLEEAGAHVVYGVFGYKVHAKMALVIRREDGVLKRYAHLGTG
FT                   NYHQGTSRIYTDFGLITADEQITADVNTLFMEITGLGKPGRLNKLYQSPFTLHKMVIGR
FT                   IARETEHAKAGKPARITAKMNSLIEPTVIEALYRASAAGVQIDLIVRGMCTLRPGVKGL
FT                   SENIRVRSIVGRQLEHARVYCFHNNGADDTFISSADWMGRNFFRRIETATPITAPELKK
FT                   RVIREGLEMALADNTHAWLMQPDGGYIRAAPAEGESEADLQNDLWDLLRG"
FT   gene            complement(5273..5716)
FT                   /locus_tag="NGO_0004"
FT   CDS_pept        complement(5273..5716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88777"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAI9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003751571.1"
FT                   /protein_id="AAW88777.1"
FT                   /translation="MPPRLLSGILCCLLTTAPVFAQGQPDAVSAYIQKKKVIVDTSKAE
FT                   LCFADDRQCHPVLIGTATPKGTFGLTLNSTDKPGYGGEVIGFKQEGDFLFALHRVWNQI
FT                   PSERRNERIASPSVSDRIMTNGCINVSDAVYEKLRHYFVLEVI"
FT   gene            complement(5723..6239)
FT                   /pseudo
FT                   /locus_tag="NGO_00025"
FT                   /note="SmpA / OmlA family protein; disrupted"
FT   gene            6506..9136
FT                   /gene="leuS"
FT                   /locus_tag="NGO_0006"
FT   CDS_pept        6506..9136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="NGO_0006"
FT                   /product="leucine--tRNA ligase"
FT                   /EC_number="6.1.1.4"
FT                   /note="leucine--tRNA ligase; LeuRS; class-I aminoacyl-tRNA
FT                   synthetase; charges leucine by linking carboxyl group to
FT                   alpha-phosphate of ATP and then transfers
FT                   aminoacyl-adenylate to its tRNA; due to the large number of
FT                   codons that tRNA(Leu) recognizes, the leucyl-tRNA
FT                   synthetase does not recognize the anticodon loop of the
FT                   tRNA, but instead recognition is dependent on a conserved
FT                   discriminator base A37 and a long arm; an editing domain
FT                   hydrolyzes misformed products; in Methanothermobacter
FT                   thermautotrophicus this enzyme associates with prolyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88778"
FT                   /db_xref="GOA:Q5FAJ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAJ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B4RNT1.1"
FT                   /protein_id="AAW88778.2"
FT                   /translation="MQEHYQPAAIEPAAQKKWDDARISNVSEDASKPKYYCLSMFPYPS
FT                   GKLHMGHVRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAMKNNVAPAAWTYDN
FT                   IEYMKTQLKSLGFAIDWEREVATCKPEYYRWEQWLFTKLFEKGIVYRKNGTVNWDPVDQ
FT                   TVLANEQVIDGRGWRSGALIEKREIPMYYFKITDYAEELLNDLDKLEHWPEQVKTMQRN
FT                   WIGKSRGMTVRFAVSDDSKQGLEGDYAKFLQVYTTRPDTLMGATYVAVAAEHPLATAAA
FT                   ADKPELQAFIAECKAGSVAEADMATMEKKGVPTGRYVVNPLNGDKLEVWIANYVLWGYG
FT                   DGAVMAVPAHDERDFEFAAKYNLPKKQVIAVGDNAFDANRWQEWYGDKENGVLVNSGDL
FT                   DGLDFQTAFDAVAAKLQSQGAGEPKTQYRLRDWGISRQRYWGCPIPIVHCEKCGDVPVP
FT                   ADQLPVVLPENVVPDGMGSPLAKMPEFYETSCPCCGGAAKRETDTMDTFMESSWYFFRY
FT                   MSPKFSDGMVSAESAKYWGAVDQYIGGIEHAILHLLYARFFTKLMRDEGLVNVDEPFER
FT                   LLTQGMVVCETYYRENDKGGKDWINPADVELTFDDKGRPVSAVLKADGLPVVISGTEKM
FT                   SKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFLRRLWRTVYE
FT                   YLKQGGAVKAFAGNQDGLSKELKDLRHKLHSTTAKVSDDYGRRQQFNTAIAAVMELLNQ
FT                   YDKTDTGSEQGRAVAQEVLEAAVRLLWPIVPHICETLWSELNGAKLWEAGWPTVDEAAL
FT                   VKSEIEVMVQVNGKLRGKITVAADASKADLEAAALANEGAVKFMEGKPAKKIIVVPGRL
FT                   VNIVV"
FT   gene            9365..10294
FT                   /locus_tag="NGO_0007"
FT   CDS_pept        9365..10294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0007"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88779"
FT                   /db_xref="GOA:Q5FAK4"
FT                   /db_xref="InterPro:IPR010324"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041368"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAK4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010950969.1"
FT                   /protein_id="AAW88779.1"
FT                   /translation="MNLFFDTQLGKQQNKATHKIRVMSEAWLEKNGYCPCCGSKPMQRF
FT                   ANNKPVADLFCPNCHEQYELKSKNQKTIGNSVPDGAYRTMLERIRSDTNPNFFFLAYKK
FT                   ADYSIRQLVLVPKHFITPDMIIPRNKGIKNRPHHIMCSINLAPLPESGKIFLIDDSRII
FT                   EPETVLKKWQSNLFLRNQNAERKDWLLAVMKCIDQLTEEFTLSQMYEFENKLSIQFPQN
FT                   NHIKDKIRQQLQILRDQNMIEFIGRGLYKKNRQIAPNSQGVLISNHDTEFTRNIYSSAI
FT                   LKTVEVQRNIAAKGSSRKKVGELLAIYD"
FT   gene            10287..11094
FT                   /pseudo
FT                   /locus_tag="NGO_00040"
FT                   /note="DNA methyltransferase; disrupted"
FT   gene            11091..11646
FT                   /pseudo
FT                   /locus_tag="NGO_0009"
FT                   /note="hypothetical protein"
FT   gene            complement(12107..12307)
FT                   /locus_tag="NGO_0010"
FT   CDS_pept        complement(12107..12307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88782"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAK1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704992.1"
FT                   /protein_id="AAW88782.1"
FT                   /translation="MPDRIKPSRNGGGTDGIARQQGTAQTGAKPETSPTARHGDFLRPL
FT                   QGGLDLSGTGLKAKRAGRRTV"
FT   gene            complement(12417..12728)
FT                   /locus_tag="NGO_0011"
FT   CDS_pept        complement(12417..12728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0011"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88783"
FT                   /db_xref="GOA:Q5FAK0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAK0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002241961.1"
FT                   /protein_id="AAW88783.1"
FT                   /translation="MKYKSGIFAAIHETMQGLHDIGAIDKKTMRGFDKSCLTEIKPLSG
FT                   GDIKAIREKEALSQAAFAIYLNVGKNHVSAWERGVKKPSGAALKLLTIVKNKGIEAIA"
FT   gene            complement(12725..13092)
FT                   /pseudo
FT                   /locus_tag="NGO_00060"
FT                   /note="addiction module toxin RelE; disrupted"
FT   gene            13341..13625
FT                   /locus_tag="NGO_0015"
FT   CDS_pept        13341..13625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88784"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAJ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704991.1"
FT                   /protein_id="AAW88784.1"
FT                   /translation="MRFGFSFRYAPTAKTVKNRKTPKVVTDSLPFVTAFVTNFLSFSYF
FT                   YSELNLNRYGVASPCRTICTVCGSPPCPDLNLIHYISYTYLSNFSPVTR"
FT   gene            complement(13982..14067)
FT                   /locus_tag="NGO_18786"
FT   tRNA            complement(13982..14067)
FT                   /locus_tag="NGO_18786"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:complement(14031..14033),aa:Leu,seq:gag)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(14081..14431)
FT                   /locus_tag="NGO_0016"
FT   CDS_pept        complement(14081..14431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0016"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88785"
FT                   /db_xref="GOA:Q5FAJ8"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAJ8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687220.1"
FT                   /protein_id="AAW88785.1"
FT                   /translation="MEAFKTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQ
FT                   GVFGSAGNANFLSRSTAVAATFFFATCMAMVYIHTHTTKHGLDFSNIRQTQQAPKPVSN
FT                   TEPSAPVPQQQK"
FT   gene            complement(14438..15211)
FT                   /locus_tag="NGO_0017"
FT   CDS_pept        complement(14438..15211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0017"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88786"
FT                   /db_xref="GOA:Q5FAJ7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAJ7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002240772.1"
FT                   /protein_id="AAW88786.1"
FT                   /translation="MYRQIGMWDQKWVIGNWKMNGRLQNNNALMHRFRILPTAERVLIG
FT                   LAAPTVYLLQLHNAMQIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIG
FT                   HSERSLYFGEKNEIQRRKMENVLNVGLIPLLCVGESLEERETGKEHEVIAHQLSILQGL
FT                   DTKNIAVAYEPVWAIGTGKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADN
FT                   AADIFAVPYVDGALVGGASLSYDSFTAIISAAQNA"
FT   gene            15370..15897
FT                   /locus_tag="NGO_0018"
FT   CDS_pept        15370..15897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0018"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88787"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAJ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003696618.1"
FT                   /protein_id="AAW88787.1"
FT                   /translation="MYANMGDMMHALHFSASDKAALYREVLPQIESVVADEADWVANLA
FT                   NTAAVLKEAFGWLWVGFYFVDTRSDELVLAPFQGPLACTRIPFGRGVCGQAWAKGETVV
FT                   VKDVNAHPDHIACSSLSRSEIVVPLFSDGRCIGVLDADSEHLAQFDEADALYLGELAKI
FT                   LERRFEASSQAA"
FT   gene            16000..16656
FT                   /locus_tag="NGO_0019"
FT   CDS_pept        16000..16656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0019"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88788"
FT                   /db_xref="GOA:Q5FAJ5"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAJ5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014574231.1"
FT                   /protein_id="AAW88788.1"
FT                   /translation="MDFEKARFNMVEQQIRPWDVLDFDVLDALEEIPRELFADESLQGL
FT                   AYADMELPLANGHKMLEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVS
FT                   DDIDAERQKRAKAVLDGLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVTLVPEVLKEQ
FT                   LKDGGRMAVIVGRRPVQRALLITRRGDVFEEKVLFDTLVAHLDDKDAHPFDSFNF"
FT   gene            16737..17060
FT                   /locus_tag="NGO_0020"
FT   CDS_pept        16737..17060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0020"
FT                   /product="sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88789"
FT                   /db_xref="GOA:Q5FAJ4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAJ4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002247146.1"
FT                   /protein_id="AAW88789.1"
FT                   /translation="MDIVQLPSAALKAWMDEGRMFCLLDVRTDEEAAVCSLPNALHIPM
FT                   NLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAEAGFENLYNLQGGIDAWAVEVDAEM
FT                   ARY"
FT   gene            complement(17323..19500)
FT                   /locus_tag="NGO_0021"
FT   CDS_pept        complement(17323..19500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0021"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88790"
FT                   /db_xref="GOA:Q5FAL3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAL3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214666.1"
FT                   /protein_id="AAW88790.1"
FT                   /translation="MTRFKYSLLFAALLPVYAQADVSVSDDPKPQESTELPTITVTADR
FT                   TASSNDGYTVSGTHTPFGLPMTLREIPQSVSVITSQQMRDQNIKTLDRALLQATGTSRQ
FT                   IYGSDRAGYNYLFARGSRIANYQINGIPVADALADTGNANTAAYERVEVVRGVAGLPDG
FT                   TGEPSATVNLVRKHPTRKPLFEVRAEAGNRKHFGLGADVSGSLNAEGTLRGRLVSTFGR
FT                   GDSWRQLERSRDAELYGILEYDIAPQTRVHAGMDYQQAKETADAPLSYAVYDSQGYATA
FT                   FGPKDNPATNWSNSRNRALNLFAGIEHRFNQDWKLKAEYDYTRSRFRQPYGVAGVLSID
FT                   HSTAATDLIPGYWHADPRTHSASMSLTGKYRLFGREHDLIAGINGYKYASNKYGERSII
FT                   PNAIPNAYEFSRTGAYPQPSSFAQTIPQYDTRRQIGGYLATRFRAADNLSLILGGRYSR
FT                   YRAGSYNSRTQGMTYVSANRFTPYTGIVFDLTGNLSLYGSYSSLFVPQLQKDEHGSYLK
FT                   PVTGNNLEADIKGEWLEGRLNASAAVYRARKNNLATAAGRDQSGNTYYRAANQAKTHGW
FT                   EIEVGGRITPEWQIQAGYSQSKPRDQDGSRLNPDSVPERSFKLFTAYHLAPEAPSGRTI
FT                   GAGVRRQGETHTDPAALRIPNPAAKARAVANSRQKAYAVADIMARYRFNPRTELSLNVD
FT                   NLFNKHYRTQPDRHSYGALRTVNAAFTYRFK"
FT   gene            complement(19763..20086)
FT                   /locus_tag="NGO_0022"
FT   CDS_pept        complement(19763..20086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0022"
FT                   /product="cupin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88791"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAL2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003768951.1"
FT                   /protein_id="AAW88791.1"
FT                   /translation="MQNETINLKQHLAAIKEYWQPEIINRHGFQFRLVKLLVDYGWHTH
FT                   GYSDKVLFAVEGDMAVDFADGGNMTIREGEMAVVPKSVSHRPRSENGCSVVLIDLPDPS
FT                   EAA"
FT   gene            complement(20119..21090)
FT                   /locus_tag="NGO_0023"
FT   CDS_pept        complement(20119..21090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0023"
FT                   /product="iron ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88792"
FT                   /db_xref="GOA:Q5FAL1"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAL1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010356564.1"
FT                   /protein_id="AAW88792.1"
FT                   /translation="MKPRFYWAACAVLPAACSPEPAAEKTVSAASQAASTPVATLTVPT
FT                   ARGDAVVPKNPERVAVYDWAALDTLTEPGVNVGATTAPVRVDYLQPAFDKAATVGTLFE
FT                   PDCESLHRHNPQFVITGGPGAEAYEQLAKNATTIDLTVDNGNIRTSGEKQMETLSRIFG
FT                   KEARVAELNAQIDALFAQKREAAKGKGRGLVLSVTGNKVSAFGTQSRLASWIHGDIGLP
FT                   PVDESLRNEGHGQPVSFEYIKEKNPGWIFIIDRTAAIGQEGPAAVEVLDNALVCGTNAW
FT                   KRKQIIVMPAANYIVAGGARQLIQAAEQLKAAFEKAEPVAAQ"
FT   gene            21326..22282
FT                   /locus_tag="NGO_0025"
FT   CDS_pept        21326..22282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0025"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88794"
FT                   /db_xref="GOA:Q5FAK9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAK9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003782512.1"
FT                   /protein_id="AAW88794.1"
FT                   /translation="MNTAAIYRQYQTYVRSDKSGWALDGCSDSALIAQAKQPGLHLKMC
FT                   INRFDSGITLSRMRGGGTGAFPTEIHNFSHNCALFVMVSGQNRLQMGGREYRPSAGEIW
FT                   LVRGELADVSETLLPDSGGMCALHLDFSLEKLRRWHDEGLLDERLFSPQTIGRFALQRL
FT                   AQNAGTLTAAACPLLQRPFESDGFGLLADEADALELSARLLRFTFRRHDNGYRRRRIDE
FT                   AADILNSEFARPLTIAEIARRVGLNECYLKRYFKAQTGETVAGRLRRLRLEHALALIES
FT                   GSTIQAAMHFCGYRHAGRFNEAFRRHYGFLPSDVKKC"
FT   gene            complement(22395..24410)
FT                   /locus_tag="NGO_0026"
FT   CDS_pept        complement(22395..24410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0026"
FT                   /product="prolyl endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88795"
FT                   /db_xref="GOA:Q5FAK8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAK8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002239320.1"
FT                   /protein_id="AAW88795.1"
FT                   /translation="MKSYPDPYRHFENLDSAETQNFAAEANAETRARFLNNDKARALSD
FT                   GILNQMQDTRQIPFCQEHRARMYHFHQNAEYPKGVYRMCTAATYRSGYPEWKILFSVAD
FT                   FDELLGDDVYLGGVSHLVEQPNRALLTLNKSGGDTAYTLEVDLEAGELVEGGFHFPAGK
FT                   NHVSWRDENSVWVCPAWDERQLTESGYPREVWLVERGKSFEESLPAYQIDKGAMMVNAW
FT                   RYLDPQGSPIDLIEASDGFYTKTYLQVSSEGGAKPLNLPNDCDVVGYLAGHLLLTLRKD
FT                   WHRANQSYPSGALVAVKLNRGELGAAQLLFAPDETQALESVETTKRFVVASLLENVQGR
FT                   LKAWRFADSKWQEAELPHLPSGALEMTDQPWGGDVVYLAASDFTTPLTLFALDLNVMEL
FT                   TVMRLQPQQFVSDGIEVRQFWAVSSDGERIPYFHVGKNAAPDTPTLVYAYGGFGIPELP
FT                   HYLGSVGKYWLEEGNAFVLANIRGGGEFGPRWHQAAQGISKHKSVDDLLAVVRDLSERG
FT                   MSSPKHIGLQGGSNGGLITAAAFVREPQSIGALVCEVPLTDMIRYPLLSAGSSWTDEYG
FT                   NPQKYEACKRRLGELSPYHNLSDGIDYPPALITTSLSDDRVHPAHALKFYAKLRETSPQ
FT                   SWLYSPDGGGHTGNGTQRESADKLACVLLFLKEFLG"
FT   gene            complement(24506..25816)
FT                   /locus_tag="NGO_0027"
FT   CDS_pept        complement(24506..25816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0027"
FT                   /product="N-acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88796"
FT                   /db_xref="GOA:Q5FAK7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="PDB:2R8V"
FT                   /db_xref="PDB:2R98"
FT                   /db_xref="PDB:3B8G"
FT                   /db_xref="PDB:3D2M"
FT                   /db_xref="PDB:3D2P"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAK7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003696632.1"
FT                   /protein_id="AAW88796.1"
FT                   /translation="MNAPDSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTLNKLAA
FT                   DIGLLSQLGIRLVLIHGAYHFLDRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAGTVRS
FT                   RFEAALCGSVSGFARAPSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQLD
FT                   AGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDGISRPDGTLAETL
FT                   SAQEAQSLAEHAASETRRLISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSI
FT                   AKEAFVSIRQAHSGDIPHIAALIRPLEEQGVLLHRSREYLENHISEFSILEHDGDLYGC
FT                   AALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWF
FT                   AERGFQTASEDELPETRRKDYRSNGRNPHILVRRLHR"
FT   gene            complement(25813..26241)
FT                   /locus_tag="NGO_0028"
FT   CDS_pept        complement(25813..26241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0028"
FT                   /product="MJ0042 family finger-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88797"
FT                   /db_xref="GOA:Q5FAK6"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAK6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687243.1"
FT                   /protein_id="AAW88797.1"
FT                   /translation="MPACFCPHCKTRLWVKETQLNVAQGFVVCQKCEGLFKAKDHLAST
FT                   KEPIFNDLPEAVSDVKLVHRIGTHAISKKQISRDEIADILNGGTTLHDTPPATAAAAPA
FT                   AAPQVSVPPARQEGLNWTIATLFALIVLIMQLSYLFIL"
FT   gene            complement(26309..26950)
FT                   /gene="pyrE"
FT                   /locus_tag="NGO_0029"
FT   CDS_pept        complement(26309..26950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="NGO_0029"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="involved in fifth step of pyrimidine biosynthesis;
FT                   converts orotidine 5'-phosphate and diphosphate to orotate
FT                   and 5-phospho-alpha-D-ribose 1-diphosphate"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88798"
FT                   /db_xref="GOA:Q5FAK5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAK5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A9M1F6.1"
FT                   /protein_id="AAW88798.1"
FT                   /translation="MTDFRQDFLKFSLAQNVLKFGEFTTKAGRRSPYFFNAGLFNDGAS
FT                   TLQLAKFYAQSIIESGIRFDMLFGPAYKGIILAAATAMMLAEKGVNVPFAYNRKEAKDR
FT                   GEGGVLVGAPLKGRVLIIDDVISAGTSVRESIKLIEAEGATPAGVAIALDRMEKGTGKL
FT                   SAVQEVEKQYGLPVAPIASLNDLFILLQNNPEFGQFLEPVRTYRRQYGVE"
FT   gene            complement(27012..27749)
FT                   /locus_tag="NGO_0030"
FT   CDS_pept        complement(27012..27749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0030"
FT                   /product="DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88799"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAI8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010791194.1"
FT                   /protein_id="AAW88799.1"
FT                   /translation="MLSARYLHLHEALGLGPMWLKQAAAVLPPKNTPATPAQARPQTVR
FT                   AATIRPSQPHNVQTRLETMKALETAAVHTRKPAPETETPPPGLSDGIAPVPAASGITKL
FT                   AVVSLCPPIEDAVYGQLFHGKAGILLDNILKAAGLDAAYVHKTCWVKTAAVGNPMPSEQ
FT                   AVADALGQIARELDGCRAPAVLFLGQAFVNLERQAMIETLCGSRPFFIIDHPARLLRQP
FT                   ELKARNWQVLKQLKRALRQGGGS"
FT   gene            complement(27743..28183)
FT                   /locus_tag="NGO_0031"
FT   CDS_pept        complement(27743..28183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0031"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88800"
FT                   /db_xref="GOA:Q5FAI7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAI7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702201.1"
FT                   /protein_id="AAW88800.1"
FT                   /translation="MNIRPASPSDCAALAALDTVCNPSAWTQRQFESALVSPSEQVFLA
FT                   EKDGRIAAFIVWQNLPDESELHLIATAPECRRRGVASALLEYWYAHLPEGTQRLLLEVR
FT                   AGNAAAQALYTKHGFSIAGRRKNYYCAADGQTEDAVLMEKIC"
FT   gene            complement(28180..28857)
FT                   /locus_tag="NGO_0032"
FT   CDS_pept        complement(28180..28857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0032"
FT                   /product="glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88801"
FT                   /db_xref="GOA:Q5FAI6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAI6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002251540.1"
FT                   /protein_id="AAW88801.1"
FT                   /translation="MQADFNRPVLAVDTGTSYLSLALRADGEIRLFHQEVGIRQSELIL
FT                   PEIRTLFRNAGITAADLGAIVYAKGPGAFTGLRIGIGVAQGLATPFDTPLIGIPTLDAA
FT                   ASLPPPQSCILAAADARMGEVFYAWFDTLNRRRLSDYQVGRAADIALPEGYVFSDGIGS
FT                   AFALENRPPFSGKPDMPTAADFLALALGGGYPATGAAHAELLYVRNKIALTAKEQAERK
FT                   ART"
FT   gene            complement(28996..29835)
FT                   /locus_tag="NGO_0033"
FT   CDS_pept        complement(28996..29835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0033"
FT                   /product="factor H binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88802"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR014902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAI5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704982.1"
FT                   /protein_id="AAW88802.2"
FT                   /translation="MNRTTFCCLSLTAGPDSDRLQQRRGGGGGVAADIGTGLADALTAP
FT                   LDHKDKGLKSLTLEASIPQNGTLTLSAQGAEKTFKAGGKDNSLNTGKLKNDKISRFDFV
FT                   QKIEVDGQTITLASGEFQIYKQDHSAVVALRIEKINNPDKIDSLINQRSFLVSDLGGEH
FT                   TAFNQLPDGKAEYHGKAFSSDDADGKLTYTIDFAAKQGHGKIEHLKTPEQNVELASAEL
FT                   KADEKSHAVILGDTRYGGEEKGTYRLALFGDRAQEIAGSATVKIGEKVHEIGIADKQ"
FT   gene            complement(29992..31056)
FT                   /locus_tag="NGO_0034"
FT   CDS_pept        complement(29992..31056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0034"
FT                   /product="fructose-1,6-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="class II aldolase; catalyzes the reversible aldol
FT                   condensation of dihydroxyacetonephosphate and
FT                   glyceraldehyde 3-phosphate in the Calvin cycle, glycolysis
FT                   and gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88803"
FT                   /db_xref="GOA:Q5FAI4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:5U4N"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAI4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219833.1"
FT                   /protein_id="AAW88803.1"
FT                   /translation="MALVSMRQLLDHAAENSYGLPAFNVNNLEQMRAIMEAADQVNAPV
FT                   IVQASAGARKYAGAPFLRHLILAAVEEFPHIPVVMHQDHGASPDVCQRSIQLGFSSVMM
FT                   DGSLLEDGKTPSSYEYNVNATRTVVNFSHACGVSVEGEIGVLGNLETGEAGEEDGVGAA
FT                   GKLSHDQMLTSVEDAVRFVKDTGVDALAIAVGTSHGAYKFTRPPTGDVLRIDRIKEIHQ
FT                   ALPNTHIVMHGSSSVPQEWLKVINEYGGNIGETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAVRRYLAENPSDFDPRKYLGKTIEAMKQICLDRYLAFGCEGQAGKIKPVSLEKM
FT                   ASRYAKGELNQIVK"
FT   gene            31250..32167
FT                   /locus_tag="NGO_0035"
FT   CDS_pept        31250..32167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0035"
FT                   /product="recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88804"
FT                   /db_xref="GOA:Q5FAI3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAI3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A1KS31.1"
FT                   /protein_id="AAW88804.1"
FT                   /translation="MVLDGFAAYFDAYLENIVREGKSEHTVAAYRRDLEELFALLAQMP
FT                   SEDAGGVPQDLSRRDFTAALRRLSQRGLDGRTLARKLSAWRQYCAWLVKRGLMRADPTA
FT                   DIKPPKQPERVPKALPQEWLNRMLDLPVDGGDPLAVRDHALFELMYGSGLRVSEIHGLN
FT                   ADDVYLDEAWVHVTGKGRKQRQVPLTGKSVEALKNYLPLRQTASDGKALFTGRNGTRLS
FT                   QRQIQKRLESWAAQYGDGRHVSPHMMRHSYAGHLLQASRDIRAVQELLGHSSLSTTQIY
FT                   TKLDFDHIARLYDEAHPRAKRQDE"
FT   gene            32252..34165
FT                   /locus_tag="NGO_0036"
FT   CDS_pept        32252..34165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0036"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88805"
FT                   /db_xref="GOA:Q5FAI2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAI2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690504.1"
FT                   /protein_id="AAW88805.1"
FT                   /translation="MNPSPLLHLIDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGH
FT                   FASNLGAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFP
FT                   KRCESEYDAFGVGHSSTSIGAALGMAAADKLLGGDRRSVAIIGDGAMTAGQAFEALNCA
FT                   GDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAM
FT                   EFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRSRKGP
FT                   QLLHVITKKGNGYKLAENDPVKYHAVANLPKEGGAQMPSEKEPKPAAKPTYTQVFGKWL
FT                   CDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPV
FT                   VAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCVPNMI
FT                   VAAPSDENECRLLLSTCYQADAPAAVRYPRGTGTGAPVSDGMETVEIGKGIIRREGEKT
FT                   AFIAFGSMVATALAVAEKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEENAEQGGA
FT                   GGAVLEVLAKHGICKPVLLLGVADTVTEHGDPKKLLDDLGLSAEAVERRVREWLPDRDA
FT                   AN"
FT   gene            complement(34186..34365)
FT                   /locus_tag="NGO_00175"
FT   CDS_pept        complement(34186..34365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00175"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRJ4"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="AKO63581.1"
FT                   /translation="MPCIGRRHRRRYTDKRNKFPNAQRHTKHRPKAAARTLPAACGVSI
FT                   KKPQKQTPFKNAAR"
FT   gene            complement(34412..35740)
FT                   /locus_tag="NGO_0037"
FT   CDS_pept        complement(34412..35740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0037"
FT                   /product="(dimethylallyl)adenosine tRNA
FT                   methylthiotransferase"
FT                   /note="catalyzes the formation of
FT                   2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at
FT                   position 37 in tRNAs that read codons beginning with
FT                   uridine from N6-(dimethylallyl)adenosine (i(6)A)"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88806"
FT                   /db_xref="GOA:Q5FAI1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAI1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219830.1"
FT                   /protein_id="AAW88806.1"
FT                   /translation="MKKVFIRTFGCQMNEYDSEKMLSVLAEEHGGIEQVTQADEADIIL
FT                   FNTCSVREKAQEKVFSDLGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVVFG
FT                   PQTLHRLPKMIVDKETSGLSQVDISFPEIEKFDHLPPARVEGGAAFVSIMEGCSKYCSF
FT                   CVVPYTRGEEFSRPLNDVLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLL
FT                   RIVHEIPGIERMRFTTSHPREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGY
FT                   TALEYKSIIRKLRAIRPDLCLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSP
FT                   RPGTPAANLPDDTPHEEKVRRLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQ
FT                   LQARTVNNRVVNFTGTPDMINQMIDLEITEAYTFSLRGKIVEA"
FT   gene            36077..36460
FT                   /locus_tag="NGO_0039"
FT   CDS_pept        36077..36460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0039"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88807"
FT                   /db_xref="GOA:Q5FAI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAI0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002233044.1"
FT                   /protein_id="AAW88807.2"
FT                   /translation="MYCLRLRRLVLIFVNPLYQTEEGIAQTVVKGKTTRAEVEARFGKR
FT                   NPFGCYAYHEVSLPIYNFLPTNFIYMKSERRHWEWCADYDGEGVVRDYRFTHKVEKDER
FT                   SVIRDTVGVIRKEAGKSLSQPEK"
FT   gene            36524..37804
FT                   /locus_tag="NGO_0040"
FT   CDS_pept        36524..37804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0040"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /EC_number="5.4.3.8"
FT                   /note="Converts (S)-4-amino-5-oxopentanoate to
FT                   5-aminolevulinate during the porphyrin biosynthesis
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88808"
FT                   /db_xref="GOA:Q5FAH9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAH9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692485.1"
FT                   /protein_id="AAW88808.1"
FT                   /translation="MNRNEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVW
FT                   DENGTRYTDYVGSWGPAIVGHAHPEVVEAVREAALGGLSFGAPTEGEIAIAEQIAEIMP
FT                   SVERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLLVKAGSGLLTFGNP
FT                   SSAGVPADFTKHTLVLEYNNIAQLEEAFAQSGDEIACVIVEPFVGNMNLVRPTEAFVKA
FT                   LRGLTEKHGAVLIYDEVMTGFRVALGGAQSLHGITPDLTTMGKVIGGGMPLAAFGGRKD
FT                   IMECISPLGGVYQAGTLSGNPIAVAAGLKTLEIIQREGFYENLTALTQRLANGIAAAKA
FT                   HGIEFAADSVGGMFGLYFAAHVPRNYADMARSNIDAFKRFFHGMLDRGIAFGPSAYEAG
FT                   FVSAAHTPELIDETVAVAVEVFKAMAA"
FT   gene            complement(38028..38516)
FT                   /locus_tag="NGO_00195"
FT   CDS_pept        complement(38028..38516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00195"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63582"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Y2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012504151.1"
FT                   /protein_id="AKO63582.1"
FT                   /translation="MTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKARISGKR
FT                   YRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNARFRRMG
FT                   ALRGTAEKLGHKVLPPAPCSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSYFDFN"
FT   gene            complement(38525..38893)
FT                   /locus_tag="NGO_00200"
FT   CDS_pept        complement(38525..38893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00200"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00200"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63583"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IVY1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005231956.1"
FT                   /protein_id="AKO63583.1"
FT                   /translation="MVPFEPGRGNAVPVFVNPLYYGQCKNTGQTAATFNLSRNTLYLRI
FT                   RLKKQTGSLKHQVTGLNAAKSDRQKPARYVGRHPDACLHEIAKHFDCTAAAVCHAPKQM
FT                   RMARKKRPPLTKDKTRPK"
FT   gene            complement(38824..39027)
FT                   /pseudo
FT                   /locus_tag="NGO_00205"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(39110..39640)
FT                   /locus_tag="NGO_0042"
FT   CDS_pept        complement(39110..39640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0042"
FT                   /product="oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88809"
FT                   /db_xref="GOA:Q5FAH8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAH8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271806.1"
FT                   /protein_id="AAW88809.2"
FT                   /translation="MEMTGLNPETDRIIEVAMIITDSDLNVLAQSEVYAIHQSDDLLDN
FT                   MDEWNTATHGRTGLTQRVRESSHTEAEVEQKLLDFMSEWIPGRATPMCGNSIHQDRRFM
FT                   VKYMPKLENYFHYRNLDVSTLKELAKRWNPPIAKSVVKRGSHKALDDILESIEEMRHYR
FT                   EHFLISAPKAEAQ"
FT   gene            complement(39691..40578)
FT                   /locus_tag="NGO_0043"
FT   CDS_pept        complement(39691..40578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0043"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88810"
FT                   /db_xref="GOA:Q5FAH7"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAH7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687261.1"
FT                   /protein_id="AAW88810.1"
FT                   /translation="MPYQQITVNVNDAVAERLADALMEHGALSAAIEDACAGTQNEQAI
FT                   FGEPGMPTEQIWQQSKVIALFGEHDEAAAVIDAAAQECGLKDLAYTGETIENQDWVRLT
FT                   QSQFDPIRISDRLWITPSWHEAPEGCAVNLRLDPGLAFGTGSHPTTRLCLKWLDTQLKN
FT                   GESVLDYGCGSGILTIAALKLGAGSAVGVDIDEQAVRSGRDNAEQNNVDAQFFLPDSLP
FT                   QGQFDVVVANILANPLRMLGEMLAARTKQGGRIVLSGLLDEQAEELGGIYSQWFDLDPA
FT                   ETDEGWARLSGVKR"
FT   gene            complement(40682..42043)
FT                   /locus_tag="NGO_0044"
FT   CDS_pept        complement(40682..42043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0044"
FT                   /product="acetyl-CoA carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="an AccC homodimer forms the biotin carboxylase
FT                   subunit of the acetyl CoA carboxylase, an enzyme that
FT                   catalyzes the formation of malonyl-CoA, which in turn
FT                   controls the rate of fatty acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88811"
FT                   /db_xref="GOA:Q5FAH6"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAH6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687264.1"
FT                   /protein_id="AAW88811.1"
FT                   /translation="MLKKVLIANRGEIALRVLRACREMGIATVAVHSETDKGSLHVKLA
FT                   DESVCIGPAASAQSYLNIPAIIAAAEVTCADAVHPGYGFLAENADFAEQVEQSGFTFIG
FT                   PKPDTIRLMGDKVSAKHAMIAAGVPCVPGSDGALPDDDAEILKIADKVGYPVIIKASGG
FT                   GGGRGMRVVEKKEDLLQSVEMTKAEAGAAFGNPMVYMERYLQRPRHVEIQVLADEHGNA
FT                   VYLAERDCSLQRRHQKVIEEAPAPFIDEKARKKIGKACTDACKRIGYRGAGTFEFLYED
FT                   GEFFFIEMNTRVQVEHPVTELITGVDIVQEQLRIASGLPLQYKQKDIKIEGHAFECRIN
FT                   AEDPYNFIPSPGPIESCHLPGGFGIRVDSHIYQGYRIPPYYDSLIGKICVHGKTREQAM
FT                   AKMRVALAELAVTGIKTNTPLHRDLFADAGFQEGGVSIHYLEHWLEARKTKQDK"
FT   gene            complement(42157..42618)
FT                   /locus_tag="NGO_0045"
FT   CDS_pept        complement(42157..42618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0045"
FT                   /product="acetyl-CoA carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="composes the biotin carboxyl carrier protein subunit
FT                   of the acetyl-CoA carboxylase complex, the enzyme that
FT                   catalyzes the carboxylation of acetyl-CoA to malonyl-CoA,
FT                   which in turn controls the rate of fatty acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88812"
FT                   /db_xref="GOA:Q5FAH5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAH5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014580068.1"
FT                   /protein_id="AAW88812.1"
FT                   /translation="MDLRKLKKLIDLVEESGIAEIEVTEGEEKVRITRTIAAAAAPVYA
FT                   APVPAAAPAVTPAAAPVAASAPAAAPAARDLSDAQKSPMVGTFYRAPGPNAAAFVEVGQ
FT                   QVKAGDTLCIIEAMKLMNEIEAEKSGTVKEILVENGTPVEFGEPLFIIG"
FT   gene            complement(42600..42857)
FT                   /locus_tag="NGO_0046"
FT   CDS_pept        complement(42600..42857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0046"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAH4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014575556.1"
FT                   /protein_id="AAW88813.1"
FT                   /translation="MRKIKLPAHFPQKPPFFDILLDIYRQLRENEHNFTVVSHHRKTVS
FT                   EHHSARFAPLPQAGCFLKNQRNNPPEHRQPLKEQKWICAN"
FT   gene            42974..44014
FT                   /locus_tag="NGO_0047"
FT   CDS_pept        42974..44014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0047"
FT                   /product="S-adenosylmethionine tRNA ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88814"
FT                   /db_xref="GOA:Q5FAH3"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAH3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014582255.1"
FT                   /protein_id="AAW88814.1"
FT                   /translation="MDISDFDFTLPEHLIAQHPPEVRGSSRLLVALSDMPLQDRVFGDL
FT                   PDYVEAGDVLVFNNTKVMKARLFGQKDSGGRIEALIERVLDNHTALAHIRSSKSPKPGM
FT                   GLVFEGGIRAVMVGREGELFCLRFEGGQTVYELLEQNGHLPLPPYIERAADADDDSRYQ
FT                   TVYAKYQGAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVDKIEEHKM
FT                   HSEWFEVPSETVAAVEAAKARGNKAWAVGTTSMRALESAARATGYLKDGQGDTDIFITP
FT                   GYRFNVVDRLVTNFHLPKSTLLMLVGAFSGMGHIRAVYRHAIEREYRFFSYGDAMVLGR
FT                   NEGGGL"
FT   gene            complement(44215..47430)
FT                   /gene="carB"
FT                   /locus_tag="NGO_0048"
FT   CDS_pept        complement(44215..47430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="NGO_0048"
FT                   /product="carbamoyl phosphate synthase large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="four CarB-CarA dimers form the carbamoyl phosphate
FT                   synthetase holoenzyme that catalyzes the production of
FT                   carbamoyl phosphate; CarB is responsible for the
FT                   amidotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88815"
FT                   /db_xref="GOA:Q5FAH2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAH2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003699430.1"
FT                   /protein_id="AAW88815.1"
FT                   /translation="MPKRTDLKSILIIGAGPIVIGQACEFDYSGAQACKALREEGYKVI
FT                   LVNSNPATIMTDPEMADVTYIEPIMWQTVEKIIAKERPDAILPTMGGQTALNCALDLAR
FT                   NGVLAKYNVELIGATEDAIDKAEDRGRFKEAMEKIGLSCPKSFVCHTMNEALAAQEQVG
FT                   FPTLIRPSFTMGGSGGGIAYNKDEFLAICERGFDASPTHELLIEQSVLGWKEYEMEVVR
FT                   DKADNCIIICSIENFDPMGVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIGVDTGG
FT                   SNVQFAVNPENGEMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGFTLDELRNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFAFEKFPAADDRLTTQMKSVGEVMAMGRTIQESFQKAL
FT                   RGLETGLCGFNPRSEDKAEIRRELANPGPERMLFVADAFRAGFTPEEIHEICAIDPWFL
FT                   AQIEDLMKEEKSVSDGQLQDLDYAALRRLKRKGFSDKRLAQLLNVSEKEVREHRYALKL
FT                   HPVYKRVDTCAAEFATETAYLYSTYEEECESRPSDRKKVMILGGGPNRIGQGIEFDYCC
FT                   VHAALALRESGFETIMVNCNPETVSTDFDTSDRLYFEPLTLEDVLEIVRTENPWGVIVH
FT                   YGGQTPLKLANALVENGVNIIGTSADSIDAAEDRERFQKVLNDLGLRQPPNRIAHNEEE
FT                   ALVKAEEIGYPLVVRPSYVLGGRAMQIIHSAEQLQKYMREAVQVSEDSPVLLDFFLNNA
FT                   IEVDVDCVSDGKDVVIGGIMQHVEQAGIHSGDSGCSLPPYSLSEEIQDEIRRQTKAMAY
FT                   ALGVVGLMNVQFAVQDGVVFVLEVNPRASRTVPFVSKATGVPLAKVGARCMAGISLKEQ
FT                   GVEKEVVPDFYAVKEAVFPFIKFPGVDTILGPEMRSTGEVMGVGASFGEAYYKAQLGAG
FT                   ERLNPTGKIFLSVREEDKERVIKTAKNFQALGYGICATRGTAQYLTEHGLIVQAINKVP
FT                   EGRPHIGDALKNGEIALVVNTVSSDPQSVSDSHIIRQSALQQRVPQYTTTAGGEAMSEG
FT                   AKSRDYLGVYSVQELHGRLKNRN"
FT   gene            complement(47441..47974)
FT                   /locus_tag="NGO_0049"
FT   CDS_pept        complement(47441..47974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAH1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692498.1"
FT                   /protein_id="AAW88816.1"
FT                   /translation="MFSDIYLNPKNYFGIEKRLPFKAFWDNGGQCYLDLKVVDGKIIAL
FT                   CGQLINYTNTSIVNAAEEVYRSIIDYLISNEILIVRTKFSFKNIFSTNEKKYKEIEKEI
FT                   NKFLYKNMDWYLFFNNDITLDPYTGNDLIWHVQIDPNDGGAQFLETYQSWEKLQQKYPN
FT                   ITFSYDKNDLILTK"
FT   gene            complement(48412..48732)
FT                   /pseudo
FT                   /locus_tag="NGO_00250"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(49539..49928)
FT                   /locus_tag="NGO_0050"
FT   CDS_pept        complement(49539..49928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0050"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88817"
FT                   /db_xref="GOA:Q5FAH0"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="PDB:3HRL"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAH0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003686761.1"
FT                   /protein_id="AAW88817.1"
FT                   /translation="MNPPEKLLTAENPALRQRAKAMRQEMSEAEAKLWQHLRAGRLNGY
FT                   KFRRQQPMGNYIVDFMCVTPKLIVEADGGQHAEQAVYDHARTVYLNSLGFTVLRFWNHE
FT                   ILQQTNDVLAEILRVLQELEKQPAR"
FT   gene            complement(50091..50470)
FT                   /pseudo
FT                   /locus_tag="NGO_00260"
FT                   /note="glyoxalase; disrupted"
FT   gene            complement(50524..51657)
FT                   /locus_tag="NGO_0053"
FT   CDS_pept        complement(50524..51657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0053"
FT                   /product="carbamoyl-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88818"
FT                   /db_xref="GOA:Q5FAG9"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAG9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003699436.1"
FT                   /protein_id="AAW88818.1"
FT                   /translation="MNTPALLVLADGSVFHGTSIGYEGSASGEVVFNTSMTGYQEILTD
FT                   PSYCKQIVTLTYPHIGNTGTNAEDEESRSVYAAGLIIRDLPLLHSSFRASESLHDYLVR
FT                   NETVAIADIDTRRLTMLLREKGAQGGAILTGADATVEKAQELIAAFGSMVGKDLAKEVS
FT                   CTETYEWTEGEWELGKGFVTPDKQPYHVVAYDFGVKTNILRMLASRGCRLTVVPAQTSA
FT                   EDVLALNPDGVFLSNGPGDPEPCTYAIEAVQKLMESGKPIFGICLGHQLISLAIGAKTL
FT                   KMRFSHHGANHPVQDLDSGKVVITSQNHGFAVDADTLPANARITHKSLFDNTLQGIELT
FT                   DKPVFCFQGHPEASPGPQDVGYLFDKFIGNMKAAKQA"
FT   gene            52440..52553
FT                   /locus_tag="NGO_00270"
FT   CDS_pept        52440..52553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00270"
FT                   /product="polyprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00270"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5Z1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704566.1"
FT                   /protein_id="AKO63584.1"
FT                   /translation="MPPPPEKRKKMPSEDLSDGICGKTGRAGGSEEDFAPA"
FT   gene            complement(52527..55541)
FT                   /locus_tag="NGO_0055"
FT   CDS_pept        complement(52527..55541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0055"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88820"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAG7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010950983.1"
FT                   /protein_id="AAW88820.2"
FT                   /translation="MDERNQPEVKWEGSYSTLREKDGERKFIYTNQRNKLNQQNNFISF
FT                   DNTDTLVSRQSGTAVFGTATYLPPYGKVSGFDTAELNKRGNAVNWIHTTRAGLAGYVYT
FT                   GVICRDTGQCPQLVYKTRFSFDNTGLAKNTGRLDRHTEPSRENSPIYKLSDYPWLGVSF
FT                   NLGSEGTAKDGRSSNKLVSSFDENNSNSNQNLVYTTEGHRISLGDWQRESTAMAYYLNA
FT                   KLHLLDKQRIENIAPGKTVDLGTLRPRVETKTNNWGNLLSFWATWKIEDKGNITVRLGL
FT                   PEVKAGRCTNTAHPNPNAKAPSPALTAPALWFGPVQNGKVQMYSASVSTYPGSSSSRIF
FT                   LQELKTRTDPARPGRHSLAALDTQNIKSREPNFNSRQTVIRLPGGVYKINSGKNGGRVA
FT                   GINGNDGKNDTFGIYKDRLVTPEADEWSNILLPWTARYYGNDDIFKTFNQPNSKTQNGK
FT                   KQYSQKYRIRTKEDDNDKPRDLGDIVNSPIVAVGGYLATSANDGMVHLFKRNGTDQRGY
FT                   ELKLSYIPGTMERKDIEGNDSDLAKELRAFAEKGYVGDRYGVDGGFVLRRITDDQDKQK
FT                   HFFMFGAMGLGGRGAYALDLSKIDGNYPAAAPLFDVKNGDNNGKNRVKVELGYTVGTPQ
FT                   IGKTQNGKYAAFLASGYAAKNIGSGDNKTALYVYDLENGSGSLIKKIEVQGGKGGLSSP
FT                   TLVDKDLDGTVDIAYAGDRGGNMYRFDLSDSNPDKWSVRTIFEGDKPITSAPAVSRLAD
FT                   KRVVIFGTGSDLTEDDVLNTGEQYIYGIFDDDKGTVKVTVQNGTGGGLLEQVLKEENKT
FT                   LFLNKGSDGSGSKGWVVKLKEGQRVTVKPTVVLRTAFVTIRSYTGNDKCGAQTAILGIN
FT                   TADGGALTPRSARPIVPDNQVAQYSGHQKMNGKSIPIGCMWKNGKTVCPNGYVYDKPVN
FT                   VRYLDEKKTDDFPVTADGDAGGSGTFKEGKKPARNNRCFSGKGVRTLLMNDLDSLDITG
FT                   PMCGIKRLSWREVFF"
FT   gene            55826..56158
FT                   /locus_tag="NGO_00280"
FT   CDS_pept        55826..56158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00280"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IUX8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009348059.1"
FT                   /protein_id="AKO63585.1"
FT                   /translation="MLRGIPSAAGAPQTAGFGKPPDPAPAGLPVAKPPSPGCQRGMFAK
FT                   VTRPSDGVQCIGLPHHSPCALIHGTAVFGNPQPFARPAIAACAAMAGRGGGIFQVAATF
FT                   PNNLTA"
FT   gene            complement(57122..58201)
FT                   /locus_tag="NGO_0056"
FT   CDS_pept        complement(57122..58201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0056"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88821"
FT                   /db_xref="GOA:Q5FAG6"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAG6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017146699.1"
FT                   /protein_id="AAW88821.1"
FT                   /translation="MNIQNIRTLLDTVAVPNTARTLGGEKAVRSVGQRSDGIHIALHFG
FT                   FPVAHIAAALADAVQETLMPETGGAHIHLGIDTEIGTHKVRPGVTTIKGVKNIIAVASG
FT                   KGGVGKSTTTANLAAAMARMGARVGVLDADLYGPSQPTMLGVHDRKPDQKNQKLIPVES
FT                   SDGIQVMSIGFLVDTGQAVVWRGPMVSQALQQLMFQSEWDEVDYLFIDLPPGTGDIQLT
FT                   LSQRIPVTGSVIVTTPQDIALIDARKAVDMFRKVNIPILGVLENMSVHICSNCGHSEAL
FT                   FGTDGGKDLAARLNVPLLGQLPLSLPVREAMDGGTPARLFDEHPAIARIYTDAAFQIAL
FT                   GIADKGKDFSSRFPKIVVE"
FT   gene            58420..58495
FT                   /locus_tag="NGO_18791"
FT   tRNA            58420..58495
FT                   /locus_tag="NGO_18791"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:58453..58455,aa:Lys,seq:ttt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            58575..59084
FT                   /locus_tag="NGO_0057"
FT   CDS_pept        58575..59084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0057"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88822"
FT                   /db_xref="GOA:Q5FAG5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAG5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003696651.1"
FT                   /protein_id="AAW88822.1"
FT                   /translation="MKKKLLSGIKFAVRTALVFLLVSLFLDWVRKPDEPAGAAGRPLTL
FT                   LSGQRLTLGQFSRDRTVLVYFWGSWCGVCRYQSPIIDDLAADGVPVVGVAVRSGSASEV
FT                   AAYMAKRGLGFPTVSDEDGGLARSWRIAATPAVVLVKNGKMVRYTTGISSYWGLRARIF
FT                   QADFFG"
FT   gene            59299..59421
FT                   /locus_tag="NGO_00300"
FT   CDS_pept        59299..59421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00300"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63586"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRJ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003752052.1"
FT                   /protein_id="AKO63586.1"
FT                   /translation="MRFIAYCCYMFVLLYNGCIKNYAHRLSRRFESLIFDNLET"
FT   gene            59425..59865
FT                   /locus_tag="NGO_0058"
FT   CDS_pept        59425..59865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0058"
FT                   /product="homoprotocatechuate degradative operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88823"
FT                   /db_xref="GOA:Q5FAG4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAG4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002257676.1"
FT                   /protein_id="AAW88823.2"
FT                   /translation="MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLL
FT                   AENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVYLKLTSEGEKLY
FT                   EEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDALNS"
FT   gene            59981..60481
FT                   /locus_tag="NGO_0059"
FT   CDS_pept        59981..60481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0059"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88824"
FT                   /db_xref="GOA:Q5FAG3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR011982"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAG3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702225.1"
FT                   /protein_id="AAW88824.1"
FT                   /translation="MADLQKTFQTSFRDAMASCAAGVHVITTDGAAGRYGITMTAVAPV
FT                   TDEPPTVMLCINRSARIIPILSENGSLCINMLADEHQDVAEHFAGLTGLSPEERFAYHI
FT                   WHRGKTGQLEIEGALAHLHGHIVGKHEIGTHFVFYVRLDEIKNCGCKRPALLYFRRQFR
FT                   PLD"
FT   gene            60497..61192
FT                   /locus_tag="NGO_0060"
FT   CDS_pept        60497..61192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0060"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88825"
FT                   /db_xref="GOA:Q5FAG2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAG2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217946.1"
FT                   /protein_id="AAW88825.1"
FT                   /translation="MKAMILAAGRGERMRPLTDTTPKPLLDVAGKPLIGWHLCRLKQAG
FT                   FTEIVINHAWLGRQIENALGDGSAYGVNIAYSPEPAGGLETAGGIAQALPLLGGQPFLV
FT                   ANGDVLTDIDFTAAFQTASSLPGHISAHLWLVGNPPHNPDGDFSLLPDGSVRPEVSGGN
FT                   GLTFSGVGIYRPEMFDGIEAGSVAKLAPVLLNEMRQNRVSGQKHTGLWLDVGTVCRLKE
FT                   AQALAAAWK"
FT   gene            complement(61226..61656)
FT                   /pseudo
FT                   /locus_tag="NGO_00320"
FT                   /note="membrane protein; disrupted"
FT   gene            61831..63507
FT                   /locus_tag="NGO_0062"
FT   CDS_pept        61831..63507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0062"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88826"
FT                   /db_xref="GOA:Q5FAG1"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAG1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019742723.1"
FT                   /protein_id="AAW88826.1"
FT                   /translation="MSFKTDAETAQSSTMRPIGEIAAKLGLNVDNIEPYGHYKAKINPA
FT                   EAFKLPQKQGRLILVTAINPTPAGEGKTTVTIGLADALRHIGKDSVIALREPSLGPVFG
FT                   VKGGAAGGGYAQVLPMEDINLHFTGDFHAIGAANNLLAAMLDNHIYQGNELNIDPKRVL
FT                   WRRVVDMNDRQLRNIIDGMGKPVDGVMRPDGFDITVASEVMAVFCLAKDISDLKERFGN
FT                   ILVAYAKDGSPVYAKDLKAHGAMAALLKDAIKPNLVQTIEGTPAFVHGGPFANIAHGCN
FT                   SVTATRLAKHLADYAVTEAGFGADLGAEKFCDIKCRLAGLKPDAAVVVATVRALKYNGG
FT                   VERANLGEENLEALAKGLPNLLKHISNLKNVFGLPVVVALNRFVSDSDAELAMIEKACA
FT                   EHGVEVSLTEVWGKGGAGGADLARKVVNAIDNQPNNFGFAYDVELGIKDKIRAIAQKVY
FT                   GAEDVDFSAEASAEIASLEKLGLDKMPICMAKTQYSLSDNAKLLGCPEGFRIAVRGITV
FT                   SAGAGFIVALCGNMMKMPGLPKVPAAEKIDVDEHGVIHGLF"
FT   gene            63621..64712
FT                   /gene="ychF"
FT                   /locus_tag="NGO_0063"
FT   CDS_pept        63621..64712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="NGO_0063"
FT                   /product="GTP-binding protein"
FT                   /note="EngD; translation-associated GTPase; the crystal
FT                   structure of the Haemophilus influenzae YchF protein showed
FT                   similarity to the yeast structure (PDB: 1NI3); fluorescence
FT                   spectroscopy revealed nucleic acid binding; the yeast
FT                   protein YBR025c interacts with the translation elongation
FT                   factor eEF1"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88827"
FT                   /db_xref="GOA:Q5FAG0"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAG0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003823115.1"
FT                   /protein_id="AAW88827.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTQSGIEAANYPFCTIEPNVGIVE
FT                   VPDPRMAELAKIVNPQKMQPAIVEFVDIAGLVAGASKGEGLGNRFLANIRETDAIVNVV
FT                   RCFDDDNIVHVSGKVDPIADIETIGTELALADLASVEKAIVREEKRARSGDKDAQKLVD
FT                   LCKKLLPHLDEGKPVRSFGLDAEERALLKPLFLLTAKPAMYVGNVAEDGFENNPHLDRL
FT                   KELAAKENAPVVAVCAAMESEIAELEDGEKAEFLAEMGLEEPGLNRLIRAGYDLLGLQT
FT                   YFTAGVKEVRAWTIHKGDTAPQAAGVIHTDFERGFIRAQVIAYDDFVSLGGEAKAKEAG
FT                   KMRVEGKEYVVQDGDVMHFLFNV"
FT   gene            64750..64989
FT                   /locus_tag="NGO_0064"
FT   CDS_pept        64750..64989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88828"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAF9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010950985.1"
FT                   /protein_id="AAW88828.1"
FT                   /translation="MPSEAGFGGFRRSHTAGMQPHQNKIPPAFPICPPRFLQNKLPALP
FT                   LREAVRYSEYPEPRYKMTFQTAFAQPAAFQVKTL"
FT   gene            64986..66860
FT                   /locus_tag="NGO_0065"
FT   CDS_pept        64986..66860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0065"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88829"
FT                   /db_xref="GOA:Q5FAF8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAF8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002246416.1"
FT                   /protein_id="AAW88829.1"
FT                   /translation="MSQALPYRPDIDTLRAAAVLSVIVFHIEKDWLPGGFLGVDIFFVI
FT                   SGFLMTAILLREMSGGRFFLKTFYIRRIKRILPAFFAVLAATLAGGFFLFTKDDFFLLW
FT                   KSALTALGFASNLYFARGKDYFDPAQEEKPLLHIWSLSVEEQFYFVFPILLLLVARKSL
FT                   RVQFGFLAALCALSLAASFMPSALDKYYLPHLRACEMLVGSLTAVRMRYRQQRNPAVGK
FT                   RYAAVGALFSACILSACLFAYSEQTAYFPGPAALIPCLAVAALIYFNHYEHPLKKFFQW
FT                   KITVAAGLISYSLYLWHWPILAFMRYIGPDNLPPYSPAAAIVLTLAFSLISYHCIEKPF
FT                   KKWKGSFAQSVLWIYALPMLVLGAGSFFAMRLPFMAQYDRLGLTRSNTSCHNNTGKQCL
FT                   WGDTEKQPELLVLGDSHADHYKTFFDAVGKKEKWSATMVSADACAYVEGYASRVFQNWA
FT                   ACRAVYRYAEEHLPRYPKVVLAMRWGSQMPENSRSLAYDAGFFQKFDRMLHKLSSEKQA
FT                   VYLMADNLASSYNVQRAYILSSRIPGCRQTLRPDDESTLKANARIRELAAKYPNVYIID
FT                   AAAYIPADFQIGGLPVYSDKDHINPYGGTELAKRFSEKQRFLDTRHNH"
FT   gene            66922..68217
FT                   /locus_tag="NGO_0066"
FT   CDS_pept        66922..68217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0066"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88830"
FT                   /db_xref="GOA:Q5FAF7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAF7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003710849.1"
FT                   /protein_id="AAW88830.1"
FT                   /translation="MSVIQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSLH
FT                   IGHLLPVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAGWVGSIRSQ
FT                   LTPFLSFEGGNAAIMANNADWFGSMNCLDFLRDIGKHFSVNAMLNKESVKQRIDRDGAG
FT                   ISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGIDLTRRLNQKQVFGLTLP
FT                   LVTKSDGTKFGKTEGGAVWLNAKKTSPYQFYQFWLKVADADVYKFLKYFTFLSIEEIGV
FT                   VEAKDKASGSKPEAQRILAEEMTRLIHGEEALAAAQRISESLFAEDQSRLTESDFEQLA
FT                   LDGLPAFEVSDGINAVEALVKTGLAASNKEARGFVNAKAVLLNGKPAEANNPNHAAERP
FT                   DDAYLLIGEYKRFGKYTILRRGKRNHALLVWK"
FT   gene            complement(69021..69710)
FT                   /locus_tag="NGO_00350"
FT   CDS_pept        complement(69021..69710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00350"
FT                   /product="Opacity protein opA54"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00350"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63587"
FT                   /db_xref="GOA:A0A0H4J5B4"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5B4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002250000.1"
FT                   /protein_id="AKO63587.1"
FT                   /translation="MQADLAYAAERITHDYPEPTGAKKGKISTVSDYFRNIRTHSIHPR
FT                   VSVGYDFGGWRIAADYARYRKWNNSKYSVNTKKVNENKGEKINVTQYLKAENQENGTFH
FT                   AVSSLGLSAVYDFKLNDKFKPYIGMRVGYGHVRHQVRSVEQETTTVTTYLQSGKPSPIV
FT                   RGSTLKLPHHESRSSRRLGFGAMAGVGIDVAPGLTLDAGYRYHYWGRLENTRFKTHEAS
FT                   LGVRYRF"
FT   gene            complement(69855..70039)
FT                   /pseudo
FT                   /locus_tag="NGO_00355"
FT                   /note="sugar ABC transporter ATP-binding protein;
FT                   disrupted"
FT   gene            70253..71173
FT                   /locus_tag="NGO_0068"
FT   CDS_pept        70253..71173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0068"
FT                   /product="riboflavin kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88831"
FT                   /db_xref="GOA:Q5FAF6"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAF6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359737.1"
FT                   /protein_id="AAW88831.2"
FT                   /translation="MKIRPGRHNAPDFPHGAAVTIGNFDGVHLGHKHILQKLRLEADAR
FT                   GLPVVAVVFEPQPKEFFALRTGKTPPCRISPLRTKLELLEGTGCVDAAWVLRFDRNFSE
FT                   ISAQAFIDRLLRQTLNTRYLLVGDDFRFGAGREGCFELLAQQPDMQTERTPSVIVEDIR
FT                   TSSTAVRQALSDGNLAYAKKLLGHDYVLGGRVVHGRKLGRTLNAPTANIRLPGHRYALG
FT                   GVFVVEADGAFGTRRGVASFGFNPTVDGGCSQKLEVHLFDFQGDLYGQRLNVRFLHKLR
FT                   DEEKFDGMEELKRRIEADMEAAKCW"
FT   gene            71315..74104
FT                   /locus_tag="NGO_0069"
FT   CDS_pept        71315..74104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0069"
FT                   /product="isoleucine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88832"
FT                   /db_xref="GOA:Q5FAF5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAF5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013449470.1"
FT                   /protein_id="AAW88832.1"
FT                   /translation="MTDYSKTVNLLESPFPMRGNLAKREPAWLKSWYEQKRYQKLREIA
FT                   KGRPKFILHDGPPYANGDIHIGHAVNKILKDIIIRSKTQAGFDAPYVPGWDCHGLPIEV
FT                   MVEKLHGKDMPKARFRELCREYAAEQIARQKKDFIRLGVLGDWDNPYLTMDFKTEADTV
FT                   RMLGEIYKSGYLYRGAKPVQFCLDCGSSLAEAEVEYKDKVSPAIDVAYPFKNTVALAAA
FT                   FGLAGIEGKAFAVIWTTTPWTLPASQAVSAGADVVYQLIDTPKGKLVLAKDLAEGALKR
FT                   YGFSDGIAILAETTGDKLENLHMNHPFLERDIPMLNGEHVTTDAGTGLVHTAPAHGLED
FT                   YAVCNKYGIELYNPVNAEGKYISETPRVAGMSVWEANPVILQWPEETGNLLASSKIEHS
FT                   YAHCWRHKTPLIYRATGQWFVGMDKAGSDGKTLRDKAIKAVDDTEFFPPWGRARLESMI
FT                   EGRPDWVVSRQRYWGTPMTFFVHKETGELHPNSAELLEKVAQRIEEKGIEAWFSLDKSE
FT                   LLSAEDCEHYDKLPDTMDVWFDSGSTHYSVVKQREELEWPADLYLEGSDQHRGWFQSSM
FT                   LTGCASSMGRAPYKQLLTHGFVVDQNGRKMSKSIGNVVAPQEVYNEFGADILRLWAAST
FT                   DYSGELAISKEILKRVTESYRRIRNTLSFLFANLSDFNPIEDAVQQADMVEIDRYALVL
FT                   ARRLQERLAGGYYPRYAFHFAVKDIVSFCSEDLGAFYLDILKDRLYTTKADSRARRSAQ
FT                   TALYHITRSLVLLIAPILCFTGEEAWDIIGGGEEDSVLFHTWHEFPAINEKAEAELVKK
FT                   WTAIREAREAVTAAIEPLRADKTVGSSLQAEAEITAPEEMAGYLNALGEELRFALLVSK
FT                   AEVKVGDELAVAAKASDGEKCERCWHYTRDVGAVAGYETVCKRCAENVGGEGETRHYA"
FT   gene            complement(74783..75466)
FT                   /locus_tag="NGO_0070"
FT   CDS_pept        complement(74783..75466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0070"
FT                   /product="Opacity protein opA54"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88833"
FT                   /db_xref="GOA:Q5FAF4"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAF4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147239.1"
FT                   /protein_id="AAW88833.2"
FT                   /translation="MQADLAYAAERITHDYPEPTAPGKNKISTVSDYFRNIRTHSIHPR
FT                   VSVGYDFGGWRIAADYARYRKWNDNKYSVDIKELENKNQNKRDLKTENQENGSFHAVSS
FT                   LGLSAVYDFKLNDKFKPYIGARVAYGHVRHSIDSTKKITGTLTAYPSDADAAVTVYPDG
FT                   HPQKNTYQKSNSSRRLGFGAMAGVGIDVAPGLTLDAGYRYHNWGRLENTRFKTHEASLG
FT                   MRYRF"
FT   gene            76565..77059
FT                   /locus_tag="NGO_0071"
FT   CDS_pept        76565..77059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0071"
FT                   /product="peptidase A8"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88834"
FT                   /db_xref="GOA:Q5FAF3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAF3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5FAF3.1"
FT                   /protein_id="AAW88834.1"
FT                   /translation="MSSSVSSKTRYWVLALAAIVLDQWSKWAVLSSFQYRERVNVIPSF
FT                   FDLTLVYNPGAAFSFLADQGGWQKYFFLVLAVAVSAYLVRAILRDEFAALGKIGAAMII
FT                   GGASGNVIDRLIHGHVVDFLLFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK
FT                   T"
FT   gene            77089..78057
FT                   /gene="ispH"
FT                   /gene_synonym="lytB"
FT                   /locus_tag="NGO_0072"
FT   CDS_pept        77089..78057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /gene_synonym="lytB"
FT                   /locus_tag="NGO_0072"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="catalyzes the conversion of
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into
FT                   isopentenyl diphosphate (IPP) and dimethylallyl diphosphate
FT                   (DMAPP); functions in the nonmevalonate isoprenoid
FT                   biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88835"
FT                   /db_xref="GOA:Q5FAF2"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAF2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015815274.1"
FT                   /protein_id="AAW88835.1"
FT                   /translation="MNGKTIILANPRGFCAGVDRAISIVERALEEFGAPVYVRHEVVHN
FT                   KFVVDNLREKGAVFIEDLAEVPPGATLVYSAHGVSKAVQQEAAERGFRVFDATCPLVTK
FT                   VHKEVARLDAQDCEIIMIGHKGHAEVEGTMGQLAPGKMLLVETVGDVAKLEVRNPDKLA
FT                   YVSQTTLSVDETKDIIAALNARFPNIRNPHKEDICYATTNRQTAVKELAEQCDIVIVVG
FT                   SPNSSNSNRLREVAASRGIDAYMVDNASYLQRTWFEGKSKVGVTAGASAPEVLVREVLA
FT                   TIRGWGHETVREGGGAEESIVFVLPKELRREGETKPDLCKR"
FT   gene            78158..78607
FT                   /locus_tag="NGO_00385"
FT   CDS_pept        78158..78607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00385"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00385"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63588"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IVY6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147004.1"
FT                   /protein_id="AKO63588.1"
FT                   /translation="MSTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTRY
FT                   LRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDEPGIPGCSTL
FT                   CRYRKFRYARAAYFGLLKVGAQSHLKAMCLNLLKAANRLSAPAAA"
FT   gene            complement(78813..79472)
FT                   /locus_tag="NGO_0073"
FT   CDS_pept        complement(78813..79472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0073"
FT                   /product="phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88836"
FT                   /db_xref="GOA:Q5FAF1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAF1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015815275.1"
FT                   /protein_id="AAW88836.1"
FT                   /translation="MTPPKLIIFDWDGTLADTTQPIIDTMRRSFAECGFPPPEAERVRS
FT                   LIGYSLPEIIRALLEMPSEAAVADIARTYSAHYLNPNNRNMTLFPDAPPCLDKLKAQGF
FT                   RLAVATGKGRAGLDNAISQTATGGYWLATACAGEYPSKPSPEMVFGLCGELGLDPKEAL
FT                   VVGDTAHDLHMAANAGAAAVGVATGAHSREQLLGAPHLAVLDGLSELPGFLARHYA"
FT   gene            79620..79847
FT                   /locus_tag="NGO_00395"
FT   CDS_pept        79620..79847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00395"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00395"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISI6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687324.1"
FT                   /protein_id="AKO63589.1"
FT                   /translation="MGQFMSVFRINMTAATVLAALSSPVFAAQTADLETVHIKGQRSYN
FT                   AIATEKNGDYSSLKAAIWMTASIPASPPAA"
FT   gene            79899..80336
FT                   /locus_tag="NGO_00400"
FT   CDS_pept        79899..80336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00400"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63590"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IUY3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003749763.1"
FT                   /protein_id="AKO63590.1"
FT                   /translation="MGKRVMEGVETEISGAITPKWQIHAGYSYLHSQIKTAANPRDDGI
FT                   FLLVPKHSANLWTTYQVTPGLTVGGGVNAMSGITSSAGMHAGGYATFDAMAAYRFTPKL
FT                   KLQINADNIFNRHYYARVGGTNTFNIPGSERSLTANLRYSF"
FT   gene            80406..80726
FT                   /locus_tag="NGO_0076"
FT   CDS_pept        80406..80726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88837"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAF0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002225663.1"
FT                   /protein_id="AAW88837.1"
FT                   /translation="MRSQPEYGIAKENRPNRQADRFAGSVLPLAASLTHKPNIMKPIPT
FT                   DTFQPAILPQAFETEIKSTCTGRIYRIQTATLGEMQSEGYPVLFVLDGEAFFPRCTTSC
FT                   SR"
FT   gene            80714..81337
FT                   /locus_tag="NGO_0077"
FT   CDS_pept        80714..81337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0077"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88838"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010950989.1"
FT                   /protein_id="AAW88838.1"
FT                   /translation="MQSLMNNPVTRSNAPCLIVGIGYTTGSVRDLAQRAADYTPPLGDN
FT                   ATADERRQFGQADRFADFIDSELTAFLESRYTLNRNETAVFGHSFGALFGLYSLLSHRC
FT                   FRRHWLVSPSIWWHNRRILDFMPSENRLDGIDACLNIGALERSSGCKRREERDMAGQAE
FT                   QMAAELDRRGTAVFFREYPNADHGNVPFYSLTDCVEYLREAWQR"
FT   gene            complement(81989..85423)
FT                   /locus_tag="NGO_0078"
FT   CDS_pept        complement(81989..85423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0078"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88839"
FT                   /db_xref="GOA:Q5FAE8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017628914.1"
FT                   /protein_id="AAW88839.1"
FT                   /translation="MTEPTYIPLRLHTEFSITDGMVRIKKLIAKAQEYGLPALGISDLM
FT                   NEFGLVKFYKACRGAGIKPVGAADVWIGNPNAPDKPFRAMLVIRNDAGYLRLSELLTEA
FT                   YVGQDRNIHHAELNPEWLENGDNSGLICLSGAHYGEVGVNLLNGNEDAARAAALKYAAW
FT                   FPDTFYLELQRLPERPEWEACVSGSVKLAEELGLPVVATHPTQFMNRDDFNAHEARVCI
FT                   AGGWVLTDKKRPRDFTPSQFFIPPETMLERFADLPEALENTVEIAKRCNLHITLGKNFL
FT                   PLFPTPDGLSLDDCLIKLSNEGLQERMVQLYPDEAERAAKMPEYQERLDFELNIIIQMK
FT                   FPGYFLIVQDFINWAKTHGCPVGPGRGSGAGSLVAYSLKITDLDPLKYALLFERFLNPE
FT                   RVSMPDFDVDFCQANRGRVIEYVREKYGAQAVSQIVTFGTMSSKAVIRDVGRVLELPFM
FT                   LCDKLSKLIPLEANKPLSLDDAMKAQPQIQELLEAEEADELITLAKKLEDLTRGLGMHA
FT                   GGVLIAPGKISDYSPVYQADESASPVSMYDKGDVEDVGLVKFDFLGLRNLTIIEMAQNN
FT                   IKNTAGDIVDVGKIPLDDQTAYQIFRDANTTAVFQFESTGMKKMLKTAHTTKFEELIAF
FT                   VSLYRPGPMDNIPDFVARMKGQEFQYIHPLLEGILAPTYGIMVYQEQVMQAAQIIGGYS
FT                   LGGADLLRRAMGKKKPEEMVKHREIFAEGAAKQGISREKSDEIFNYMEKFAGYGFNKSH
FT                   AAAYALISYQTAWLKAHYPAEFMAATMSSELDNTDQLKHFYDDCRANGIEFLPPDINES
FT                   DYRFTPYPDMKIRYALGAIKGTGEAAVESIIAARQSGGKFTGLLDFCERVGKEHMNRRT
FT                   LEALIRGGAFDSIEPNRAMLLANIDLAMDNADQKAANANQGGLFDMMEDAIEPVRLIDA
FT                   PMWSESEKLAEEKTVIGFYLSGHPFGPYAQEVRQIAPTKLGRLKPQDSVRLAGFVTAVR
FT                   TMMGKRGKIAFVSLEDSSGQAEIMVGGQTLENCADCLKADQVLIIESKVSRDDYGGGDG
FT                   LRIMANQVMTLQTARERYARSLSLALAPHHDIGGLVRLLAAHQLPDTPRIPLQLSYANE
FT                   KASGRLQVPPKWTVTPSSALFGELETLLGSRSVRVNW"
FT   gene            85956..86189
FT                   /locus_tag="NGO_0079"
FT   CDS_pept        85956..86189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0079"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88840"
FT                   /db_xref="GOA:Q5FAE7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002237342.1"
FT                   /protein_id="AAW88840.1"
FT                   /translation="MEATVYLEDNEYIALCDLLKLAGLAESGGQAKAFIAEGLVLRNGG
FT                   TEIRKTAKIRGGEVIEFDGARLEIADGYDPEA"
FT   gene            86167..86370
FT                   /locus_tag="NGO_0080"
FT   CDS_pept        86167..86370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88841"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217925.1"
FT                   /protein_id="AAW88841.1"
FT                   /translation="MDTTLKHKAEALLGEPLLDEPVRPESWECCGSDCGEACIQTIYWA
FT                   DKARYDAQRKKLKEAGWPDDAV"
FT   gene            complement(86412..86666)
FT                   /locus_tag="NGO_00430"
FT   CDS_pept        complement(86412..86666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00430"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRK4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017146706.1"
FT                   /protein_id="AKO63591.1"
FT                   /translation="MGCYVVVNEGRDVSMLSDSVAAAVILKNRCMANAKEKPLCRHSRA
FT                   GENPDFDLLEMFKVNRYFKLPDSCFRGNGDMNVFNFNLL"
FT   gene            86665..87501
FT                   /locus_tag="NGO_0081"
FT   CDS_pept        86665..87501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0081"
FT                   /product="phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88842"
FT                   /db_xref="GOA:Q5FAE5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214549.1"
FT                   /protein_id="AAW88842.1"
FT                   /translation="MIDLHCHSTVSDGMLPPAEVVRLAHQNGCTLLALTDHDHTGGISE
FT                   ARAEADRLGLRLINGVEISVTWRGRTIHVVGLDFDEQDENLQNLLADVRKGRLKRLEAI
FT                   AAKLEKKGIGGAYDGALALAANKEMVSRTHVAEFLIKNGHVKNKQQAFTKYLGDGKSCA
FT                   VRHEWATLADCVSAVNGAGGMAVIAHPMRYDLSATAKRNLFEEFKNLGGAGIEVHSGNC
FT                   CKNDRLNYALLADRFGLLASAGSDFHRLDDFSGGILGACPDLPENCKPVRAHFSRH"
FT   gene            complement(87553..88845)
FT                   /locus_tag="NGO_0082"
FT   CDS_pept        complement(87553..88845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0082"
FT                   /product="valine--pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88843"
FT                   /db_xref="GOA:Q5FAE4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002241916.1"
FT                   /protein_id="AAW88843.1"
FT                   /translation="MQFSAFGEKFTQHSGILQLMDDLGDALKSDKPVNMLGGGNPARIP
FT                   EIDRAFADIFSKLAAEHAVENIGNYSNPQGDAALIDALTAFPNREYGWNLTVGNIALTN
FT                   GSQNAFFYLFNLFGGKFKLSDGTSAEKAILLPLAPEYIGYADVHVEGRHFVSVKPKIEN
FT                   VEHEGEAGFFKYRVDFDALENLPELKAGKIGAICCSRPTNPTGNVLTDGEMARLDALAR
FT                   EHGIPPIIDNAYGMPFPNIIDSGVTLNWHENIILCFSLSKVGLPGVRTGIIVAAPEAVK
FT                   AVSSLNAIVNLAPTRFGAAIAAPLLESGEMKRLADQVIRPFYRNQAQTAVSLLKRELGA
FT                   YPMKIHKPEGAIFLWLWFENLPVSSQTLYEMLKAEGTLIIPGEHFFVGIDTQDYPHAGE
FT                   CIRMSIAQDAQTLEKGIAAIGKTVRKPYDNV"
FT   gene            complement(88901..90811)
FT                   /locus_tag="NGO_0083"
FT   CDS_pept        complement(88901..90811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0083"
FT                   /product="protein-PII uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88844"
FT                   /db_xref="GOA:Q5FAE3"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221304.1"
FT                   /protein_id="AAW88844.1"
FT                   /translation="MNLETLIALPRNIKKICFLIHDFLMIFTAFWFTQSLKADYSDEWF
FT                   DFANWQSFLLTALLTITLFIRMGLYRAVTRFVSFHVLTTAFAGSLASAVLFFLNTLIFE
FT                   ERLRLALPIVYFLLLFVSVTGSRMVLRGLLSDHQKKTHDPVIIYGAGRSGRQLLEAVKQ
FT                   MREYSAAAFVDDNPKLWHTVIYDLAVYQPDAIAFLIERYGVEKILLAIPSATQEQRRRI
FT                   ISKLKAYPCEVLTIPGMKDLMDGKISIGTLKKISVSDLLGRDSVAPDDRLMNADTEGKT
FT                   VMVTGAGGSIGSELCRQIIRRRPERLLLFELSEFALYTVEKELCEYCARNGIAAEILPF
FT                   LGSVQNRTLLTHIMTAFSVATVYHAAAYKHVPMVEFNTVEGIRNNIFGTLECALAATAS
FT                   GVETFVLISTDKAVRPANTMGAGKRMAELCLQALAAEPGQKTRFSMVRFGNVLGSSGSV
FT                   VPLFEKQIAEGGPITLTHPDITRYFMTIPEAAQLVIQAGAMGRGGDVFVLDMGESVKIT
FT                   DLARQMITLSGLKPKTPEQPDGDIEILITGLRPGEKLYEELLIGDNVRKTGHPRIMTAD
FT                   ETMLPWHELSALLDRIRTACDRYDQQAIRDLLVNAPTGFTPTGGICDLLWVCETHRKNA
FT                   V"
FT   gene            complement(90859..92064)
FT                   /locus_tag="NGO_0084"
FT   CDS_pept        complement(90859..92064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0084"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88845"
FT                   /db_xref="GOA:Q5FAE2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687338.1"
FT                   /protein_id="AAW88845.2"
FT                   /translation="MPSEPDGPNTMLNTALSPWPSFTREEADAVSKVLLSNKVNYWTGS
FT                   ECREFEKEFAAFAGTRYAVALSNGTLALDAALKAIGIGAGDDVIVTSRTFLASASCIVN
FT                   AGANPVFADVDLNSQNISAETVKAVLTPNTKAVIVVHLAGMPAEMDGIMALAKEHDLWV
FT                   IEDCAQAHGATYKGKSVGSIGHVGAWSFCQDKIITTGGEGGMVTTNDKTLWEKMWAYKD
FT                   HGKSYDAVYHREHAPGFRWLHESFGTNWRMMEMQAVIGRIQLKHLPEWTARRQENAAKL
FT                   AESLRKFKSIRLIEVAGYIGHAQYKFYAFVKPEHLKDDWTRDRIVSELNARNVPCYQGG
FT                   CSEVYLEKAFDNTPWRPKERLKNAVELGGTALTFLVHPTLTDDEIAFCKKHIEAVLTEA
FT                   AR"
FT   gene            complement(92165..93406)
FT                   /locus_tag="NGO_0085"
FT   CDS_pept        complement(92165..93406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0085"
FT                   /product="UDP-N-acetylgalactosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88846"
FT                   /db_xref="GOA:Q5FAE1"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="PDB:4M98"
FT                   /db_xref="PDB:4M99"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704933.1"
FT                   /protein_id="AAW88846.1"
FT                   /translation="MSKAVKRLFDIIASASGLIVLSPVFLVLIYLIRKNLGSPVFFIRE
FT                   RPGKDGKPFKMVKFRSMRDALDSDGIPLPDSERLTDFGKKLRATSLDELPELWNVLKGE
FT                   MSLVGPRPLLMQYLPLYNKFQNRRHEMKPGITGWAQVNGRNALSWDEKFSCDVWYTDNF
FT                   SFWLDMKILFLTVKKVLIKEGISAQGEATMPPFAGNRKLAVIGAGGHGKVVAELAAALG
FT                   TYGEIVFLDDRTQGSVNGFPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITENAAAL
FT                   GFKLPVLIHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDCLLDAF
FT                   VHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNP
FT                   AKPLTGKNPKTGTA"
FT   gene            complement(93399..94565)
FT                   /locus_tag="NGO_0086"
FT   CDS_pept        complement(93399..94565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0086"
FT                   /product="glycosyl transferase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88847"
FT                   /db_xref="GOA:Q5FAE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAE0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704930.1"
FT                   /protein_id="AAW88847.1"
FT                   /translation="MNITIAAPYCSLPSEPHFNRFWYLAELLSQSHDVLLITSNFKHYD
FT                   KSFRRPEDAKAASQGRLKVMLLEESGYSKNVSLGRVTSHHRFVKHFEKWLENCRPGEQD
FT                   VVYSAYPLIATNLLLGKHKARLGYKLIVDVQDVWPESFSSVVPFLKKIPHNLLPFASRA
FT                   NRAYRYADALVAVSQTYLDRAKEANPNVPGEVVYIGADFAAIAPPPRFRSKTVRFFYLG
FT                   TLSYNYDVETVCKGVRKLLDDGENVELHIMGGGPDLDRLKQYACDGIKFYGYIPYAEMM
FT                   SVAKGCDIAVNAIHSYAMQSITNKLSDYMALQKPILNSQVHDEVAEVLTLLPHENYRSG
FT                   DVDGFVQAAKDILKRKNDPVQSDEIVRRFRHDISYRKIVNLIERLANE"
FT   gene            complement(94579..95643)
FT                   /locus_tag="NGO_0087"
FT   CDS_pept        complement(94579..95643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0087"
FT                   /product="glycosyl transferase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88848"
FT                   /db_xref="GOA:Q5FAD9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAD9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704929.1"
FT                   /protein_id="AAW88848.1"
FT                   /translation="MKIILTTSMSGLGGTETATVRLGRLLKRHGHDIILASSDGPFVGE
FT                   AQASGIRWQPVDFYRGGLAGYLKSTFAYARMLRREQPDIIDCQMARVVPACALAAKIVS
FT                   PKTKIICHSHGLDAATYPKTAKLFDKLGAYIIGNCKHEREKLIRHGFPAGRIAYAYNTP
FT                   PEFHFRKTEKECAVLGTLSRLDTVRAVHLMLDILKKMVGRNIPVRLNMAGIGEEMDNLK
FT                   AQAKRLGIEDKVTFLGGVRDLTGYFKEVDILVNTPHCVGDHGAGVGNNILEAGLYDTPV
FT                   VTYNMAGISEMVITGQTGYCIPFGDDEAFIEAVDTLIKHPELRSQMGKALHKHVETLCS
FT                   DDEIYRTTMAAYEM"
FT   gene            complement(95640..97061)
FT                   /locus_tag="NGO_0088"
FT   CDS_pept        complement(95640..97061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0088"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88849"
FT                   /db_xref="GOA:Q5FAD8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAD8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010356645.1"
FT                   /protein_id="AAW88849.1"
FT                   /translation="MDTKEILGYAAGSIGSAVLAVIILPLLSWYFPADDIGRIVLMQTA
FT                   AGLTVSVLCLGLDQAYVREYYAAADKDTLFKTLFLPPLLFSAAIAALLLSRPSLPSEIL
FT                   FSLDDAAAGIGLVLFELSFLPIRFLLLVLRMEGRALAFSSAQLVPKLAILLLLPLTVGL
FT                   LHFPANTSVLTAVYALANLAAAAFLLFQNRCRLKAVRRAPFSPAVLHRGLRYGIPLALS
FT                   SLAYWGLASADRLFLKKYAGLEQLGVYSMGISFGGAALLLQSIFSTVWTPYIFRAIEEN
FT                   ATPARLSATAESAAALLASALCLTGIFSPLASLLLPENYAAVRFTVVSCMLPPLFYTLT
FT                   EISGIGLNVVRKTRPIALATLGALAANLLLLGLAVPSGGTRGAAVACAASFWLFFVFKT
FT                   ESSCRLWQPLKRLPLYMHTLFCLASSAAYTCFGTPANYPLFAGVWAAYLAGCILRHRKN
FT                   LHKLFHYLKKQGFPL"
FT   gene            complement(97256..98365)
FT                   /locus_tag="NGO_0089"
FT   CDS_pept        complement(97256..98365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0089"
FT                   /product="DeoR faimly transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88850"
FT                   /db_xref="GOA:Q5FAD7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAD7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010356647.1"
FT                   /protein_id="AAW88850.1"
FT                   /translation="MFSDTNISMMENALRLAALGRFSTSPNPRVGCVIAHGSQIVGQGF
FT                   HVKAGEPHAEVHALRQAGEMAKGATAFVTLEPCSHYGRTPPCAEALLRSGVTRVVAAMR
FT                   DPNPPVAGKGLVLLKAAGIKTECGLLENKARELNRGFLSRIERRRPFVRLKCAVSLDGK
FT                   TALSDGSSFWITGEEARADVQVLRAESCAVLTGIGTVLADNPRLNVRAFPTLRQPARIV
FT                   LDSRLRLPPNSHLVTDGQSPTYIATLERDEDKLRPYREHAHIRILMPSETADGKIDLHH
FT                   LMRLLADEGFGEIMVEAGSELTSAFLAENLADEIVLYRSPKILGGGKDLFSLPENRAAL
FT                   SAPPLWTPVSSEILGHDIKTVFRKNGNAF"
FT   gene            complement(98397..98849)
FT                   /locus_tag="NGO_0090"
FT   CDS_pept        complement(98397..98849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0090"
FT                   /product="NrdR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88851"
FT                   /db_xref="GOA:Q5FAD6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAD6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704920.1"
FT                   /protein_id="AAW88851.1"
FT                   /translation="MKCPFCAHPDTRVVDSRLMEERNAVRRRRQCPGCGKRFGTLETAE
FT                   LKMPAVIGPDKKRSPFNAQRLRNDLTAAARKSALTPEQIDETVRLTEHRLYTSGQRDIS
FT                   SSELVEIVLEELFGQNTEAAVRFAALHKRFDSPEHFASWLAQGGKT"
FT   gene            complement(98878..99720)
FT                   /locus_tag="NGO_0091"
FT   CDS_pept        complement(98878..99720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0091"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88852"
FT                   /db_xref="GOA:Q5FAD5"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAD5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017629283.1"
FT                   /protein_id="AAW88852.1"
FT                   /translation="MCQLLGMNCNTPTDIMFSFEGFRRRGGITDHHADGFGIGFFEGKG
FT                   VRLFHDDKPSANSPVADLVRAYQIKSENVVAHIRKASQGQTSLANTHPFMREMWGGYWL
FT                   FAHNGHLVDFFPEQGEFFHPVGTTDSERAFCHILNRLRTRFAARPDDDTLFDAIAGLTH
FT                   EIRKFGLFNFMLSDGISLFAHASTLLHYIVRQAPFGKARLLDDDVMVDFAEVTTPDDRV
FT                   AVISTLPLTRDESWSQLAVNELVMFREGNIVRHDRPENPVYMSAEEGLEIARAAGVSV"
FT   gene            complement(100459..101538)
FT                   /locus_tag="NGO_0092"
FT   CDS_pept        complement(100459..101538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0092"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88853"
FT                   /db_xref="GOA:Q5FAD4"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAD4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014582239.1"
FT                   /protein_id="AAW88853.1"
FT                   /translation="MKTLTVHTPSHSYPIFIGNGLLPQAGSLLKPHLGKRAAIITNETV
FT                   APLYLGTLQTALDAAGVSHFSIILPDGEAHKNWQTLNLIFDGLMQNRAERKTTLIALGG
FT                   GVIGDMVGFAAATYQRGAPFIQIPTTLLSQVDSSVGGKTAINHPLGKNMIGAFYQPQAV
FT                   LADLDTLHTLPARELSAGMAEVIKYGALGDIGFFEWLEQHMPELMALERAPLTQAVYRC
FT                   CQMKADIVAQDETEQGIRAWLNLGHTFGHAVEAEMGYGVWLHGEAVAAGCVLAARLSEQ
FT                   LGKTSAADTARLAALLEAAGLPSAPPVFAFEKWLAHMSHDKKVSGGIMRFIGLNRLGEA
FT                   VITEITDTDILRRTLQPYL"
FT   gene            complement(101618..102130)
FT                   /locus_tag="NGO_0093"
FT   CDS_pept        complement(101618..102130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0093"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88854"
FT                   /db_xref="GOA:Q5FAD3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAD3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P63600.1"
FT                   /protein_id="AAW88854.1"
FT                   /translation="MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAAG
FT                   VPIPTIFEMEGEQGFRSRETAILKKLIVLPHIVLSTGGGAVLKEENRALIRKSGTVVYL
FT                   HAPPETLLERTRCDNSRPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRETVQT
FT                   LLKRLSR"
FT   gene            103086..103223
FT                   /locus_tag="NGO_00500"
FT   CDS_pept        103086..103223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00500"
FT                   /product="phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00500"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63592"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5B7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003710247.1"
FT                   /protein_id="AKO63592.1"
FT                   /translation="MFRVAVFCGNDEALDCEDLSLPPSFPQKWESRNEKQQEFIGNDRN
FT                   "
FT   gene            complement(103398..105569)
FT                   /locus_tag="NGO_0094"
FT   CDS_pept        complement(103398..105569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0094"
FT                   /product="pilus assembly protein PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88855"
FT                   /db_xref="GOA:Q5FAD2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAD2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5FAD2.1"
FT                   /protein_id="AAW88855.1"
FT                   /translation="MNTKLTKIISGLFVATAAFQTASAGNITDIKVSSLPNKQKIVKVS
FT                   FDKEIVNPTGFVTSSPARIALDFEQTGISMDQQVLEYADPLLSKISAAQNSSRARLVLN
FT                   LNKPGQYNTEVRGNKVWIFINESDDTVSAPARPAVKAAPAAPAKQQAAAPFTESVVSVS
FT                   APFSPAKQQAAASAKQTNIDFRKDGKNAGIIELAALGFAGQPDISQQHDHIIVTLKNHT
FT                   LPTALQRSLDVADFKTPVQKVTLKRLNNDTQLIITTTGNWELVNKSAAPGYFTFQVLPK
FT                   KQNLESGGVNNAPKTFTGRKISLDFQDVEIRTILQILAKESGMNIVASDSVSGKMTLSL
FT                   KDVPWDQALDLVMQARNLDMRQQGNIVNIAPRDELLAKDKAFLQAEKDIADLGALYSQN
FT                   FQLKYKNVEEFRSILRLDNADTTGNRNTLVSGRGSVLIDPATNTLIVTDTRSVIEKFRK
FT                   LIDELDVPAQQVMIEARIVEAADGFSRDLGVKFGATGRKKLKNETSAFGWGVNSGFGGG
FT                   DKWEAQTKINLPVAAAANSISLVRAISSGALNLELSASESLSKTKTLANPRVLTQNRKE
FT                   AKIESGYEIPFTVTTASGGGNSTNTELKKAVLGLTVTPNITPDGQIIMTVKINKDSPAQ
FT                   CASGNNTILCISTKSLNTQAMVENGGTLIVGGIYEENNGNTLTKVPLLGDIPVIGNLFK
FT                   TRGKKTDRRELLIFITPRIIDTAGNSLRY"
FT   gene            complement(105588..106133)
FT                   /locus_tag="NGO_0095"
FT   CDS_pept        complement(105588..106133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0095"
FT                   /product="pilin assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88856"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAD1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221313.1"
FT                   /protein_id="AAW88856.1"
FT                   /translation="MKHYALLISFLALSACSQNSEDLNEWMAQTRREAKAEIIPFQAPT
FT                   LPVAPVYSPPQLTGPNAFDFRRMETAKKGENAPDTKRIKETLEKFSLENMRYVGILKSG
FT                   QKVSGFIEAEGYVYTVGVGNYLGQNYGRIESITDDSIILNELIEDSTGNWVSRKAELLL
FT                   NSSDKNTEQAAAPAAEQN"
FT   gene            complement(106151..106798)
FT                   /locus_tag="NGO_0096"
FT   CDS_pept        complement(106151..106798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0096"
FT                   /product="pilus assembly protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88857"
FT                   /db_xref="GOA:Q5FAD0"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAD0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690570.1"
FT                   /protein_id="AAW88857.1"
FT                   /translation="MASKSSKTNLDLNNLHLLNLPARLFIALLVVAAVLGLGYAGLFKS
FT                   QMESLEEYEAKETELKNTYKQKSIDAASLNNLRDELASIRSTFDIMLKQLPTDAEIPNL
FT                   VQELHQAGSSNGLRLDSVMPQPPVDDGPIKKLPYSISITGNYEQISQFTRDVGSLSRII
FT                   TLESLKIAQSPENGGNPDGKSSILNLSAIATTYQAKSVEELAAEAAQNAEQK"
FT   gene            complement(106799..107398)
FT                   /locus_tag="NGO_0097"
FT   CDS_pept        complement(106799..107398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0097"
FT                   /product="pilus assembly protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88858"
FT                   /db_xref="GOA:Q5FAC9"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAC9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214520.1"
FT                   /protein_id="AAW88858.1"
FT                   /translation="MNNLIKINLLPYREEMNKRKQQQFKTLMYGAVLTGVAAVAATYLF
FT                   IDNMINKQSEKNTLLEISIAHLDTELSEIQKLKQEKDAFLIKKNKIEELQIKRLQAAKI
FT                   LDSLNEAVPGSTYLTSLDAVTADSYRLSGRTSSDNRVAAMMRAMPNTGIFKQPELLSIK
FT                   KNNSHQEFTLQATLQPIVKAAESKENPASGNAQEAN"
FT   gene            complement(107401..108516)
FT                   /locus_tag="NGO_0098"
FT   CDS_pept        complement(107401..108516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0098"
FT                   /product="pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88859"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAC8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015815297.1"
FT                   /protein_id="AAW88859.1"
FT                   /translation="MRLFKSLKNPKKTDAKLPKKSSGLNNRAAIGIDIDQHSIKMVQLS
FT                   GRSLNQIQLEKYVIAKLPKNIIQGNKVQNYDQLVTYLQQAYAKLGTSCKNIVASVPQNL
FT                   ATIEQLTYTAKDAELDLQGFVESSISEASSISLEEANYDYQVLSQSAVGEAVLSVASRK
FT                   DEIEPLIDAFNAAGMKLSALDVDIFGQYNAYALWINHFAPELADEKVAIFGVYAAQTYA
FT                   LVIQDGKILYKQETSVSEEQLNQLIQRTYQVTAEKAEEIINSPQKPSDYQESVANYFNQ
FT                   QITQEIQRVLQFYYTTQTADDMTDIKHILLTGEAVRQKGIAQTVASQTNADVQCVHPAR
FT                   YFANDLKTDEQQFELDAPTLTKAFGLAVRGL"
FT   gene            108668..111064
FT                   /locus_tag="NGO_0099"
FT   CDS_pept        108668..111064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0099"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88860"
FT                   /db_xref="GOA:Q5FAC7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAC7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014580082.1"
FT                   /protein_id="AAW88860.1"
FT                   /translation="MIKKILTTCFGLFFGFCVFGVGLVAIAILVTYPKLPSLDSLQHYQ
FT                   PKMPLTIYSADGEVIGMYGEQRREFTKIGDFPEVLRNAVIAAEDKRFYRHWGVDVWGVA
FT                   RAAVGNVVSGSVQSGASTITQQVAKNFYLSSEKTFTRKFNEVLLAYKIEQSLSKDKILE
FT                   LYFNQIYLGQRAYGFASAAQIYFNKNVRDLTLAEAAMLAGLPKAPSAYNPIVNPERAKL
FT                   RQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRRELYEKYGED
FT                   AYTQGFKVYTTVRTDHQKAATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQY
FT                   LSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVALDRRALGFAARAVDNEKMGEDRIR
FT                   RGAVIRVKNNGGRWAVVQEPLLQGALVSLDAKTGAVRALVGGYDFHSKTFNRAVQAMRQ
FT                   PGSTFKPFVYSAALSKGMTASTVVNDAPISLPGKGPNGSVWTPKNSDGRYSGYITLRQA
FT                   LTASKNMVSIRILMSIGVGYAQQYIRRFGFRPSELPASLSMALGTGETTPLKVAEAYSV
FT                   FANGGYRVSSHVIDKIYDRDGRLRAQMQPLVAGQNAPQAIDPRNAYIMYKIMQDVVRVG
FT                   TARGAAALGRTDIAGKTGTTNDNKDAWFVGFNPDVVTAVYIGFDKPKSMGRAGYGGTIA
FT                   VPVWVDYMRFALKGKQGKGMKMPEGVVSSNGEYYMKERMVTDPGLMLDNSGIAPQPSRR
FT                   AKEDDEAAVENEQQGRSDETRQDVQETPVLPSNTDSKQQQLDSLF"
FT   gene            complement(111184..111813)
FT                   /locus_tag="NGO_0100"
FT   CDS_pept        complement(111184..111813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0100"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88861"
FT                   /db_xref="GOA:Q5FAC6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAC6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690572.1"
FT                   /protein_id="AAW88861.2"
FT                   /translation="MNLFQNAKFFTTVNHLKDLPDTPLEIAFVGRSNAGKSSAINTLTN
FT                   HVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRK
FT                   QLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLL
FT                   KPYSDRQNISVQLFSSLKKQGIDEANRTVGSWFDAADAAASSPEEN"
FT   gene            112020..112643
FT                   /locus_tag="NGO_0101"
FT   CDS_pept        112020..112643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0101"
FT                   /product="cytochrome C"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88862"
FT                   /db_xref="GOA:Q5FAC5"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAC5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687359.1"
FT                   /protein_id="AAW88862.1"
FT                   /translation="MRRLTLLAFVLAAGAVSASPKADVEKGKQVAATVCAACHAADGNS
FT                   GIAMYPRLAAQHTAYIYHQTIGIRDGKRTHGSAAVMKPVVMNLSDQDILNVSAFYAKQQ
FT                   PKSGEANPKENPELGAKIYRGGLSDKKVPACMSCHGPSGAGMPGGGSEIQAYPRLGGQH
FT                   QAYIVEQMNAYKSGQRKNTIMEDIANRMSEEDLKAVANFIQGLR"
FT   gene            complement(112719..112922)
FT                   /locus_tag="NGO_00545"
FT   CDS_pept        complement(112719..112922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00545"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IVZ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010361240.1"
FT                   /protein_id="AKO63593.1"
FT                   /translation="MELKKANHGRERSVGDIRDLLIVCLFRHQEYGKAELGRQKTTSRF
FT                   YCLDAFYFKTMKTACIDSNGCD"
FT   gene            112921..114873
FT                   /locus_tag="NGO_0102"
FT   CDS_pept        112921..114873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0102"
FT                   /product="cytochrome C biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88863"
FT                   /db_xref="GOA:Q5FAC4"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAC4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002235152.1"
FT                   /protein_id="AAW88863.2"
FT                   /translation="MRFAVALLSLLGIASVIGTVLQQNQPQTDYLVKFGPFWTRIFDFL
FT                   GLYDVYASAWFVVIMMFLVVSTSLCLIRNVPPFWREMKSFREKVKEKSLAAMRHSSLLD
FT                   VKIAPEVAKRYLEVRGFQGKTVSREDGSVLIAAKKGTMNKWGYIFAHVALIVICLGGLI
FT                   DSNLLLKLGMLAGRIVPDNQAVYAKDFKPESILGASNLSFRGNVNISEGQSADVVFLNA
FT                   DNGMLVQDLPFEVKLKKFHIDFYNTGMPRDFASDIEVTDKATGEKLERTIRVNHPLTLH
FT                   GITIYQASFADGGSDLTFKAWNLRDASREPVVLKATSIHQFPLEIGKHKYRLEFDQFTS
FT                   MNVEDMSEGAEREKSLKSTLNDVRAVTQEGKKYTNIGPSIVYRIRDAAGQAVEYKNYML
FT                   PILQDKDYFWLTGTRSGLQQQYRWLRIPLDKQLKADTFMALREFLKDGEGRKRLVADAT
FT                   KDAPAEIREQFMLAAENTLNIFAQKGYLGLDEFITSNIPKGQQDKMQGYFYEMLYGVMN
FT                   AALDETIRRYGLPEWQQDEARNRFLLHSMDAYTGLTEYPAPMLLQLDGFSEVRSSGLQM
FT                   TRSPGALLVYLGSVLLVLGTVFMFYVREKRAWVLFSDGKIRFAMSSARSERDLQKEFPK
FT                   HVESLQRLGKDLNHD"
FT   gene            114866..116053
FT                   /locus_tag="NGO_0103"
FT   CDS_pept        114866..116053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0103"
FT                   /product="cytochrome C biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88864"
FT                   /db_xref="GOA:Q5FAC3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAC3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003750256.1"
FT                   /protein_id="AAW88864.1"
FT                   /translation="MTEHYKTLPEHELLIQKSLIRNLNLWDWVFAVLVFAATVFVQTRS
FT                   GMHMDIYETVMLWASAGIAVFLGWFFKPMRWFVPLSVLLAYAAVGLYGGNIKSAEIFLL
FT                   RYFLSSQSAIMWQCAFVFFALFAYISGAVLASVKNVPTNTLLGMGTVFAWVSAVAGFTG
FT                   LLVRWHESYLLRPDAGHIPVSNLYEVFILFLVITALMYLYYEGKFAVQKLGGFVFGFMA
FT                   VVVGFVLWYSVSREAHTIQPLIPALQSWWMKIHVPANFIGYGAFCISAMLGIAELVSLR
FT                   AEEKGGKLWLPPSALIDEVMYKAIAVGFLFFTIATILGALWAADAWGRYWSWDPKETWA
FT                   FIVWLNYAVWLHLRLVAGWRGKVLAWWAIIGLFVTAFAFIGVNMFLSGLHSYGTL"
FT   gene            116169..117233
FT                   /locus_tag="NGO_0104"
FT   CDS_pept        116169..117233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0104"
FT                   /product="UGMP family protein"
FT                   /note="universal genome maintenance protein;
FT                   Kae1/Qri7/OSGEP/YgjD family protein; in Archaea, some Kae1
FT                   are found as fusion proteins similar to two distinct
FT                   proteins in yeast that are involved in the KEOPS complex;
FT                   kinase associated endopeptidase 1 (Kae1) and a
FT                   serine/threonine protein kinase (Bud32); in Pyrococcus Kae1
FT                   has atypical AP endonuclease activity and inhibits the
FT                   kinase activity of Bud32; the protein is essential in
FT                   Escherichia coli and Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88865"
FT                   /db_xref="GOA:Q5FAC2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAC2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014582237.1"
FT                   /protein_id="AAW88865.1"
FT                   /translation="MLVLGIESSCDETGVALYDTERGLRSHCLHTQMAMHAEYGGVVPE
FT                   LASRDHIRRLVPLTEGCLAQAGASYGDIDAVAFTQGPGLGGALLAGSSYANALALALDK
FT                   PVIPVHHLEGHLLSPLLAEEKPDFPFVALLVSGGHTQIMAVRGIGDYELLGESVDDAAG
FT                   EAFDKTAKLLGLPYPGGAKLSELAESGRPEAFVFPRPMIHSDDLQMSFSGLKTAVLTAV
FT                   EKVREANGSETIPEQTRNNICRAFQDAVVEVLEAKVKKALLQTGFRTVVVAGGVGANRK
FT                   LRETFGNMTVQIPTPKGKPKHPSEKVSVFFPPMAYCTDNGAMIAFAGAMHLGKGREVGA
FT                   FNVRPRWSLSEIVK"
FT   gene            complement(117278..118126)
FT                   /locus_tag="NGO_0105"
FT   CDS_pept        complement(117278..118126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0105"
FT                   /product="lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88866"
FT                   /db_xref="GOA:Q5FAC1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAC1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687365.1"
FT                   /protein_id="AAW88866.2"
FT                   /translation="MHILLTALLKCLSLLSLSCLHTLGNRLGHLAFYLLKEDRARIVAN
FT                   MRQAGLNPDTQTVKAVFAETAKCGLELAPAFFKKPEDIETMFKAVHGWEHVQQALDKGE
FT                   GLLFITPHIGSYDLGGRYISQQLPFHLTAMYKPPKIKAIDKIMQAGRVRGKGKTAPTGI
FT                   QGVKQIIKALRAGEATIILPDHVPSPQEGGGVWADFFGKPAYTMTLAAKLAHVKGVKTL
FT                   FFCCERLPDGQGFVLHIRPVQGELNGNKAHDAAVFNRNTEYWIRRFPTQYLFMYNRYKT
FT                   P"
FT   gene            complement(118265..118468)
FT                   /locus_tag="NGO_00570"
FT   CDS_pept        complement(118265..118468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00570"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63594"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISJ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687369.1"
FT                   /protein_id="AKO63594.1"
FT                   /translation="MNIMSTAGNIAKFPYSCHSVEKYSYLNGALESLSVRFVQAKKFPH
FT                   QAGLDCSGEPHRFFNRPPYLSV"
FT   gene            118517..119686
FT                   /locus_tag="NGO_0106"
FT   CDS_pept        118517..119686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0106"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="catalyzes the formation of S-adenosylmethionine from
FT                   methionine and ATP; methionine adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88867"
FT                   /db_xref="GOA:Q5FAC0"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="PDB:5T8S"
FT                   /db_xref="PDB:5T8T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAC0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009312787.1"
FT                   /protein_id="AAW88867.2"
FT                   /translation="MSEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETL
FT                   VNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIA
FT                   QGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWL
FT                   RPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLT
FT                   DETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAY
FT                   ACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDL
FT                   RPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL"
FT   gene            complement(119751..121160)
FT                   /locus_tag="NGO_0107"
FT   CDS_pept        complement(119751..121160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0107"
FT                   /product="peptidase S13"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88868"
FT                   /db_xref="GOA:Q5FAB9"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAB9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002250348.1"
FT                   /protein_id="AAW88868.1"
FT                   /translation="MNFPKTAASLLLLLASLAAHALDTGRIPQNEIAVYVQELDSGKVI
FT                   IDHRAGIPVNPASTMKLVTAFAAFKTFGSNYRWATEFKSNGTVNDGTLDGNLYWAGSGD
FT                   PVFNQENLLAVQRQLRDKGIRNITGRLMLDHSLWGEVGSPDHFEADSGSPFMTPPNPTM
FT                   LSAGMVMVRAERNAAGSTDILTDPPLPHIFAQNNLKITASQAACPSVKKLMRASFSGNT
FT                   LKLRGNIPESCLGKPVGVRMFALDELIRQSFTNRWLLGGGRISDGIGIADTPEGAQTLA
FT                   VAHSKPMKEILTDMNKRSDNLIARSVFLKLGGDGKLPAVSEQAASAVRRELAVSGIDVA
FT                   DLVLENGSGLSRKERVTARMMAQMLETAYFSPFAQDFIDTLPIAGTDGTLRNRFKQSGG
FT                   LLRLKTGTLNNVRALAGYWLGDKPMAVVVIINSGRAVSLLPDLDNFVAKNIISGGDGWL
FT                   DAKLMCKERRA"
FT   gene            121405..121890
FT                   /locus_tag="NGO_0108"
FT   CDS_pept        121405..121890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0108"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88869"
FT                   /db_xref="GOA:Q5FAB8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAB8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010950992.1"
FT                   /protein_id="AAW88869.1"
FT                   /translation="MFPEGWQAEIVEIGHLPLYNFDYDDPEVEDVPLPESYTAFRETIK
FT                   ASDGILFVTSENNRTIPACLKNAVDIGSKPNADVAWKNKPAGIISHSVGKMGGYSSQKN
FT                   LRLALSYFDMPVTGQPEVFLGNSPTLFDENGKLIDSARDFVQSYINQFVGLIERNAK"
FT   gene            121880..122068
FT                   /locus_tag="NGO_0109"
FT   CDS_pept        121880..122068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88870"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAB7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690577.1"
FT                   /protein_id="AAW88870.1"
FT                   /translation="MPNKQTKSKSRKTGSGFAAFLYGPGSVKVCRLPDNARQMIGVFKI
FT                   PRVRHAPRSAMIGGSFV"
FT   gene            122065..122244
FT                   /locus_tag="NGO_00595"
FT   CDS_pept        122065..122244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00595"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IUY8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704524.1"
FT                   /protein_id="AKO63595.1"
FT                   /translation="MNRRTGTDAPAPSRYRLFRIGCRREMTDGCRNVGRREWNARLIPH
FT                   MLAVLPARAVLCSK"
FT   gene            122259..123572
FT                   /locus_tag="NGO_0110"
FT   CDS_pept        122259..123572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0110"
FT                   /product="citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88871"
FT                   /db_xref="GOA:Q5FAB6"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAB6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690578.1"
FT                   /protein_id="AAW88871.1"
FT                   /translation="MLTFIGLLIIGVIVWLLLTEKVSPIIALILVPLIGALLAGFDVSQ
FT                   LKEFYSGGTKSVTQIVIMFMFSILFFGIMNDVGLFRPMIGGLIKLTRGNIVAVSVGTVL
FT                   VSVVAQLDGAGATTFLSVVPALLPLYKRLHMNPYLLFLLLTSSAGLINLLPRGGPIGRV
FT                   ASVLGADVGELYKPLLTVQIIGVVFILVLSLFLGVREKRRIVRELGALPAVADLIKPAP
FT                   LSEEEQKLARPKLFWWNVLLFLAAMSLLFSGIFPPGYVFMLAATAALLLNYRSPQEQME
FT                   RIYAHAGGAVMMASIILAAGTFLGILKGAGMLDAISKDLVHILPDALLPYLHIAIGVLG
FT                   IPLELVLSTDAYYFGLFPIVEQITSQAGVAPEAAGYAMLIGSIVGTFVTPLSPALWMGL
FT                   GLAKLSMGKHIRYSFFWAWGLSLAILVSSIAAGIVPLP"
FT   gene            123841..124468
FT                   /pseudo
FT                   /locus_tag="NGO_00605"
FT                   /note="XRE family transcriptional regulator; disrupted"
FT   gene            124550..125800
FT                   /locus_tag="NGO_0112"
FT   CDS_pept        124550..125800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0112"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88872"
FT                   /db_xref="GOA:Q5FAB5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAB5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704900.1"
FT                   /protein_id="AAW88872.1"
FT                   /translation="MFVPLAMLAGMFSYYETFHETEALQDDLLRQAALYVGPDSKPETL
FT                   PEGDGDTRILVQMPQQEDPVVSLPAHLADGLHTLQADGDDDYYRVYIRTTEQGRIAVMQ
FT                   ENEYREDLAEDAARQSVLPLLAALPLMILLTVWITHKAMRPVRKLSQSLEQRRINGLSA
FT                   LSVYNIPSKIRGFVTAINLLLKRVDEDIRRRQRFVADAAHELRTPMTALSLQAERLNNM
FT                   PLPPDAGRQSAVLQQSIRRNKHLLEQLLALARSQSDETPLTKTTFGLQSRFRQVLQELM
FT                   PLALEKRQDIGVAVGGDVEVSADETEIYTLVKTFADNAVRYTPNGGRIDLGFTDEGKYL
FT                   AVWVEDNGNGIPESECPRVLDPFYRILGTEQQGAGLGLSIADTLAKKYGGYLELTDSRR
FT                   FGHGLLIRALLDKETLK"
FT   gene            complement(125835..127328)
FT                   /locus_tag="NGO_0113"
FT   CDS_pept        complement(125835..127328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0113"
FT                   /product="ribonuclease G"
FT                   /note="involved in the processing of the 5'end of 16S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88873"
FT                   /db_xref="GOA:Q5FAB4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAB4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002227609.1"
FT                   /protein_id="AAW88873.1"
FT                   /translation="MLSGLPIPKDIARPPETILVNITPQETRVAVLEENNICELHIERN
FT                   SGHSLVGNIYLGVVRRVLPGMQSAFIDIGLERAAFLHIVDVLEQRRNPEETQRIEHMLF
FT                   EGQSVLVQVIKDPINTKGARLSTQISLAGRFLVHLPQEDHIGVSQRIEDDAERSSLRER
FT                   LDKLLPENACRGYIIRTNAENATDEQLQSDIDYLTKVWEHIQEQAKIRPPETLLYQDLP
FT                   LSLRVLRDMVGCDTQKILVDSTVNHGRMTRFAEQYVHGALGRIELFKGERPLFETHNIE
FT                   QEISRALQPRVNLNFGSYLIIESTEAMTTIDVNTGGFVGARNFDETIFRTNLEACHTIA
FT                   RELRLRNLGGIIIIDFIDMAQESHREAVLQELAKALAFDRTRVTLHDFTSLGLVELTRK
FT                   RSRENLNQVLCEPCPSCQGRGRLKTPQTVCYEIQREIVREARRYDAESFRILAAPNVID
FT                   LFLDEESQSLAMLIDFIGKPISLAVETAYTQEQYDIVLM"
FT   gene            127547..127804
FT                   /locus_tag="NGO_0114"
FT   CDS_pept        127547..127804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0114"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88874"
FT                   /db_xref="GOA:Q5FAB3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAB3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219776.1"
FT                   /protein_id="AAW88874.1"
FT                   /translation="MQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAEM
FT                   QRLSGQRSVPQIFIGETHVGGFTDLYRLQQEGGLDGLLNP"
FT   gene            127825..128268
FT                   /locus_tag="NGO_0116"
FT   CDS_pept        127825..128268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0116"
FT                   /product="preprotein translocase subunit SecB"
FT                   /note="molecular chaperone that is required for the normal
FT                   export of envelope proteins out of the cell cytoplasm; in
FT                   Escherichia coli this proteins forms a homotetramer in the
FT                   cytoplasm and delivers proteins to be exported to SecA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88876"
FT                   /db_xref="GOA:Q5FAB1"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAB1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019742968.1"
FT                   /protein_id="AAW88876.1"
FT                   /translation="MSEELQPVFSIERLYVKDLSLEVPHAPQIFLEQGDPEVDMRVSTG
FT                   SQKLEDGYYDVDVTVTVTAKLDNERTMFLNEVTQSGIFRLENIPEEDVQLLLGVACPNI
FT                   LFPYAREAVSGTVTRAGFPPVLLAPINFEAIYQQQQEAEAAGA"
FT   gene            128357..130396
FT                   /locus_tag="NGO_0117"
FT   CDS_pept        128357..130396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0117"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88877"
FT                   /db_xref="GOA:Q5FAB0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAB0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002225638.1"
FT                   /protein_id="AAW88877.2"
FT                   /translation="MSPETQKQLKITDVSAKKLDKLNLHTAWDLVLHLPLRYEDETHIM
FT                   PIKDAPIGVPCQVEGEVIHQEVTFKPRKQLIVQIADGSGSVLFLRFIHFYASHQKQTAV
FT                   GKRIRAVGEIKHGFYGDEMIHPKIRDAEGGGLAESLTPVYPTVNGLNQPTLRRIIQTAL
FT                   DVTPLHDTLPDALLGRLKLPRLAESLRLLHSPPPSFTIHQLSDGTLPAWQRLKFDELLA
FT                   QQLSMRLARQKRVSGTAAALRGDGTLTQALRQALPFALTDAQEKVVSEICRDMAQTHPM
FT                   HRLLQGDVGSGKTIVAALSALTAIESGAQVAVMAPTEILAEQHFIKFKQWLEPLGIEVV
FT                   CLFGSLRKKAKDEAKAKLADGSVKIAVGTHALFSDGVAFHNLGLSIVDEQHRFGVAQRL
FT                   ALKNKGREVHQLMMSATPIPRTLAMSFFADLDVSVIDELPPGRTPIKTRLVNNVRRAEV
FT                   EGFVLGTCRKGRQAYWVCPLIEESETLQLQTAAETLARLQTALPEPNIGLVHGRMKAAE
FT                   KAEVMAEFAAGRLNVLVATTVIEVGVDVPNAALMVIEHAERMGLAQLHQLRGRVGRGAG
FT                   ESVCVLLFAEPLGELAKARLKVIYEHTDGFEIARQDLNIRGPGEFLGARQSGVPMLRFA
FT                   KLEEDLHLLEQARETAPMLIEQNPEIVEAHLARWLSGREGYLGV"
FT   gene            complement(130990..132033)
FT                   /locus_tag="NGO_0118"
FT   CDS_pept        complement(130990..132033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0118"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88878"
FT                   /db_xref="GOA:Q5FAA9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FAA9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002242977.1"
FT                   /protein_id="AAW88878.1"
FT                   /translation="MSKKIKAGIVGATGYTGVELLRLLAAHPDVEVAAVTSRSEAGTAV
FT                   ADYFPSLRGVYGLAFQTPDEAGLEQCDIVFFATPNGIAMKDAPRLLEQGVRVIDLSADF
FT                   RIRDIPTWEHWYGMTHAAPGLVSQAVYGLSELNREAVAQARLVANPGCYPTCVSLPLVP
FT                   LLRQCRLKPGMPLIADCKSGVSGAGRKGNVGSLLCEAGDNFKAYGTAGHRHLPEIRQTI
FT                   AGLQDGIAEGFVFTPHLAPMIRGMHATVYLHLSDGSDPETVLRDYYRDSPFMDILPAGS
FT                   TPETRSVRGANLCRISIRQAAQSDVWVVLSVIDNLVKGAAGQAVQNMNIMFGLEETHGL
FT                   DAIPLLP"
FT   gene            complement(132030..132323)
FT                   /locus_tag="NGO_0119"
FT   CDS_pept        complement(132030..132323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0119"
FT                   /product="peptide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88879"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAA8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002221438.1"
FT                   /protein_id="AAW88879.1"
FT                   /translation="MKTLVLLLLSFSTTTAFAAYGLGLGQAPKYPVGFRAYGYVYSGRQ
FT                   GWVLKTEADAIKLDTLFKRFVYRPSAANQNPVGQAVGQRSDGIPANHTKEKP"
FT   gene            132347..132475
FT                   /locus_tag="NGO_0120"
FT   CDS_pept        132347..132475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAA7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214457.1"
FT                   /protein_id="AAW88880.1"
FT                   /translation="MKPDYSKRSSENRFQTTFYLITIKMLTTKNKPLFSVWRQIFN"
FT   gene            132575..133729
FT                   /locus_tag="NGO_0121"
FT   CDS_pept        132575..133729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0121"
FT                   /product="cupin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88881"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAA6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704893.1"
FT                   /protein_id="AAW88881.1"
FT                   /translation="MGIHLDFGISPKTFRQTYLYQKPKLFKGAVRNLEAASCKYINEIY
FT                   QRADPTAPLFHLRKKGAIVPKEEYVESFDDLGKTRYRFIKSVIYEHMKNGASLVYNHIN
FT                   NEPFSDHIARQVARFAGAHTIVSGYLAFGSDESYKNHWDTRDVYAIQLFGKKRWQLTAP
FT                   DFPMPLYMQQTKDTDISIPEHIDMDIILEAGDVLYIPRGWWHRPIPLGCETFHFAVGTF
FT                   PPNGYNYLEWLMKKFPTIESLRHSFSDWEQDRTRINDTAAQIAAMIADPVNYEAFSEDF
FT                   LGKERTDTAFHLEQFANPNATPLSDDVRLRLNANNLDTLEKGYLIGNGMKISVDELGKK
FT                   VLEHIGKNEPLLLKNLLVNFNQAKHEEVRKLIYQLIELDFLEIL"
FT   gene            133738..133965
FT                   /locus_tag="NGO_00655"
FT   CDS_pept        133738..133965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00655"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00655"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63596"
FT                   /db_xref="GOA:A0A0H4IRL0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRL0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002232975.1"
FT                   /protein_id="AKO63596.1"
FT                   /translation="MKNWKQFIFFVILVIACYQVLYFLSDMFLLDYINKYSWNLNFIQG
FT                   TLNFFSIYLPYVFVSRIFRNTNQEKEYKND"
FT   gene            133958..134311
FT                   /locus_tag="NGO_0122"
FT   CDS_pept        133958..134311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88882"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAA5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002234250.1"
FT                   /protein_id="AAW88882.2"
FT                   /translation="MIELQLHELKLVSGGGPVTDNIAGNVANAATTKGGPTWGDFVAIP
FT                   AAAATVHFLPKNFFGAIGANGVYNLTRDWVNDAVNAPPYNGRPIFEIEHGLTAPATKAD
FT                   KSGNGYTDGTDYC"
FT   gene            134372..135646
FT                   /locus_tag="NGO_0123"
FT   CDS_pept        134372..135646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0123"
FT                   /product="hemolysin D"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88883"
FT                   /db_xref="GOA:Q5FAA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAA4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687397.1"
FT                   /protein_id="AAW88883.1"
FT                   /translation="MNRPKQPFFRPEVAIARQTSLTGKVILTRPLSFSLWTTFASISAL
FT                   LIILFLIFGNYTRKTTMEGQILPASGVIRVYAPDTGTITAKFVEDGEKVKAGDKLFALS
FT                   TSRFGAGGSVQQQLKTEAVLKKTLAEQELGRLKLIHENETRSLKATVERLENQKLHISQ
FT                   QIDGQKRRIRLAEEMLRKYRFLSANDAVSKQEMMNVEAELLEQKAKLDAYRREEAGLLQ
FT                   EIRTQNLTLASLPKRHETEQSQLERTIADISQEVLDFEMRSEQIIRAGRSGYIAIPNVE
FT                   VGRQVDPSKLLLSIVPERTELYAHLYIPSSAAGFIKPKDKVVLRYQAYPYQKFGLASGS
FT                   VVSVAKTALGRQELSGLGMVSSDLAKSNEPVYLVKIKPDKPTITAYGEEKPLQIGMTLE
FT                   ADILHEKRRLYEWVLEPIYSMSGRL"
FT   gene            135846..136178
FT                   /locus_tag="NGO_0124"
FT   CDS_pept        135846..136178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88884"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAA3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014580085.1"
FT                   /protein_id="AAW88884.2"
FT                   /translation="MNEMTAVFGGTEGTWGHRGRVSGEWVGSKVGGALGSFAGAFTGMA
FT                   GGALVTGGNPAGIAIGGAGGGWVGAEGGSALGGHIGGFAGAKWGKMIDRRNCQCGEDCH
FT                   CDPCNC"
FT   gene            136192..136407
FT                   /locus_tag="NGO_0125"
FT   CDS_pept        136192..136407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88885"
FT                   /db_xref="GOA:Q5FAA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAA2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692579.1"
FT                   /protein_id="AAW88885.1"
FT                   /translation="MDFAHYLKHWKAAVLIYLAISILTDILCYFLNFDGVFYKGRFFSV
FT                   TVAGPVGALSFLAYLLYLKREENRSH"
FT   gene            136509..137276
FT                   /locus_tag="NGO_00680"
FT   CDS_pept        136509..137276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00680"
FT                   /product="peptidase C39"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00680"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63597"
FT                   /db_xref="GOA:A0A0H4J5C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5C0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003694777.1"
FT                   /protein_id="AKO63597.1"
FT                   /translation="MDYLQNLSLGLTKKLPVILQTEVAECGLACLAAVAGFYGFYTDLR
FT                   ALRSKYCLSLKGENLADIVRFADDMGLTGRALRLDLDELGSLRLPCILHWDLNHFVVLE
FT                   SVSSDGAAVMDPASGRRKVKTEEISRKFTGIALELWPNTRFEAGEEKQEIRILPMLRGI
FT                   SGLGRTLFQLLALAAAMEVFAFLQNVSFKIGRGESLALIGRSGCGKSTLLDILSGNLPP
FT                   ESGKVMINGHDIYSLPPRFIRNLSAMVRQDDVL"
FT   gene            137469..137750
FT                   /locus_tag="NGO_00685"
FT   CDS_pept        137469..137750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00685"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00685"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63598"
FT                   /db_xref="GOA:A0A0H4IVZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IVZ5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003696701.1"
FT                   /protein_id="AKO63598.1"
FT                   /translation="MIREEISAMPMGYETLIGDMGSALSGGQKQRIVLARALYCEPKIL
FT                   FLDEAASHLDIANEKAVNANLNGLSIIKIMAAHRKETVESADRKMSLG"
FT   gene            complement(137771..138997)
FT                   /locus_tag="NGO_0127"
FT   CDS_pept        complement(137771..138997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0127"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88886"
FT                   /db_xref="GOA:Q5FAA1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FAA1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003699499.1"
FT                   /protein_id="AAW88886.1"
FT                   /translation="MTFLQRWQGLADNKICAFAWFVIRRFSEERVPQAAASMTFTTLLA
FT                   LVPVLTVMVAVASIFPVFDRWSDSFVSFVNQTIVPQGADMVFDYIDAFRDQANRLTAIG
FT                   SVMLVVTSLMLIRTIDNAFNRIWRVNTQRPWMMQFLVYWALLTFGPLSLGVGISFMVGS
FT                   VQDSVLSSGAQQWADALKTAARLAFMTLLLWGLYRFVPNRFVPARQAFVGALITAFCLE
FT                   TARFLFTWYMGNFDGYRSIYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQGEAFR
FT                   RGFDSRGRFDDVLKILLLLDAAQKEGRTLSVQEFRRHINMGYDELGELLEKLARYGYIY
FT                   SGRQGWVLKTGADSIELSELFKLFVYRPLPVERDHVNQAVDAVMTPCLQTLNMTLAEFD
FT                   AQAKKQQQS"
FT   gene            complement(138994..139380)
FT                   /pseudo
FT                   /locus_tag="NGO_00695"
FT                   /note="hypothetical protein; disrupted"
FT   gene            139485..140159
FT                   /locus_tag="NGO_0129"
FT   CDS_pept        139485..140159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0129"
FT                   /product="7-cyano-7-deazaguanine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88888"
FT                   /db_xref="GOA:Q5FA99"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA99"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5FA99.1"
FT                   /protein_id="AAW88888.1"
FT                   /translation="MSNQKALVIFSGGQDSTTCLIQAIQTYGRENVQAITFRYGQRHAV
FT                   ELERAEWIAQDLGVSQTVLDLSLMRQITHNALMDETAAIETAAIETADNGVPNTFVDGR
FT                   NALFLLYAAIFAKGQGIRHIIAGVCETDFSGYPDCRGVFVKSMNVTLNLAMDYDFQIHT
FT                   PLMYLTKAQTWALADEMGVLDYIREQTHTCYKGIVGGCRECPSCILRERGLAECLESKK
FT                   AV"
FT   gene            140187..140702
FT                   /locus_tag="NGO_0130"
FT   CDS_pept        140187..140702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88889"
FT                   /db_xref="InterPro:IPR011440"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA98"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003698058.1"
FT                   /protein_id="AAW88889.1"
FT                   /translation="MPKLHMFYLGGNAGRSNIEVHDIQFAVCDDYREAVPALKAAWFGD
FT                   TDKIHIDGWQVVEWADGYDIAVSETPKTKMPPENAPRLYFANVGGYRAGQLAEAHAFGL
FT                   FAAATPAEAKQKALQTLLTDYVRQHKDNLKDVDNLLALEHIGNFHIRLTPNPHGKPAEI
FT                   GFQGYLPI"
FT   gene            140790..141212
FT                   /locus_tag="NGO_0131"
FT   CDS_pept        140790..141212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0131"
FT                   /product="6-carboxy-5,6,7,8-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88890"
FT                   /db_xref="GOA:Q5FA97"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA97"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217869.1"
FT                   /protein_id="AAW88890.1"
FT                   /translation="MKITKIFTFDSSHMLDGHDGKCQNLHGHTYKLEITVSDGIVRGGP
FT                   KDGMVMDFTDLKAIVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTA
FT                   ENMAVEMYCRLKNAGLNVCRVKLWETPTSCAEYEGE"
FT   gene            141478..141850
FT                   /pseudo
FT                   /locus_tag="NGO_00715"
FT                   /note="membrane protein; disrupted"
FT   gene            141847..142485
FT                   /locus_tag="NGO_00720"
FT   CDS_pept        141847..142485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00720"
FT                   /product="7-carboxy-7-deazaguanine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00720"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63599"
FT                   /db_xref="GOA:A0A0H4ISJ9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISJ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003777273.1"
FT                   /protein_id="AKO63599.1"
FT                   /translation="MKKISVAPENPQYRIVEIFESLQGEGWNTGMPAVFVRLGKCNLAC
FT                   GWCDTDYLTFGMMSLSDILGRLKTYAARNIIITGGEPTIQPHLDTLLDALKAEGYFLCL
FT                   ETNGLKPAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDAVGFCENMERKIRA
FT                   HHYYLSPCEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGIE"
FT   gene            complement(142821..142897)
FT                   /locus_tag="NGO_18796"
FT   tRNA            complement(142821..142897)
FT                   /locus_tag="NGO_18796"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:complement(142861..142863),aa:Pro,seq:cgg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(142978..144063)
FT                   /locus_tag="NGO_0135"
FT   CDS_pept        complement(142978..144063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0135"
FT                   /product="beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88893"
FT                   /db_xref="GOA:Q5FA94"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA94"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704507.1"
FT                   /protein_id="AAW88893.1"
FT                   /translation="MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAIGGIILFRRNFQN
FT                   IEQLKTLTAEIKALRTPELIIAVDHEGGRVQRFIEGFTRLPAMNVLGQIWDKDGASAAE
FT                   TAAGQVGRVLATELSACGIDLSFTPVLDLDWGNCAVIGNRSFHRNPEAVARLALALQKG
FT                   LAKGGMKSCGKHFPGHGFVEGDSHLVLPEDGRSLDELEAADLAPFRIMSREGMAAVMPA
FT                   HVVYPQVDTKPAGFSEIWLKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEA
FT                   GCDIVLVCNRPDLVDELRDGFTIPDNQDLAGRWQYMENSLGHEAVQAVMQTMGFQAAQA
FT                   FVAGLASPQDTAGGVKVGEAF"
FT   gene            complement(144120..145640)
FT                   /locus_tag="NGO_0136"
FT   CDS_pept        complement(144120..145640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88894"
FT                   /db_xref="GOA:Q5FA93"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA93"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010950999.1"
FT                   /protein_id="AAW88894.1"
FT                   /translation="MQLIDYSHSFFSVVPPFLALALAVITRRVLLSLGIGILVGVAFLV
FT                   GGNPVDGLTHLKDMVVGLAWADGDWSLGKPKILVFLILLGIFTSLLTYSGSNQAFADWA
FT                   KRHIKNRCGAKMLTACLVFVTFIDDYFHSLAVGAIARPVTDKFKVSRAKLAYILDSTAS
FT                   PMCVLMPVSSWGASIIATLAGLLVTYKITEYTPMGTFVAMSLMNYYALFALIMVFVVAW
FT                   FSFDIGSMARFEQAALNEAHDETAASDATKGRVYALIIPVLALIASTVSAMIYTGAQAS
FT                   ETFSILGAFENTDVNTSLVFGGTCGVLAVVLCTFGTIKTADYPKAVWQGAKSMFGAIAI
FT                   LILAWLISTVVGEMHTGDYLSTLVAGNIHPGFLPVILFLLASVMAFATGTSWGTFGIML
FT                   PIAAAMAVKVEPALIIPCMSAVMAGAVCGDHCSPISDTTILSSTGARCNHIDHVTSQLP
FT                   YALTVAAAAASGYLALGLTKSALLGFGTTGIVLAVLIFLLKDKKRADV"
FT   gene            145668..145817
FT                   /locus_tag="NGO_0137"
FT   CDS_pept        145668..145817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA92"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690597.1"
FT                   /protein_id="AAW88895.1"
FT                   /translation="MGGYLSASGLGFVGKMGGNIFCRKKYLFKINQLIFVKCPLIGIDG
FT                   HFII"
FT   gene            complement(145843..147342)
FT                   /locus_tag="NGO_0138"
FT   CDS_pept        complement(145843..147342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0138"
FT                   /product="protease Do"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88896"
FT                   /db_xref="GOA:Q5FA91"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA91"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002221414.1"
FT                   /protein_id="AAW88896.1"
FT                   /translation="MFKKYQYFALAALCAALLAGCEKAGSFFGADKKEASFVERIEHTK
FT                   DDGSVSMLLPDFAQLVQSEGPAVVNIQAAPAPRTQNGSGNAETDSDPLADSDPFYEFFK
FT                   RLVPNMPEIPQEEADDGGLNFGSGFIISKNGYILTNTHVVAGMGSIKVLLNDKREYTAK
FT                   LIGSDVQSDVALLKIDATEELPVVKIGNPKNLKPGEWVAAIGAPFGFDNSVTAGIVSAK
FT                   GRSLPNESYTPFIQTDVAINPGNSGGPLFNLKGQVVGINSQIYSRSGGFMGISFAIPID
FT                   VAMNVAEQLKNTGKVQRGQLGVIIQEVSYGLAQSFGLDKASGALIAKILPGSPAERAGL
FT                   QAGDIVLSLDGGEIRSSGDLPVMVGAITPGKEVSLGVWRKGEEITIKAKLGNAAEHTGA
FT                   SSKTDEAPYTEQQSGTFSVESAGITLQTHTDSSGKHLVVVRVSDAAERAGLRRGDEILA
FT                   VGQVPVNDEAGFRKAMDKAGKNVPLLVMRRGNTLFIALNLQ"
FT   gene            complement(147480..148109)
FT                   /locus_tag="NGO_0139"
FT   CDS_pept        complement(147480..148109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0139"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88897"
FT                   /db_xref="GOA:Q5FA90"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA90"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687424.1"
FT                   /protein_id="AAW88897.1"
FT                   /translation="MNRQIRQEIFERFRAANPHPTTELNFNSPFELLIAVLLSAQATDV
FT                   GVNKATAKLFPVADTPQAMLDLGLDGVMEYTKTIGLYKTKSKHIMQTCRIVLEKYNGQV
FT                   PEDREALESLPGVGRKTANVVLNTAFGHPVMAVDTHIFRVSNRTKIAPGKDVREVEDKL
FT                   MRFIPKEFLMDAHHWLILHGRYTCKALKPQCQTCIINDLCEYPAKS"
FT   gene            complement(148156..148692)
FT                   /locus_tag="NGO_0140"
FT   CDS_pept        complement(148156..148692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0140"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: pir||D81914 probable membrane
FT                   protein NMA0712 [imported] - Neisseria meningitidis (group
FT                   A strain Z2491) >gi|7379436|emb|CAB83998.1| (AL162754)
FT                   putative membrane protein [Neisseria meningitidis]; COG1238
FT                   Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88898"
FT                   /db_xref="GOA:Q5FA89"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA89"
FT                   /protein_id="AAW88898.1"
FT                   /translation="MPDKKGAYGCAVFLHRPPPFGGGVKIPYNPSPIFTCLGLFAMIPS
FT                   YTYAALAFSAFTSATLLPGTSEAAFALFVRNFPKHAYGALLCAGLANGLGSMVSYWMGR
FT                   LLPSRKMPSEKTLNLIRRFGIWLLAFAWLPVVGDALPLTAGWLRLNPWTSGLMLVIGKT
FT                   ARYAFILWGMQYYAA"
FT   gene            148719..148865
FT                   /locus_tag="NGO_0141"
FT   CDS_pept        148719..148865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88899"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA88"
FT                   /protein_id="AAW88899.1"
FT                   /translation="MPRCGISEFSGYGGGFSFYWERFLQARRNFLKSIKTYANNCKILI
FT                   SAA"
FT   gene            149005..150228
FT                   /locus_tag="NGO_0142"
FT   CDS_pept        149005..150228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0142"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88900"
FT                   /db_xref="GOA:Q5FA87"
FT                   /db_xref="InterPro:IPR005964"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA87"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019273139.1"
FT                   /protein_id="AAW88900.2"
FT                   /translation="MSAQSQNNHTSPLVVLTTLFFMMGFITCMNDILIPHLKEIFDLSY
FT                   VQAMLIQFCFFTAYAVMSIPMGAFVGKVGYKNGVIGGFLLTAVGCLLFYPAAGSHSYAV
FT                   FLGALFILASGVTLLQVAGNPYVTLLAKPGKESATLTLVQAFNALGTTIAPQIGAFLIL
FT                   ADATQTVSKAEQISSVQIPYLGLAGLLIILAVFVKMIRLPDARKIAAEESAHNHDGKTG
FT                   VWQYKHLVFGTAGIFCYVGAEVSIGSLMVNVLGYLKGLDHASAAHYLSFYWGGAMVGRF
FT                   LGSAVMAKFAPNRYLAFNASAAVVLLAVAMATGSGNADVAMWSLLAIGFFNSIMFPTIF
FT                   SLATKGLGKFTNAASGVLCTAIVGGAVVPVIQGWAADTYTLMSSFVVSVICYLYIVFFA
FT                   VYGYRADK"
FT   gene            150518..151897
FT                   /locus_tag="NGO_0143"
FT   CDS_pept        150518..151897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0143"
FT                   /product="sodium:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88901"
FT                   /db_xref="GOA:Q5FA86"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA86"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002252825.1"
FT                   /protein_id="AAW88901.1"
FT                   /translation="MFAFKSLLDMPRGEALAVVVALIAAMGYTIISLEWLPHMSIIAAI
FT                   VVLILYGLARGLKYNDMQAGMIGALNQGMGAVYLFFFIGLMVSALMMSGAIPTLMYYGF
FT                   GLISPTYFYFSAFALCSVIGVSIGSSLTACATVGVAFMGMAAAFQADMAMTAGAIVSGV
FT                   FFGDKMSPLSDTTGISASIVGIDLFEHIKNMMYTTIPAWLISAALMLWLLPSVAAQDLN
FT                   SVESFRSQLEATGLVHGYSLIPFALLVVLALMRVNAVVAMLFTVIAAVAVTYLHSTPDL
FT                   RQLGAWFYGGYKLEGEAFKDIAKLISRGGLESMFFTQTIVILGMSLGGLLFALGVIPSL
FT                   LEAVRTFLTNAGRATFSVAMTSVGVNFLIGEQYLSILLSGETFKPVYDKLGLHSCNLSR
FT                   TLEDAGTVINPLVPWSVCGVFISHALGVPVWEYLPYAFFCYLSLALTLLFGWTGLTLSK
FT                   K"
FT   gene            complement(152040..152864)
FT                   /locus_tag="NGO_0144"
FT   CDS_pept        complement(152040..152864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0144"
FT                   /product="cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88902"
FT                   /db_xref="GOA:Q5FA85"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA85"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002243328.1"
FT                   /protein_id="AAW88902.1"
FT                   /translation="MDGAQPKTNFFERLIARLAREPDSAEDVLNLLRQAHEQEVFDADT
FT                   LTRLEKVLDFAELEVRDAMITRSRMNVLKENDSIERITAYVIDTAHSRFPVIGEDKDEV
FT                   LGILHAKDLLKYMFNPEQFHLKSVLRPAVFVPEGKSLTALLKEFREQRNHMAIVIDEYG
FT                   GTSGLVTFEDIIEQIVGDIEDEFDEDESADNIHSVSAERWRIHAATEIEDINAFFGTEY
FT                   GSEEADTIGGLVIQELGHLPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK"
FT   gene            complement(152866..153381)
FT                   /locus_tag="NGO_0145"
FT   CDS_pept        complement(152866..153381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0145"
FT                   /product="rRNA maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88903"
FT                   /db_xref="GOA:Q5FA84"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA84"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9K0P7.1"
FT                   /protein_id="AAW88903.2"
FT                   /translation="MKRAKKYPFLTLQRQRFHLNFENASSAAGIPAERDFYRWAWSALK
FT                   NEYLRADIGLILLDEEEARAYNRDYRGKDYATNVLSFALNEGEILPCQVSERLYGDLII
FT                   CPQVVLKEAAEQGKTPERHFAHLTIHGTLHLMGYDHIKDDEAEIMEAEEIRLMRAAGYP
FT                   NPYREDGH"
FT   gene            153500..154435
FT                   /locus_tag="NGO_0146"
FT   CDS_pept        153500..154435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0146"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88904"
FT                   /db_xref="GOA:Q5FA83"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA83"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704497.1"
FT                   /protein_id="AAW88904.1"
FT                   /translation="MNPKKLVIASRESLLAMWQAKHIQGRLKALYPDCEVEILGMTTRG
FT                   DRILDRTLSKVGGKGLFVKELEQSLQDGRADLAVHSIKDVPMDLPEGFALAAISERANP
FT                   FDAFVSNRYARLEEMPEGAVVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGE
FT                   YDAIILAAAGLQRLELDERIRMILSESDSLPAAGQGALGIEIATHREDLYEVLKPLNHD
FT                   TTHACVTAERALARALGGSCQVPLAAYCTEENGLLILRGLVGHPDGSIVLQADAQAPAG
FT                   YADALGRAVAKKLADDGAQELIGAVLNTEN"
FT   gene            complement(154721..155005)
FT                   /locus_tag="NGO_00790"
FT   CDS_pept        complement(154721..155005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00790"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00790"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63600"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IUZ4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002257958.1"
FT                   /protein_id="AKO63600.1"
FT                   /translation="MPDGIVYADSPGSRGKLDAGGFTRCRINRSKEFADRRNHINGIGN
FT                   FWNQAKRALRKYNGIDRKPFPPLLRECEFRLNSGTPSRQLKILRDWCGI"
FT   gene            155779..156267
FT                   /locus_tag="NGO_00795"
FT   CDS_pept        155779..156267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00795"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63601"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRL6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012504151.1"
FT                   /protein_id="AKO63601.1"
FT                   /translation="MTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKARIRVKR
FT                   YRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNARFRRMG
FT                   ALRGTAEKLGHKVLPPAPYSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSYFDFN"
FT   gene            complement(156345..157430)
FT                   /locus_tag="NGO_0147"
FT   CDS_pept        complement(156345..157430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0147"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88905"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA82"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951001.1"
FT                   /protein_id="AAW88905.1"
FT                   /translation="MEMLEEAGFADAVRTGPGFQLKNGAAFSWGSRYTEFDFTDKFSDG
FT                   PGTVYQVRRAVFDKILIEEAAKQGVEVRFGHGVTAFDNSGDFARLNIETDTGESYELTA
FT                   KFVLDASGYGRVLPRLLNLETPSHLPPRQTHFTHIDDNITHPKFDRNKILITTHPQHRD
FT                   VWIWLIPFGDNRCSVGVVGTPDKLAGESETVLKKFVYECPMLSEILDKAVWENDFPFRS
FT                   IQGYSANVKSLHGRHFALLGNAAEFLDPVFSSGVTIALHSAELAADLLTKQLKGEAADW
FT                   QTEFAEPLMIGVDAFRTYVDGWYDFRFQNVVYAPDRSPEISRMLSSILAGYAWDTENPF
FT                   VAKSEQRLTALSEWVGQLESE"
FT   gene            complement(157367..157582)
FT                   /locus_tag="NGO_0148"
FT   CDS_pept        complement(157367..157582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88906"
FT                   /db_xref="GOA:Q5FA81"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA81"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951002.1"
FT                   /protein_id="AAW88906.1"
FT                   /translation="MPTQFDVAVIGAGPAGSAASALLRKKGYQVCVLENSTFRASSSAK
FT                   ACCRTVWKCWKKPVLPMPFAPGPAFS"
FT   gene            complement(157762..159135)
FT                   /locus_tag="NGO_0149"
FT   CDS_pept        complement(157762..159135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0149"
FT                   /product="RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88907"
FT                   /db_xref="GOA:Q5FA80"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA80"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002238938.1"
FT                   /protein_id="AAW88907.1"
FT                   /translation="MSNPFSSLGLGTELVSALTAQGYENPTPIQAAAIPKALAGHDLLA
FT                   AAQTGTGKTAAFMLPSLERLKRYATASTSPAMHPVRMLVLTPTRELADQIDQNVQGYIK
FT                   NLPLRHTVLFGGVNMDKQTADLRAGCEIVVATVGRLLDHVKQKNISLNKAEIVVLDEAD
FT                   RMLDMGFIDDIRKIMQMLPRQRQTLLFSATFSAPIRKLAQDFMNAPETVEVAAQNTTNA
FT                   NVEQHIIAVDTFQKRNLLERLIVDLHMNQVIVFCKTKQSVDRVTRELVRRNLSAQAIHG
FT                   DRSQQSRLETLNAFKDGSLRVLVATDIAARGLDIAELPFVINYEMPAQPEDYIHRIGRT
FT                   GRAGADGVAISLMDESEQKMFEAIKELTGNKLLIERIEGFEPRWWEQEGSKPEKTETSE
FT                   PRQRNRYESARAQREKNTRPETTANDAGAACGKIAGRSRRSRRGHRTCALLQPRYGVK"
FT   gene            complement(159159..159347)
FT                   /locus_tag="NGO_0150"
FT   CDS_pept        complement(159159..159347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA79"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687440.1"
FT                   /protein_id="AAW88908.1"
FT                   /translation="MGPRFKKVRHCTFFKQDFQSADAPAIGAGTVLWHNPHTNSRPRRS
FT                   QAGSLFPRPIGFPLQTA"
FT   gene            159349..160353
FT                   /locus_tag="NGO_0151"
FT   CDS_pept        159349..160353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0151"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88909"
FT                   /db_xref="GOA:Q5FA78"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA78"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017915088.1"
FT                   /protein_id="AAW88909.1"
FT                   /translation="MHIGGYFIDNPIALAPMAGIADKPFRRLCRAFGAGWAVCEMLASD
FT                   PTLRNTGKTLHRSDFADEGGIVAVQIAGSDPEQMADAARYNVGLGAQVIDINMGCPAKK
FT                   VCNVQAGSALMQDEPLVAAILEAVVKAAGVPVTLKTRLGWHDDHQNLPAIAKIAEDCGI
FT                   AALAVHGRARTQMYKGEARYELIAETKSRLNIPAWVNGDITSPQKAAAVLKQTAADGIM
FT                   IGRGAQGRPWFFRDLKHYAEHGVLPPALSLAECRAAILNHIRAMHAFYGETVGVRIARK
FT                   HIGWYIGEMPDGEQARREINRLDNAAAQYDTLAGYLERLAGKTDRWACGYREG"
FT   gene            160452..160781
FT                   /locus_tag="NGO_0152"
FT   CDS_pept        160452..160781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0152"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: gb|AAF41781.1| (AE002491)
FT                   factor-for-inversion stimulation protein Fis, putative
FT                   [Neisseria meningitidis MC58] >gi|7380274|emb|CAB84860.1|
FT                   (AL162756) factor-for-inversion-stimulation protein
FT                   [Neisseria meningitidis]"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88910"
FT                   /db_xref="GOA:Q5FA77"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA77"
FT                   /protein_id="AAW88910.1"
FT                   /translation="MPSENEWNGFRQKAFRRHSVLKTFQSKGYAMNPATADIAQCIEQN
FT                   LNQYFKDLNGTEPCGVYDMVLHQVEKPLLVCVMEQCGGNQSKASVMLGLNRNTLRKKLI
FT                   QHGLL"
FT   gene            160784..161320
FT                   /locus_tag="NGO_0153"
FT   CDS_pept        160784..161320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0153"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88911"
FT                   /db_xref="GOA:Q5FA76"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA76"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003711289.1"
FT                   /protein_id="AAW88911.2"
FT                   /translation="MSATVRILGIDPGSRVTGFGIIDVRGRDHFYVASGCIKTPADEPL
FT                   ADRIAVIVRHIGEVVAVYKPQQAAVEQVFVNVNPASTLMLGQARGAALAALVSHKLPVS
FT                   EYTALQVKQAVVGKGKAAKEQVQHMVVQMLGLSGTPQADAADGLAVALTHALRNHGLAA
FT                   KLNPSGMQVKRGRFQ"
FT   gene            161359..162240
FT                   /locus_tag="NGO_0154"
FT   CDS_pept        161359..162240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0154"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="Acylates the intermediate (KDO)2-lipid IVA to form
FT                   (KDO)2-(lauroyl)-lipid IVA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88912"
FT                   /db_xref="GOA:Q5FA75"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA75"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704869.1"
FT                   /protein_id="AAW88912.2"
FT                   /translation="MCTEMKFIFFVLYVLQFLPFALLHKIAGLIGSLAYLLVKPRRRIG
FT                   EINLAKCFPEWDEEKRKTVLKQHFKHMAKLMLEYGLYWYASAKCLKSLVRYRNKHYLDD
FT                   ALAAGEKVIILYPHFTAFEMAVYALNQDVPLISMYSHQKNKILDEQILKGRNRYHNVFL
FT                   IGRTEGLRALVKQFRKSSAPFLYLPDQDFGRNNSVFVDFFGIQTATITGLSRIAALANA
FT                   KVIPAIPVREADNTVTLQFYPAWKSFPSEDAQADAQRMNRFIEERVREHPEQYFWLHKR
FT                   FKTRPEGSPDFY"
FT   gene            162894..163028
FT                   /locus_tag="NGO_0155"
FT   CDS_pept        162894..163028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0155"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: emb|CAB84857.1| (AL162756)
FT                   hypothetical DNA-binding protein [Neisseria meningitidis]"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88913"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA74"
FT                   /protein_id="AAW88913.1"
FT                   /translation="MPSERIFRSVLRLVGVSSDTVKRKFAGAGLSYAGKAAGESLYCL"
FT   gene            163144..163938
FT                   /locus_tag="NGO_0156"
FT   CDS_pept        163144..163938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0156"
FT                   /product="3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88914"
FT                   /db_xref="GOA:Q5FA73"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA73"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002252744.1"
FT                   /protein_id="AAW88914.1"
FT                   /translation="MNTILAFDIETVPDVQGIRTLYDLPSSLPDDEVVLFAQQKRRAQT
FT                   GGDFMQHHLHQVVAVSCCMRWGQDKVHVGTIGEMDDGEEVVIAKFFELVEKHTPQLVSW
FT                   NGGGFDLPVLHYRSLIYGINAARYWDTGDGDFGDSRDFKWNNYISRYHQRHCDLMDLLA
FT                   LYQPRANVPLDDMAKLCGFPGKLGMDGSKVWEAFHAGRLKEIRNYCETDAVNTYLMYLR
FT                   FCLVSGRFDADEYEMEIKRIRNYLSAQTEDKPHWAEFVQAWK"
FT   gene            164163..166766
FT                   /gene="pepN"
FT                   /locus_tag="NGO_0158"
FT   CDS_pept        164163..166766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="NGO_0158"
FT                   /product="aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88915"
FT                   /db_xref="GOA:Q5FA72"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA72"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359779.1"
FT                   /protein_id="AAW88915.1"
FT                   /translation="MSKTVRYLKDYQTPAYRILETELHFDIAEPQTVVKSRLTVEPQRA
FT                   GEPLVLDGSAKLLSVKINGAAADYVLEGETLTIADVPSERFTVEVETEILPAENKSLMG
FT                   LYASGGNLFTQCEPEGFRKITFYIDRPDVMSKFTTTIVADKKRYPVLLSNGNKIDGGEF
FT                   SDGRHWVKWEDPFAKPSYLFALVAGDLAVTEDRFTTMSGRNVKIEFYTTEADKPKVGFA
FT                   VESLKNAMKWDETRFGLEYDLDIFMVVAVGDFNMGAMENKGLNIFNTKFVLADSRTATD
FT                   TDFEGIESVVGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSGDRAGRAVRRIEN
FT                   IRLLRQNQFPEDAGPTAHPVRPVSYEEMNNFYTMTVYEKGAEVVRMYHTLLGEEGFQKG
FT                   MKLYFQRHDGQAVTCDDFRAAMADANGINLDQFALWYSQAGTPVLEAEGRLKNNVFELT
FT                   IKQTVPPTPDMADKQPMMIPVKVGLLNRNGEAVAFDYQGKRATEAVLLMTEAEQAFPLE
FT                   GVTEAVVPSLLRGFSAPVYLNYPYSDDDLLLLLAHDSDAFTCWEAAQTLYRRAVAANLA
FT                   ALSDGIGLPKHEKLLAAVEKVISDDLLDNAFKALLLGVPSEAELWDGTENIDPLRYHQA
FT                   REALLDTLAVRFLPKWHELDRQAAKQENQSYEYSPETADWRTLRNVCRAFVLRADPAHI
FT                   ETVAEKYGEMAQNMTHEWGILSAVNGNESDTRNCLLAQFADKFSDDALVMDKYFALIGS
FT                   SRRSDTLQQVQTALQHPKFSLENPNKARSLIGSFSRNVPHFHAQDGSGYRFIADKVIEI
FT                   DRFNPQVAARLVQAFNLCNKLEPHRKNLVKQELQCIRAQEGLSKDVGEIVGKILG"
FT   gene            166828..167480
FT                   /pseudo
FT                   /locus_tag="NGO_00855"
FT                   /note="transposase; disrupted"
FT   gene            complement(167614..167805)
FT                   /locus_tag="NGO_0160"
FT   CDS_pept        complement(167614..167805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88916"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA71"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581138.1"
FT                   /protein_id="AAW88916.1"
FT                   /translation="MLPTRSVSSLLLGEYLEFEENGTKITAEIGSAWHFLGAACRISIN
FT                   GKYYAGNRIVWFAKKAES"
FT   gene            complement(167838..168305)
FT                   /locus_tag="NGO_0161"
FT   CDS_pept        complement(167838..168305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88917"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA70"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221508.1"
FT                   /protein_id="AAW88917.1"
FT                   /translation="MQINNISDEQVMIVKMSCYLKKDEIFKNIERYGYQSSDIKKINPP
FT                   FPLNILPVPKPYYFYLYDTHLNQIYDLAWSCNDFLMFEIFILDRESIKYIDKDKLFKSG
FT                   ETLYSNFKSIKNQCKNYFFCGFDFDAPYFKSGVSQVADYNFVPDAFSLFFI"
FT   gene            complement(168362..168538)
FT                   /locus_tag="NGO_00870"
FT   CDS_pept        complement(168362..168538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_00870"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5C4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002213901.1"
FT                   /protein_id="AKO63602.1"
FT                   /translation="MGEYLEFEESGTKITVEIGSAWHFNETIRNINTHLRGTKLPGSNW
FT                   RVQDKGHFHLWKR"
FT   gene            complement(168545..168700)
FT                   /pseudo
FT                   /locus_tag="NGO_00875"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(168745..169122)
FT                   /locus_tag="NGO_0163"
FT   CDS_pept        complement(168745..169122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA68"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690617.1"
FT                   /protein_id="AAW88919.1"
FT                   /translation="MSFGYLIATSQPCELLTKSRGETFSLIMDKMDLWIYFRFCEGNIY
FT                   TIRKNETESCLTERGGEWLKHIYEFNRESFIFSDVLLQKGESEENFSEIVLKSIKNNKI
FT                   LTVEVRSGLHFDLRNIYRIEM"
FT   gene            complement(169180..169545)
FT                   /locus_tag="NGO_0164"
FT   CDS_pept        complement(169180..169545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88920"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA67"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002227446.1"
FT                   /protein_id="AAW88920.1"
FT                   /translation="MEKPLLTPPFFLFEDVSLDIFQGLSELEKKIEPQDLMDDVYRAFD
FT                   SVGNILNFRIVEKEQKGFWVSTKIKTVVFDSADMPSDDLFLKCLQSSYKAYSETEPAGL
FT                   DKRQLMKTLIQKCGFSC"
FT   gene            complement(169527..170066)
FT                   /locus_tag="NGO_0165"
FT   CDS_pept        complement(169527..170066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0165"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88921"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA66"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687462.1"
FT                   /protein_id="AAW88921.1"
FT                   /translation="MKKQITAAVMMLSMIAPAMANGLDNQAFEDQVFHTRADAPMQLAE
FT                   LSQKEMKETEGAFLPLAILGGAAIGMWTQHGFSYATTGRPASVRDVAGGLGAIPGDVGA
FT                   AGKVVSFAKYGREIKIGNNMRIAPFGNRTGHPIGKFPHYHRRVTDNTGKTLPGQGIGRH
FT                   RPWESKSTDRSWKNRF"
FT   gene            complement(170109..170975)
FT                   /locus_tag="NGO_0166"
FT   CDS_pept        complement(170109..170975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0166"
FT                   /product="meta-pathway of phenol degradation family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88922"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA65"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003696729.1"
FT                   /protein_id="AAW88922.1"
FT                   /translation="MKNILLVFVSFVPLCVRTDLPLNIEDIMTDKGKWKLETSLTYLNS
FT                   ENSRAALASPVYIQTGSASFIPVPTEIQENGSNTDMLAGTLGLRYGLTGNTDIYGSGSY
FT                   LWHEERKLDGNGKTRNKRMSDISAGISHTFLKDGKNPALIAFLESTVYEKSRNKASSGK
FT                   SWLIGATTYKAIDPIVLSLTAAYRINGSKTLSDDVKYKAGNYWMLNPNISFAANDRISL
FT                   TGGIQWLGKQPDRIDGKKESARNTSTYAHFGAGFGFTKTAALNASARFNVSGQSSSELK
FT                   LGVQHTF"
FT   gene            171011..171226
FT                   /locus_tag="NGO_0167"
FT   CDS_pept        171011..171226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88923"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA64"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690618.1"
FT                   /protein_id="AAW88923.1"
FT                   /translation="MLMKFHVICLNNIFNDIFNTDCFFLINICLLLYCTREGRLKTSYL
FT                   IFRRPFAFSNSNQSNGFIASSRWSRL"
FT   gene            complement(171195..172121)
FT                   /locus_tag="NGO_0168"
FT   CDS_pept        complement(171195..172121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0168"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88924"
FT                   /db_xref="GOA:Q5FA63"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA63"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003696733.1"
FT                   /protein_id="AAW88924.1"
FT                   /translation="MKHLKLTLIAALLATAATAAPLPVVTSFSILGDVAKQIGGERVAV
FT                   QSLVGANQDTHAYHMTSGDIKKIRSAKLVLLNGLGLEAADIQRAVEQSKVSYAEATKGI
FT                   QPLKAEEEGGHHHDHHHDHDHDHEGHHHDHGEYDPHVWNDPVLMSDYAQNVAETLIKAD
FT                   PEGKVYYQQRLGNYQMQLKKLHSDAQAAFNAVPAAKRKVLTGHDAFSYMGNRYNISFIA
FT                   PQGVSSEAEPSAKQVAAIIRQIKREGIKAVFTENIKDTRMVDRIAKETGVNVSGKLYSD
FT                   ALGNAPADTYIGMYRHNVKALTNAMKQ"
FT   gene            complement(172198..173073)
FT                   /locus_tag="NGO_0169"
FT   CDS_pept        complement(172198..173073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0169"
FT                   /product="zinc ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88925"
FT                   /db_xref="GOA:Q5FA62"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA62"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013449372.1"
FT                   /protein_id="AAW88925.2"
FT                   /translation="MNLYDLLLAPFAEFDFMHYALASVFCLSLSAAPVGVFLVMRRMSL
FT                   IGDALSHAVLPGAAVGYMFAGLSLPAMGVGGFAAGMLMALLAGLVSRFTTLKEDANFAA
FT                   FYLSSLAIGVILISKNGSSVDLLHLLFGSVLAVDIPALQLIAAVSGLTLITLAVIYRPL
FT                   VLESIDPLFLKSVNGKGGLWHVIFLILVVMNLVSGFQALGILMSVGLMMLPAITARLWA
FT                   RNMGTLILLSVLIALFCGLIGLLISYHIEIPSGPAIILCCSVLYLFSVILGKEGGILPK
FT                   WFKNHRHHTT"
FT   gene            complement(173108..173863)
FT                   /locus_tag="NGO_0170"
FT   CDS_pept        complement(173108..173863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0170"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88926"
FT                   /db_xref="GOA:Q5FA61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA61"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692614.1"
FT                   /protein_id="AAW88926.1"
FT                   /translation="MGCLPLGGIGMSIIVENLTVSYRRRPAVHHVDITFEEHSMWAVFG
FT                   PNGAGKSTFLKSLMGLQPIDTGSIRLDGLTRQNIAYLPQQSDIDRSQPMTVFDLAAMGL
FT                   WYEIGFFKGINTAQKQRVHEALERVGMRQFARRQIAHLSNGQFQRVLFARMLVQNAKFL
FT                   LLDEPFNAVDARTTYELLDVLQKCHCGGHAIIAVLHDYEQVRAYFPNTLLLAREKIAAG
FT                   ATETILTESYLAQASAKMQQQESPDWCAS"
FT   gene            complement(174154..174519)
FT                   /locus_tag="NGO_0171"
FT   CDS_pept        complement(174154..174519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0171"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88927"
FT                   /db_xref="GOA:Q5FA60"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA60"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003679470.1"
FT                   /protein_id="AAW88927.1"
FT                   /translation="MNLIQQLEQEEIARLNKEIPEFAPGDTVVVSVRVVEGTRSRLQAY
FT                   EGVVIARRNRGLNSNFIVRKISSGEGVERTFQLYSPTVEKIEVKRRGDVRRAKLYYLRG
FT                   LTGKAARIKEKLPARKG"
FT   gene            complement(174534..175283)
FT                   /locus_tag="NGO_0172"
FT   CDS_pept        complement(174534..175283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0172"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88928"
FT                   /db_xref="GOA:Q5FA59"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA59"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9K0K4.1"
FT                   /protein_id="AAW88928.1"
FT                   /translation="MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNR
FT                   LGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQTAKVIYLSPQGKPLTHQKAAELAE
FT                   LTHLILLCGRYEGIDERLLQSSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGILGDI
FT                   QSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPD
FT                   LLEKRVLIPKESRLLNKILQEQREIQS"
FT   gene            complement(175283..175792)
FT                   /locus_tag="NGO_0173"
FT   CDS_pept        complement(175283..175792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0173"
FT                   /product="ribosome maturation factor RimM"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88929"
FT                   /db_xref="GOA:Q5FA58"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA58"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003753933.1"
FT                   /protein_id="AAW88929.1"
FT                   /translation="MTDTQNRVAMGYIKGVFGIKGWLKIAANTEYSDSLLDYPEWHLAK
FT                   DGKTVSVTLEAGKVVNGELQVKFEGIDDRDSAFSLRGYTIEIPREAFAPTEEDEYYWAD
FT                   LVGMTVVNKDDTVLGKVSNLMETGANDVLMIDGEHGQILIPFVSQYIETVDTGSKTITA
FT                   DWGLDY"
FT   gene            complement(175808..176053)
FT                   /gene="rpsP"
FT                   /locus_tag="NGO_0174"
FT   CDS_pept        complement(175808..176053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="NGO_0174"
FT                   /product="30S ribosomal protein S16"
FT                   /note="binds to lower part of 30S body where it stabilizes
FT                   two domains; required for efficient assembly of 30S; in
FT                   Escherichia coli this protein has nuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88930"
FT                   /db_xref="GOA:Q5FA57"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA57"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5FA57.1"
FT                   /protein_id="AAW88930.1"
FT                   /translation="MVVIRLARGGSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVANE
FT                   KQERVRLNADRLNHWIAQGAQVSDSVAKLIKEQKAV"
FT   gene            complement(176098..178521)
FT                   /pseudo
FT                   /locus_tag="NGO_00940"
FT                   /note="CoA-binding protein; disrupted"
FT   gene            complement(178639..180045)
FT                   /locus_tag="NGO_0176"
FT   CDS_pept        complement(178639..180045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0176"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88931"
FT                   /db_xref="GOA:Q5FA56"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA56"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217805.1"
FT                   /protein_id="AAW88931.1"
FT                   /translation="MKLFQRIFATFCAVIVCAIFVASFSFWLVQNTLAENQFNQRRTIE
FT                   TTLMGSIISAFKTRGDNGAREILTEWKNSPVSSAVYVIQGDEKKDILNRYIDNYTIERA
FT                   RLFAANNPHSNLVRIEYDRFGEEYLFFIKGWDNHQAQRLPSPLFIPGLPLAPIWHEFII
FT                   LSFIIIVGLLMAYILAGNIAKPIRILGNGMDRVANGELETRISQQVDDRDDELSHLAIQ
FT                   FDKMAEKLEKLVAKERYLLHHVSHEMRSPLARMQAIVGLIQAQPQKREQYLKRLEGELT
FT                   RMDTLAGELLTLSRLETSNMALEKESLKLLPFLGNLVEDNQSIAQKNGQTVALSADGKI
FT                   PENTTILANESYLYRAFDNVIRNAVNYSPEGSTILINIGQDHKHWIIDVTDNGPGVDEM
FT                   QLPHIFTAFYRADSSANKPGTGLGLALTQHIIEQHCGKIIAENIKPNGLRMRFILPKKK
FT                   TGFKTEKSAN"
FT   gene            complement(180058..180735)
FT                   /locus_tag="NGO_0177"
FT   CDS_pept        complement(180058..180735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0177"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88932"
FT                   /db_xref="GOA:Q5FA55"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA55"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003684348.1"
FT                   /protein_id="AAW88932.1"
FT                   /translation="MSRVLLVDDDALLTELLTEYLSAEGLNVRSVPDGEAGVQEILSGQ
FT                   YDVVVLDSMMPKMNGLDVLKNVRARSTVPIIMLTAKGDDIDRIIGLEMGADDYVPKPCT
FT                   PRELLARINAILRRAQHSGEQNNAPNSISVSDVVLYPAKRQASVKDMPLELTSTEFNLL
FT                   EVLMRHAGQVVSKETLSVEALDRKLAKFDRSIDVHISSIRHKLGDASLIQTVRGLGYLF
FT                   VKN"
FT   gene            complement(180925..182739)
FT                   /locus_tag="NGO_0178"
FT   CDS_pept        complement(180925..182739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0178"
FT                   /product="polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88933"
FT                   /db_xref="GOA:Q5FA54"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA54"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014580090.1"
FT                   /protein_id="AAW88933.1"
FT                   /translation="MSAETTVSGARPAAKLPIYILPCFLWIGIIPFTFALRLKPSPDFY
FT                   HDAAAAAGLIVLLFLTAGKKLFDVKIPAISFLLFAMAAFWWLQARLMNLIYPGMNDIAS
FT                   WVFILLAVSAWACKSLVAHYGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWENTPLLQN
FT                   IIVHRGQGVIGHIGQRNNLGHYLMWGILASAYLNGQRKIPAALGAICLIMQTAVLGLVN
FT                   SRTILTYIAAIALILPFWYFRSDKSNRRTMLGIAAAVFLTALFQFSMNAILETFTGIRY
FT                   ETAVERVANGGFTDLPRQSEWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQHTIHDNF
FT                   LSTLFTHSHNIILQLLAEMGISGTLLVAATLLTGIAGLLKRSLTPASLFLLCALAVSMC
FT                   HSMLEYPLWYVYFLIPFGLMLFLSPAEASDGIAFKKAANLGILTASAAIFAGLLHLDWT
FT                   YTRLVNSFSPAADDSAKTLNRKINELRYISANSPMLSFYADFSLVNFALPEYPETQTWA
FT                   EEATLKALKYRPYSATYRIALYLMRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPV
FT                   WAPLLPELLKDCKAFAAAPGHPETKPCK"
FT   gene            complement(182729..183082)
FT                   /locus_tag="NGO_0179"
FT   CDS_pept        complement(182729..183082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0179"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88934"
FT                   /db_xref="GOA:Q5FA53"
FT                   /db_xref="InterPro:IPR018643"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA53"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687481.1"
FT                   /protein_id="AAW88934.1"
FT                   /translation="MNRQTAYFLASFSLIALIALSLSWELWIAPLRPGGSWLALKALPL
FT                   CLPLSGILKKKIYTYQYSSMLVLIYFAEAVMRLFNAYPAEKICAALSAVFSIIFFISCL
FT                   SFVKQYKETNNVR"
FT   gene            complement(183091..183699)
FT                   /locus_tag="NGO_0180"
FT   CDS_pept        complement(183091..183699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0180"
FT                   /product="septum formation inhibitor Maf"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88935"
FT                   /db_xref="GOA:Q5FA52"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA52"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017629214.1"
FT                   /protein_id="AAW88935.2"
FT                   /translation="MNTLYLGSGSPRRMEILTQLGYRVVKLPAGIDETVKAGETPAPYV
FT                   QRMAEEKNQAALTLFCETNGAMPDFPLITADTCVFSDGIILGKPRSQAEAIEFLNRLSG
FT                   KQHTVLTAVCIHYRGKTSSRVQTNRVVFKPLSSEEISAYVQSGEPMEKAGAYAVQGIGG
FT                   IFIQSIEGSFSGIMGLPVYETVSMLQDLGYRPPLSALKP"
FT   gene            complement(183743..184513)
FT                   /locus_tag="NGO_0181"
FT   CDS_pept        complement(183743..184513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0181"
FT                   /product="twin-arginine protein translocation system
FT                   subunit TatC"
FT                   /note="with TatABE forms the twin-arginine translocation
FT                   complex which is involved in the transport of proteins
FT                   across the cytoplasmic membrane"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88936"
FT                   /db_xref="GOA:Q5FA51"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA51"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002246027.1"
FT                   /protein_id="AAW88936.1"
FT                   /translation="MSETQNEQTVQPLVEHLIELRRRLMWMVVGILVCFFGMMPFAQQL
FT                   YTFIADPLMANLPKDTSMIATDVIAPFFVPVKVTLMAAFLVSLPHTLYQIWAFVAPALY
FT                   QNEKRLITPLVLSSVSLFFIGMAFAYFLVFPVIFKFLAGVTPVGVNMATDIDKYLSFIL
FT                   GMFVAFGTAFEVPIVVILLTKIGAVTTEQLKHARPYVIVGAFVVAAVITPPDIISQTLL
FT                   AIPLILLYEAGIWFGRFFTPRSEQDGDIQPPAKT"
FT   gene            complement(184526..185212)
FT                   /locus_tag="NGO_0182"
FT   CDS_pept        complement(184526..185212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0182"
FT                   /product="preprotein translocase subunit TatB"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88937"
FT                   /db_xref="GOA:Q5FA50"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA50"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9K0J6.1"
FT                   /protein_id="AAW88937.1"
FT                   /translation="MFDFGLGELIFVGIIALIVLGPERLPEAARTAGRLIGRLQRFVGS
FT                   VKQELDTQIELEELRKVKQAFEAAAAQVRDSLKETDTDMQNSLHDISDGLKPWEKLPEQ
FT                   RTPADFGVDENGNPLPDTANTVSDGISDVMPSERSDTSAETLGDDRQTGSTAEPAETDK
FT                   DRAWREYLTASAAAPVVQAVEVSYIDTAVETPVPHTTSLRKQAINRKRDFRPKHRAKPK
FT                   LRVRKS"
FT   gene            complement(185216..185419)
FT                   /locus_tag="NGO_0183"
FT   CDS_pept        complement(185216..185419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0183"
FT                   /product="preprotein translocase subunit TatA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88938"
FT                   /db_xref="GOA:Q5FA49"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA49"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219659.1"
FT                   /protein_id="AAW88938.1"
FT                   /translation="MGSFSLTHWIIVLIIVVLIFGTKKLRNVGKDLGGAVHDFKQGLNE
FT                   GTDGKEAQKDDVIEHKKDEDKA"
FT   gene            complement(185466..185789)
FT                   /locus_tag="NGO_0184"
FT   CDS_pept        complement(185466..185789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0184"
FT                   /product="HIT family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88939"
FT                   /db_xref="GOA:Q5FA48"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA48"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:O07817.1"
FT                   /protein_id="AAW88939.1"
FT                   /translation="MDNCIFCKIAAKEIPAQTVYEDGEMVCFKDINPAAPLHLLLIPKV
FT                   HFDSLAHAAPEHQPLLGKMMLKVPEIAKASGLTDGFKTLINTGKGGGQEVFHLHIHIMG
FT                   TPV"
FT   gene            complement(185863..186186)
FT                   /locus_tag="NGO_0185"
FT   CDS_pept        complement(185863..186186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0185"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88940"
FT                   /db_xref="GOA:Q5FA47"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA47"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019273071.1"
FT                   /protein_id="AAW88940.1"
FT                   /translation="MGDSVLSAIQQTIIQRKSADPSESYVAQLLHKGEDKILKKVIEEA
FT                   GEVLMASKDKDPSHLVYEVADLWFHTMILLTHHDLKAEDVLDELSRRQGLSGLAEKAAR
FT                   TES"
FT   gene            complement(186327..187391)
FT                   /locus_tag="NGO_0186"
FT   CDS_pept        complement(186327..187391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0186"
FT                   /product="butanediol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88941"
FT                   /db_xref="GOA:Q5FA46"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA46"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017201092.1"
FT                   /protein_id="AAW88941.1"
FT                   /translation="MKAARFYNKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFM
FT                   EGPIFIPPCGHPHPISGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIIRDDV
FT                   PTGEGSNYHLSKDMNFIGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGH
FT                   HAYVRSGAKAGDVALVGGAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYI
FT                   LDPSEVDVVEEVKKLTNGEGVDVAFECTSVNKVLDTLVEACKPAANLVIVSIWSHPATV
FT                   NVHSVVMKELDVRGTIAYCNDHAETIKLVEEGKINLEPFITQRIKLDKLVSEGFERLIH
FT                   NNESAVKIIVNPNL"
FT   gene            complement(187663..188112)
FT                   /locus_tag="NGO_01000"
FT   CDS_pept        complement(187663..188112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01000"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01000"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63603"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IVY6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147004.1"
FT                   /protein_id="AKO63603.1"
FT                   /translation="MSTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTRY
FT                   LRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDEPGIPGCSTL
FT                   CRYRKFRYARAAYFGLLKVGAQSHLKAMCLNLLKAANRLSAPAAA"
FT   gene            complement(188256..189374)
FT                   /locus_tag="NGO_0187"
FT   CDS_pept        complement(188256..189374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0187"
FT                   /product="deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88942"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA45"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687493.1"
FT                   /protein_id="AAW88942.1"
FT                   /translation="MPLTRLFLKLYALLRLFLGKNAQTAWIFHPACTGHDPGANHPDSP
FT                   DRILCIEQALRRAGIWQHLQTVEAEEISDTRLALVRSSKYLNRLESCLPEDGKICRLDD
FT                   DTVISKNSLSAARFSAGSAVQAVDMVMKRKAWHAFCAARPPEHHAKSGKAGGFCLLNNV
FT                   AAGVMHAIAEYRLKRIAVIDFDVHYGDGTAEIFKDDPRILFFNLFETDLFPFPENNGMP
FT                   DGGNMVHLPLPSGTGSRTFREAVRRQWLPRLAAFKPELVLLSAGFDAHRLDESGRLNLH
FT                   EADFAWLTHKIIQTASSCPGKIVSVLEGGYTLEPLAQSAAEHIRVLAGLGKSDAATAYQ
FT                   KTLNPTKKPFAKPKTGQVRQPTQSDRYDINAV"
FT   gene            189505..189771
FT                   /locus_tag="NGO_0188"
FT   CDS_pept        189505..189771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0188"
FT                   /product="preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88943"
FT                   /db_xref="GOA:Q5FA44"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA44"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687494.1"
FT                   /protein_id="AAW88943.1"
FT                   /translation="MNQAVAQFAPLVLIMVVFYFLIMRPQQKKFKAHQAMLAALKAGDK
FT                   VVLAAGFKGKVTRVGEQFFTVDIGQGTKIEVEVERNAIAAKVD"
FT   gene            189982..191835
FT                   /locus_tag="NGO_0189"
FT   CDS_pept        189982..191835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0189"
FT                   /product="preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88944"
FT                   /db_xref="GOA:Q5FA43"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA43"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214287.1"
FT                   /protein_id="AAW88944.2"
FT                   /translation="MNRYPLWKYLLIVFTIAVAAVYSLPNLFGETPAVQVSTNRQAIII
FT                   NEQTQSKVDAALKNAGIQTDGMFVVDNSLKVRFKDTETQLKARDVIENTLGEGYITALN
FT                   LLADSPEWMAKIKANPMFLGLDLRGGVHFTMQVDMKAAMQKTFERYSGDIRRELRREKI
FT                   RSGTVRQAENSLTVPLQDAGDVQKALPQLLKLFPEATLNSEGSNIVLTLSEEAVNKVRS
FT                   DAVKQNITTLHNRVNELGVAEPIIQQSGLDRIVVQLPGVQDTAKAKDIIGRTATLEVRM
FT                   VEDDPAKLREALEGNVPSGYELLSSGGEHPETLLISKQVELTGDNINDAQPSFDQMGAP
FT                   AVSLSLDSAGGSIFGELTAANVGKRMAMVLIDQGKSEVVTAPVIRTAITGGRVEISGSM
FT                   TTAEANDTSLLLRAGSLAAPMQIVEERTIGPSLGKENIEKGFHSTLWGFAIVAAFMVVY
FT                   YRLMGFFSTIALSANILFLIGILSAMQATLTLPGMAALALTLGMAIDSNVLINERIREE
FT                   LRAGVPPQQAINLGFQHAWATIVDSNLTSLIAGIALLVFGSGPVRGFAVVHCLGILTSM
FT                   YSSVVVFRALVNLWYGRRRKLQNISIGAVWKPEAETAAGKE"
FT   gene            191839..192774
FT                   /locus_tag="NGO_0190"
FT   CDS_pept        191839..192774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0190"
FT                   /product="preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88945"
FT                   /db_xref="GOA:Q5FA42"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA42"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219655.1"
FT                   /protein_id="AAW88945.1"
FT                   /translation="MELFKIKRDIPFMSYGKLTTFISLVTFIAAVFFLVARGLNFSVEF
FT                   TGGTVMEVQYQQGADVNKMRERLDTLKMGDVQVQALGTNKHIMIRLPNKEGVTSAQLSN
FT                   QVMDLLKKDSPDVTLRQVEFIGPQVGEELVNNGLMALGFVVIGIIIYLSMRFEWRFAVS
FT                   AIIANMHDIVIILGCFAFFQWEFSLTVLAGILAVLGYSVNESVVVFDRIRENFRKPAMR
FT                   GHTVPEVIDNAITATMSRTIITHGSTEAMVVSMLVFGGAALHGFSMALTIGIVFGIYSS
FT                   VLVASPLLLMFGLSRDNIAKEAKQKEEIVV"
FT   misc_feature    192925..193035
FT                   /note="ribosomal protein S15 leader"
FT   gene            192979..193248
FT                   /locus_tag="NGO_0191"
FT   CDS_pept        192979..193248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0191"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88946"
FT                   /db_xref="GOA:Q5FA41"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA41"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009425790.1"
FT                   /protein_id="AAW88946.1"
FT                   /translation="MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKA
FT                   NPKDHHSRRGLLKMVSQRRRLLAYLRRTQPDTYRALITRLGLRK"
FT   gene            193526..194650
FT                   /locus_tag="NGO_0192"
FT   CDS_pept        193526..194650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0192"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88947"
FT                   /db_xref="GOA:Q5FA40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA40"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002256447.1"
FT                   /protein_id="AAW88947.2"
FT                   /translation="MTATTASSAKPYLQIQGLVKKFGDNYAVDNIDLDIYQNEIFALLG
FT                   SSGSGKSTLLRMLAGMESPNQGKIILDGQDITKLAPYDRPINMMFQSYALFPHMTVEQN
FT                   IAFGLKQDKMPKGEIDARVEEMLRLVQMTKFAKRKPHQLSGGQQQRIALARSLAKRPKI
FT                   LLLDEPLGALDKKLRQQTQLELVNTLEQVGVTCIMVTHDQEEAMTMATRIAIMSDGQLQ
FT                   QVGTPSDVYDYPNSRFTAEFIGETNIFDGVVIENHADYAVIECEGLENHVRIDHGLGGP
FT                   SEQDLWVSIRPEDIDLYKEKPEYLGDYNWAKGTVKEIAYLGSFAIYHIKLANGRVVKSQ
FT                   VPAPYWYVRNITPPTWDETVYISWPENQPTPLFR"
FT   gene            194666..194809
FT                   /locus_tag="NGO_01035"
FT   CDS_pept        194666..194809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01035"
FT                   /product="polyamine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01035"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63604"
FT                   /db_xref="GOA:A0A0H4ISK7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISK7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690690.1"
FT                   /protein_id="AKO63604.1"
FT                   /translation="MNLNKLKNKLFRRPGQRAVIAVPYMPPTWDETVYISWPENQPTPL
FT                   FR"
FT   gene            194825..194968
FT                   /locus_tag="NGO_01040"
FT   CDS_pept        194825..194968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01040"
FT                   /product="polyamine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01040"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63605"
FT                   /db_xref="GOA:A0A0H4ISK7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISK7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690690.1"
FT                   /protein_id="AKO63605.1"
FT                   /translation="MNLNKLKNKLFRRPGQRAVIAVPYMPPTWDETVYISWPENQPTPL
FT                   FR"
FT   gene            194984..195949
FT                   /locus_tag="NGO_0195"
FT   CDS_pept        194984..195949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0195"
FT                   /product="putrescine/spermidine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88948"
FT                   /db_xref="GOA:Q5FA39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA39"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003713503.1"
FT                   /protein_id="AAW88948.1"
FT                   /translation="MNLNKLKNKLFRRPGQRAVIAVPYIWLLVLFLIPFAIVLKISFAE
FT                   QEIAIPPFTPLTTIDEDLGRLNIAVSYQNYADIFQNFWHTLNPFGDSENSNIYLMTYWS
FT                   SIKTALTTTVICLLVGYPTAYAISRANPSVRNGLLLAIMLPFWTSFLLRVYAWMGLLGH
FT                   NGIINNLLIKMGIIREPLDLFYNAFSLNLVMVYAYLPFMILPLYTQLVKLDSRLLEAAS
FT                   DLGAGPVKSFLTITLPLSKTGIIAGSMLVFVPAVGEFVIPELVGGSENLMIGKVLWQAF
FT                   FDQNNWPLASAVAVVMVALLVVPIALFQHYENRELEEGAK"
FT   gene            195949..196836
FT                   /locus_tag="NGO_0196"
FT   CDS_pept        195949..196836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0196"
FT                   /product="polyamine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88949"
FT                   /db_xref="GOA:Q5FA38"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA38"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002241241.1"
FT                   /protein_id="AAW88949.1"
FT                   /translation="MQKSKLSWFLKLMLALSLAFLYIPLVVLVIYSFNESKLVTVWGGF
FT                   STKWYGALLENDTILEAAWLSLRIAVVSSLAAVVLGTLAGYAMARIKRFRGSTLFAGMI
FT                   SAPMVMPDVITGLSMLLLIIQVQIFLQGSEWLQHLYFDRGFFTIFLGHTTLCMAYITVV
FT                   IRSRLVELDQSLEEAAMDLGARPLKIFFVITLPLIAPAIASGFLLGITLSLDDLVITSF
FT                   LSGPGSSTLPQVIFSKIKLGLDPQMNVLATILIGIIGTLVIIVNYWMMRQATKRNREAA
FT                   EAYRQEKLAAEKAN"
FT   gene            196963..198258
FT                   /locus_tag="NGO_0197"
FT   CDS_pept        196963..198258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0197"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88950"
FT                   /db_xref="GOA:Q5FA37"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002251145.1"
FT                   /protein_id="AAW88950.2"
FT                   /translation="MIRPDFQEYLPSYYFSSVNPHTVYPKLQCRLKAETCIIGGGLSGL
FT                   CTALPLAEHGHEAVVLEAARIGFGASGRSGGQVISDYACGMGEIEKQVGLEQAQWFWQQ
FT                   SLQAVELVDERVRKHAIDCDWQRGYATVAVRPQHWEELQQWHEHAQRHYGASHYQLWDK
FT                   AELKQQLDSDMYQGAQFDPLSGHLHPLNYTLGVASAAAEAGAQIFEQSPMTRIEPYQNG
FT                   WLVYTPEGSVECKNVVYAVNTYVGLNPIFRPLERKAIAVSTFIIATEPLGARTKGLIRN
FT                   NMAVCDNRHILDYYRLSADGRLLFGGKDNEFIDNPARMTELVRQDMLKVFPQLADVRIE
FT                   YSWGGECDITANLVPHFGRLTSNVFYTQGYSGHGMAITGIAGLAVAEAILGDECRLKPF
FT                   EQLCQPNIILQPFLRKLGSFLGSKYYQWKDSR"
FT   gene            complement(198352..199656)
FT                   /locus_tag="NGO_0198"
FT   CDS_pept        complement(198352..199656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0198"
FT                   /product="ammonia channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88951"
FT                   /db_xref="GOA:Q5FA36"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA36"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687507.1"
FT                   /protein_id="AAW88951.2"
FT                   /translation="MKKHIWAASLLPASLSAEPLNWWKPYSAVNSGDTAWVMTAAALVL
FT                   LMTLPGLALFYGGMVRKKNLLSTMMHSFSIATLVGILWVAVGYSLAFTPGNAFIGGLGR
FT                   VFLSGMQIDAAARMLTVSPNAPTVPEPVFMFFQMTFAIISTAIITGAFAERMKYSAMML
FT                   FSGIWFLLVYVPGAHWVWGGGFMSKGGVLDYAGGTVVHINAGIAGLVAALVLGRRIGYG
FT                   REAMPPHNMAMTLIGAAMLWFGWFGFNAGSALAADAAAGMAMAVTQVSAVFGAAGWLAC
FT                   EKIAGHKPSALGLASGAVSGLVGITPAAGFTGPSGAAAIGILTAAACFVSVTVVKHKLR
FT                   YDDSLDAFGIHGFGGLVGGILTGIFFDNRIFGGDAAVWQQLWIQVKDGFIMAAYSGLMS
FT                   WAILKAVGKICGGLRVGKDVEREGLDLNIHGEHVE"
FT   gene            complement(200272..201531)
FT                   /gene="rho"
FT                   /locus_tag="NGO_0199"
FT   CDS_pept        complement(200272..201531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="NGO_0199"
FT                   /product="transcription termination factor Rho"
FT                   /note="An RNA-DNA helicase that actively releases nascent
FT                   mRNAs from paused transcription complexes"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88952"
FT                   /db_xref="GOA:Q5FA35"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA35"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019273062.1"
FT                   /protein_id="AAW88952.1"
FT                   /translation="MHVSELQTLHISKLLELAEEHGIENANRFRKQDLVFAIVRQMMKK
FT                   GEGFTCSGTLEILPDGFGFLRSADTSYLAGPDDIYVSPTQIRRFNLHTGDTIEGSVRVP
FT                   KDNERYFALVRLDSINGDHPEVCRHKILFENLTPLFPTEQLKLERDLKSEENLTGRAID
FT                   LISPIGKGQRALLVAPPKIGKTVMLQNIAHAVTANYPEVELIVLLIDERPEEVTEMSRS
FT                   VRGEVVSSTFDEPAQRHVQVAEMVLEKAKRMVEHKKDVVILLDSITRLARAYNTVVPAS
FT                   GKILTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVETGSRMDDVIYEEFKGTGN
FT                   MELHLDRRMAEKRLFPAININKSGTRREELLVPNDQLQRMWLLRKFLHPMDEIEATEFL
FT                   NGKIKASKNNDDFFELMRGK"
FT   gene            complement(201752..204136)
FT                   /locus_tag="NGO_0200"
FT   CDS_pept        complement(201752..204136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0200"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="catalyzes the formation of phosphoenolpyruvate from
FT                   pyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88953"
FT                   /db_xref="GOA:Q5FA34"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA34"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147135.1"
FT                   /protein_id="AAW88953.1"
FT                   /translation="MADNYVIWFENLRMTDVERVGGKNASLGEMISQLTEKGVRVPGGF
FT                   ATTADAYRAFLAHNGLNERISAALAKLDVEDVSELARVGKEIRQWILDTPFPEQLDAEI
FT                   EAAWNKMITDADGADISVAVRSSATAEDLPDASFAGQQETFLNINGLDNVKKAMRHVFA
FT                   SLYNDRAISYRVHKGFEHDIVALSAGVQRMVRSDSGASGVMFTLDTESGYNQVVFVTSS
FT                   YGLGENVVQGAVNPDEFYVFKPTLKAGKPAILRKTMGSKHIKMIFTDKAEAGKSVTNVE
FT                   VPEEDRNRFSITDEEITELAHYALTIEKHYGRPMDIEWGRDGLDGKLYILQARPETVKS
FT                   QEEGSRNLRRYAINGEKTVLCEGRAIGQKVGQGKVRLIKDASEMDSVEAGDVLVTDMTD
FT                   PDWEPVMKRASAIVTNRGGRTCHAAIIARELGIPAVVGCGNATELLENGQEVTVSCAEG
FT                   DTGFIYAGLLDVQITDVALDNMPKAPVKVMMNVGNPELAFSFANLPSEGIGLARMEFII
FT                   NRQIGIHPKALLEFDKQDDELKAEIIRRIAGYASPVDFYVDKIAEGVATLAASVYPRKT
FT                   IVRMSDFKSNEYANLVGGSVYEPHEENPMLGFRGAARYVAESFKDCFALECKALKRVRD
FT                   EMGLTNVEIMIPFVRTLGEAEAVVKALKENGLERGKNGLRLIMMCELPSNAVLAEQFLQ
FT                   YFDGFSIGSNDMTQLTLGLDRDSGLVSESFDERNPAVKVMLHLAISACRKQNKYVGICG
FT                   QGPSDHPDFAKWLVGEGIESVSLNPDTVIETWLYLANELNK"
FT   gene            204141..204404
FT                   /locus_tag="NGO_01075"
FT   CDS_pept        204141..204404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01075"
FT                   /product="Myo-inositol transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01075"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63606"
FT                   /db_xref="GOA:A0A0H4IRM1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRM1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690695.1"
FT                   /protein_id="AKO63606.1"
FT                   /translation="MSNPKYVKKETNPLAYFKRFVPPLSRFYLSGQPLRRLKNSGFRLC
FT                   SGLKPMAGILFFSGISFVKQMVLNRLMFYAVFFLFLFFGILF"
FT   gene            204491..205144
FT                   /locus_tag="NGO_0201"
FT   CDS_pept        204491..205144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0201"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88954"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA33"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503653.1"
FT                   /protein_id="AAW88954.1"
FT                   /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFYR
FT                   KIRTVANHRLALAADEVFEGPAGPGASCFGVRRKGRRGRGAAGKAVVFGIPKRNGRAYT
FT                   VAADDAEPETLPPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRRNHI
FT                   NGIGNFWNQAKRALRKYNGIDRKPFPPFLRECEFRLNFGTPSRQLKILRDRCGI"
FT   gene            205270..206091
FT                   /locus_tag="NGO_0202"
FT   CDS_pept        205270..206091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0202"
FT                   /product="PEP synthetase regulatory protein"
FT                   /note="mediates the activation of PEP synthetase by an
FT                   inorganic phosphate pyrophosphorylation and inactivates PEP
FT                   synthetase by ADP-dependent phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88955"
FT                   /db_xref="GOA:Q5FA32"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA32"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014580106.1"
FT                   /protein_id="AAW88955.1"
FT                   /translation="MSSPRQVFYISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTP
FT                   EKARAVVEKVNRSRQENGQRPIAFVSVVDDEIRRIIKGADAFQINFFETFLGLLEKELN
FT                   TEATVSGQGHHSIGNTKRYDARMEAVNFSLNHDDGVSDKNLQEADVILMGVSRSGKTPT
FT                   CLYLALQYGIRAANYPLIPDDLESADLPRMVKPYKDKLFGLTIQPERLQAIRQERRPNS
FT                   AYARIDTCRSEVADAQSMFRRHGIPFANTTDKSVEELAVHILQACKLKRRF"
FT   gene            complement(206177..206839)
FT                   /locus_tag="NGO_0203"
FT   CDS_pept        complement(206177..206839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0203"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88956"
FT                   /db_xref="GOA:Q5FA31"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA31"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002256510.1"
FT                   /protein_id="AAW88956.2"
FT                   /translation="MIQAVLFDLDGTLADTALDLGGALNTQLARHGLPEKSMDEIRTQA
FT                   SHGAAGLLKLGANITPEHPDYTAWRTEYLEEYDSRYAQDTTLFDGVNELIAELDRRGIK
FT                   WGIITNKPMRFTDKLVPKLGFAVPPATVVSGDTCGEPKPSIKPMLHACGKIHADPQHTL
FT                   YVGDAERDIQAGRNAGMKTVLAEWGYISDEDDTGSWQADFHIRTPLDLLECLDKIQP"
FT   gene            complement(206877..207704)
FT                   /locus_tag="NGO_0204"
FT   CDS_pept        complement(206877..207704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0204"
FT                   /product="ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88957"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA30"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003696748.1"
FT                   /protein_id="AAW88957.1"
FT                   /translation="MNPDIYALPERALLSGDPDEKGRLTDEAFAAVQNADGAEANAPPA
FT                   DFPRAGRPDTPVLVAPSQLTPRKMNTAEGYAAMLHAITHIEFNAVNLALDAAYRFRTLP
FT                   FQFVRDWVKVAKEEVYHFRLVRDRLRAFGFDYGSFEAHNHLWDMAYKTAYDPLLRMALV
FT                   PRVLEARGLDVMPGIRAKVEQRGDSATCGVLDIIYRDEVGHVAIGNRWYQHLCRERGLE
FT                   PVALFRSLIARYDMFIFRGYVNIEAREKAGFSRFELDMLEDFEQGLKQNKHAV"
FT   gene            208087..208710
FT                   /locus_tag="NGO_0205"
FT   CDS_pept        208087..208710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0205"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88958"
FT                   /db_xref="GOA:Q5FA29"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA29"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357008.1"
FT                   /protein_id="AAW88958.1"
FT                   /translation="MMKPHNLFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSF
FT                   TQTVQSKKKTQTAHGTFKILRPGLFKWEYTLPYRQTIVGDGQTVWLYDVDLAQVTKSSQ
FT                   DQAIGGSPAAILSNKTALESSYTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNL
FT                   AAMQLKDSFGNQTSISFGGLNTNPQLSRGAFKFTPPKGVDVLSN"
FT   gene            208983..210119
FT                   /locus_tag="NGO_0206"
FT   CDS_pept        208983..210119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0206"
FT                   /product="polyamine ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88959"
FT                   /db_xref="GOA:Q5FA28"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA28"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687520.1"
FT                   /protein_id="AAW88959.1"
FT                   /translation="MKKTLVAAILSLALTACGGGSDTAAQTPSAKPEAEQSGKLNIYNW
FT                   SDYVDPETVAAFEKETGIKMRSDYYDSNETLEAKVLTGKSGYDLTAPSIANVGRQIKAG
FT                   AYQKIDKAQIPHYGNIDKDLLKMMEAVDPGNEYAVPYFWGINTLAINTRQVQKALGTDK
FT                   LPENEWDLVFKPEYTAKLKSCGISYFDSAIEQIPLALHYLGKDPNSENPEDIKAAVDMM
FT                   KAVRGDVKRFSSSGYIDDMAAGNLCAAIGYGGDLNIAKTRAEEAANGVEIKVLTPKTGV
FT                   GVWVDSFMIPRDAQNVANAHRYIDYTLRPEVAAKNGSFVTYAPASRPARELMDEKYTSD
FT                   ASIFPTKELMEKSFIVSPKSAESVKLGVKLWQGLKAGK"
FT   gene            210214..211197
FT                   /locus_tag="NGO_0207"
FT   CDS_pept        210214..211197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0207"
FT                   /product="sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88960"
FT                   /db_xref="GOA:Q5FA27"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA27"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704837.1"
FT                   /protein_id="AAW88960.1"
FT                   /translation="MNLSIVVPIYNVESYLEACLNSIEPILSNENVELILVNDGSKDGS
FT                   EDICYKYIDKISNTKHQTPNTKYIYQDNQGLSEARNTGIKNSNGKYIAFIDSDDFINCQ
FT                   VLLDFLGKDDSDMPDVVFLNAVKYDKGRVSYFGEDYQPEKILNQSKVEVLKGLCRFRKF
FT                   PGSAWNKIIKRELIIREKLFFEKGIYSEDIEWSMRLFNAATTFSYLDGCYYYYRQGRKD
FT                   SITGTVSEKGIKSLLYILEKNAKMEFNRDISSYLYSFLSYEYLVLLFIMTSKNIACDSD
FT                   IKRRAYHLRFMLLKSNKLIYKLIFPIITLFGVDITGRILKAIRGNI"
FT   gene            211238..211768
FT                   /locus_tag="NGO_0208"
FT   CDS_pept        211238..211768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0208"
FT                   /product="anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88961"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA26"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217761.1"
FT                   /protein_id="AAW88961.1"
FT                   /translation="MNAIRTFQNRTPEIHETCMIDEACVVIGEVSLAEDVSVWPCAVLR
FT                   GDVNSITVGARSNIQDGSVLHVSHKTAAKPEGSPLVIGEDVTVGHKVMLHGCRIGNRVL
FT                   VGMGSTVLDDAVIEDDVMIGAGSLVPPRKRLEGGYLYIGSPVRQVRLLTDEEKAFLKYS
FT                   AAHYVKLSKQYGM"
FT   gene            complement(211936..213531)
FT                   /gene="prfC"
FT                   /locus_tag="NGO_0209"
FT   CDS_pept        complement(211936..213531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="NGO_0209"
FT                   /product="peptide chain release factor 3"
FT                   /note="stimulates the release of release factors 1 and 2
FT                   from the ribosome after hydrolysis of the ester bond in
FT                   peptidyl-tRNA has occurred; GDP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88962"
FT                   /db_xref="GOA:Q5FA25"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA25"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219644.1"
FT                   /protein_id="AAW88962.1"
FT                   /translation="MSQEILDQVRRRRTFAIISHPDAGKTTLTEKLLLFSGAIQSAGTV
FT                   KGKKTGKFATSDWMDIEKQRGISVASSVMQFDYKDHTVNLLDTPGHQDFSEDTYRVLTA
FT                   VDSALMVIDAAKGVEAQTIKLLNVCRLRDTPIVTFMNKYDREVRDSLELLDEVEDILQI
FT                   RCAPVTWPIGMGKNFKGVYHILNDEIYLFEAGGERLPHEFDIIKGINNPELEQRFPLEI
FT                   QQLRDEIELVQAASNEFNLDEFLAGELTPVFFGSAINNFGIQEILNSLIDWAPAPKPRD
FT                   ATMRMVGPDEPKFSGFIFKIQANMDPKHRDRIAFLRVCSGKFERGMKMKHLRINREIAA
FT                   SSVVTFMSHDRELAEEAYAGDIIGIPNHGNIQIGDSFSEGEQLAFTGIPFFAPELFRSV
FT                   RIKNPLKIKQLQKGLQQLGEEGAVQVFKPMSGADLILGAVGVLQFEVVTSRLANEYGVE
FT                   AVFDSASIWSARWVSCDDKKKLAEFEKANAGNLAIDAGGNLAYLAPNRVNLGLTQERWP
FT                   DIVFHETREHSVKL"
FT   gene            complement(213638..214033)
FT                   /locus_tag="NGO_0210"
FT   CDS_pept        complement(213638..214033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0210"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88963"
FT                   /db_xref="GOA:Q5FA24"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA24"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9K0H5.1"
FT                   /protein_id="AAW88963.1"
FT                   /translation="MDKNLLEAVKFDEKGLVCAIAQDAETKRVLMVAWMNAEALQKTVE
FT                   TGFAHYYSRSRQKQWMKGEESGHTQKVRELRLDCDGDTIVMLIAQNGGIACHTGRESCF
FT                   YKKWNGGAWETADAVLKDEKEIYGSTH"
FT   gene            complement(214064..214831)
FT                   /locus_tag="NGO_0211"
FT   CDS_pept        complement(214064..214831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0211"
FT                   /product="imidazole glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88964"
FT                   /db_xref="GOA:Q5FA23"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA23"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002251159.1"
FT                   /protein_id="AAW88964.1"
FT                   /translation="MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGA
FT                   DELTFLDITASSDNRDTILHIIEEVAGQVFIPLTVGGGVRTVADIRRLLNAGADKVSIN
FT                   TAAVTRPDLINEAAGFFGSQAIVAAVDAKAVNPENTRWEIFTHGGRNPTGLDAVEWAVE
FT                   MQKRGAGEILLTGMDRDGTKQGFNLPLTRAVAEAVDIPVIASGGVGNVRHLIEGITEGK
FT                   ADAVLAAGIFHFGEIAIREAKRTMREAGIEVRL"
FT   gene            complement(214844..215581)
FT                   /locus_tag="NGO_0212"
FT   CDS_pept        complement(214844..215581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0212"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="catalyzes the formation of
FT                   5-(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino-l-
FT                   (5-phosphoribosyl)imidazole-4-carboxamide from
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88965"
FT                   /db_xref="GOA:Q5FA22"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA22"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002226576.1"
FT                   /protein_id="AAW88965.1"
FT                   /translation="MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPADTALHWFEQGAR
FT                   RLHLVDLNGAFAGVPQNLPAIKDILAAVAKDIPVQLGGGMRDLKTIGQYLDLGLNDVII
FT                   GTAAVKNPDLVREACKAFPGRIIVGLDAKDGMAAIDGWATVTGHHVIDLAKRFEDDGVN
FT                   SIIYTDIGRDGMMSGVNIDATVKLAQSVRIPVIASGGLTGLDDIRALCAAEKHGVAGAI
FT                   TGRAIYEGSIDFAQAQQLADSLD"
FT   gene            complement(215614..216252)
FT                   /gene="hisH"
FT                   /locus_tag="NGO_0213"
FT   CDS_pept        complement(215614..216252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="NGO_0213"
FT                   /product="imidazole glycerol phosphate synthase"
FT                   /EC_number="2.4.2.-"
FT                   /note="with HisF IGPS catalyzes the conversion of
FT                   phosphoribulosyl-formimino-5-aminoimidazole-4-carboxamide
FT                   ribonucleotide phosphate and glutamine to
FT                   imidazole-glycerol phosphate, 5-aminoimidazol-4-carboxamide
FT                   ribonucleotide, and glutamate in histidine biosynthesis;
FT                   the HisH subunit provides the glutamine amidotransferase
FT                   activity that produces the ammonia necessary to HisF for
FT                   the synthesis of imidazole-glycerol phosphate and
FT                   5-aminoimidazol-4-carboxamide ribonucleotide"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88966"
FT                   /db_xref="GOA:Q5FA21"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA21"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003754012.1"
FT                   /protein_id="AAW88966.1"
FT                   /translation="MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTKIFLSGDPDRVSRA
FT                   DKVIFPGQGAMPDCMAALTRGGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNTDGLG
FT                   WFGGKVRRFARDLRDPQGCRLKVPHMGWNTVRQTQNHPLFQGIPQNTRFYFVHSYYFAP
FT                   ENPETILGESDYPSPFACIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW"
FT   gene            complement(216382..217884)
FT                   /locus_tag="NGO_0214"
FT   CDS_pept        complement(216382..217884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0214"
FT                   /product="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88967"
FT                   /db_xref="GOA:Q5FA20"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA20"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003709725.1"
FT                   /protein_id="AAW88967.1"
FT                   /translation="MAKVLVVPVSAGLNTSAAAQAFAKALDAQVFQAVDATAETLLAQG
FT                   KSDDWFDALVGKVAALDAANLVIEGIAPDADKIYLAGKNVELALSLDAAAVFAVRSDNT
FT                   DADALAHQLNLAKQFFAAAPGVLEGFVVDGAAASVAEAAAEKTGLTFFGSSDALKDVSV
FT                   LAGREAKRLSPAQFRYNLIDFARQAGKRIVLPEGAEPRTVQAAAICHEKGIARCVLLAK
FT                   REEVEAVAKERGISLPDSLEIIDPASLVEQYVEPMCELRKSKGLTPEDARKQLQDTVVL
FT                   GTMMMAQNDVDGLVSGAVHTTANTIRPALQLIKTAPGASLVSSVFFMLLPNQVLVFGDC
FT                   AVNPNPTAQQLADIAIQSADSAKAFGIDPKVAMISYSTVNSGSGPDVDTVIEATKLARE
FT                   KRPDLAIDGPLQYDAATVPGVGKSKAPGSPVAGQATVLVFPDLNTGNCTYKAVQRSANV
FT                   LSVGPLLQGLRKPVNDLSRGALVEDIVFTIALTAVQAKQMEG"
FT   gene            complement(218069..219127)
FT                   /locus_tag="NGO_0215"
FT   CDS_pept        complement(218069..219127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0215"
FT                   /product="peptide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88968"
FT                   /db_xref="GOA:Q5FA19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041230"
FT                   /db_xref="PDB:3FVQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA19"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581175.1"
FT                   /protein_id="AAW88968.1"
FT                   /translation="MTAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTT
FT                   LLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYG
FT                   LGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRVALARALAPDPELILLD
FT                   EPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTAS
FT                   PHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLPVQSGAPAGTRGTLLIRPE
FT                   QFSLHPHSAPAASIHAVVLKTTPKARHTEISLRAGQTVLTLNLPSAPTLSDGISAVLHL
FT                   DGPALFFPGNTL"
FT   gene            complement(219148..220665)
FT                   /locus_tag="NGO_0216"
FT   CDS_pept        complement(219148..220665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0216"
FT                   /product="Fe3+ dicitrate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88969"
FT                   /db_xref="GOA:Q5FA18"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA18"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357027.1"
FT                   /protein_id="AAW88969.2"
FT                   /translation="MSPKKIPIWLTGLILLIALPLTLPFLYVAMRSWQVGINRAVELLF
FT                   RPRMWDLLSNTLTMMAGVTLISIVLGIACALLFQRYRFFGKTFFQTAITLPLCIPAFVS
FT                   CFTWISLTFRVEGFWGTVMIMSLSSFPLAYLPVEAALKRISLSYEEVSLSLGKSRLQTF
FT                   FSAILPQLKPAIGSSVLLIALHMLVEFGAVSILNYPTFTTAIFQEYEMSYNNNTAALLS
FT                   AVLTAVCGIVVFGESIFRGKAKIYHSGKGVARPYPVKTLKLPGQIGAIVFLSSLLILGI
FT                   IIPFGVLIHWMMVGTSGTFALVSVFDAFIRSLSVSALGAILTILCALPLVWASVRYRNF
FT                   LTVWIDRLPFLLHAVPGLVIALSLVYFSINYTPAVYQTFIVVILAYFMLYLPMAQTTLR
FT                   TSLEQLPKGMEQVGATLGRGHFFIFRTLVLPSILPGITAAFALVFLKLMKELTATLLLT
FT                   ADDVHTLSTAVWEYTSDAQYAAATPYALMLVLFSGIPVFLLKKYAFK"
FT   gene            complement(220733..221728)
FT                   /locus_tag="NGO_0217"
FT   CDS_pept        complement(220733..221728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0217"
FT                   /product="iron ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88970"
FT                   /db_xref="GOA:Q5FA17"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA17"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271780.1"
FT                   /protein_id="AAW88970.1"
FT                   /translation="MKTSIRYALLAAALTAATPALADITVYNGQHKEAAQAVADAFTRA
FT                   TGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPALATLSAANLLEPLPASTINET
FT                   RGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSVLNYATPKWKNRIGYVPTSGA
FT                   FLEQIVAIVKLKGEAAALKWLKGLKEYGKPYAKNSVALQAVENGEIDAALINNYYWHAF
FT                   AREKGVQNVHTRLNFVRHRDPGALVTYSGAAVLKSSQNKDEAKKFVAFLAGKEGQRALT
FT                   AVRAEYPLNPHVVSTFNLEPIAKLEAPQVSATTVSEKEHATRLLEQAGMK"
FT   gene            complement(222119..222460)
FT                   /locus_tag="NGO_0218"
FT   CDS_pept        complement(222119..222460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88971"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA16"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357028.1"
FT                   /protein_id="AAW88971.1"
FT                   /translation="MTDTDTQADRFEQMMRQAVDKLFEQHDGKLESMDGREQELVLIWR
FT                   AEADIGNGGILQFVCNWGFPAAEKTCSVLKKIGAVHSAMLIHRAADALGKEIRHLQSEG
FT                   KNLKEMWDI"
FT   gene            complement(222518..223894)
FT                   /locus_tag="NGO_0219"
FT   CDS_pept        complement(222518..223894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0219"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="catalyzes the formation of arginine from
FT                   (N-L-arginino)succinate"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88972"
FT                   /db_xref="GOA:Q5FA15"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA15"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003675665.1"
FT                   /protein_id="AAW88972.1"
FT                   /translation="MHDKTWSGRFNEPVSELVKQYTASIGFDQRLAEWDIQGSLAHAQM
FT                   LTRSGVLSENDLTDIRRGMSEILEEIRSGKIEWPLDLEDVHMNIERRLTDKIGDAGKRL
FT                   HTGRSRNDQVATDIRLWLRDQITVIQNLIQNLQTALLDLAEQNAEAVMPGFTHLQVAQP
FT                   VSFGHHMLAYVEMLGRDFERMTDCRKRVNRMPLGAAALAGTTYPIQREITAELLGFEQI
FT                   CQNSLDAVSDRDFAIEFTAAASLVMVHLSRLSEELILWMSPRFGFIDIADRFCTGSSIM
FT                   PQKKNPDVPELVRGKSGRVIGHLIGLITLMKSQPLAYNKDNQEDKEPLFDTADTLIDTL
FT                   RIYADMMRGVTVKPGNMRAAVMQGFATATDLADYLVKKGMPFRDAHEVVAQAVRHADEA
FT                   GVDLSELPLEALQGFSKLISDDVYGVLTPEGSLNARNHLGGTAPEQVRLQVKRWREMSA
FT                   "
FT   gene            complement(223913..224782)
FT                   /locus_tag="NGO_0220"
FT   CDS_pept        complement(223913..224782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0220"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88973"
FT                   /db_xref="GOA:Q5FA14"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA14"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003713464.1"
FT                   /protein_id="AAW88973.1"
FT                   /translation="MKPIKKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAVEEA
FT                   VEAGCTEMVFVTGRNKRSIEDHFDKAYELETKLEMRHKDKLLEHVRNILPPNITCLYIR
FT                   QAEALGLGHAVLCARAAIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGVETV
FT                   EPSQTGSYGIVETEQLKQFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPR
FT                   GAGNEIQLTDGIAKLLDHEFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRR
FT                   LLEKYRTE"
FT   gene            complement(224810..225409)
FT                   /locus_tag="NGO_0221"
FT   CDS_pept        complement(224810..225409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0221"
FT                   /product="nucleoside-triphosphate diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88974"
FT                   /db_xref="GOA:Q5FA13"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA13"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219635.1"
FT                   /protein_id="AAW88974.1"
FT                   /translation="MSEKPEKIVLASGNAGKLKEFGNLFKPYGITVLPQSAFGIPECPE
FT                   PYPTFVENALAKARHAAGHSGLPALADDSGICAAALNGAPGIHSARYAGSNPKSDTANN
FT                   LKLAAELAGKADKSCSYVCVLVFVRHKDDPRPIIAEGIWHGQWHDTPLGQNGFGYDPYF
FT                   YLPEHGKTAAELDSEVKNRESHRAQALADLIRKLAL"
FT   gene            complement(225402..225635)
FT                   /locus_tag="NGO_0222"
FT   CDS_pept        complement(225402..225635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0222"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88975"
FT                   /db_xref="GOA:Q5FA12"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA12"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214244.1"
FT                   /protein_id="AAW88975.1"
FT                   /translation="MNRRKIYLLSVALFTLAFMLPVLLGAYLLTAGSKTFAVASFLFAF
FT                   GALFGQIGALALYLRHKSLRAAPSSSQGNRYV"
FT   gene            complement(225743..226276)
FT                   /locus_tag="NGO_0223"
FT   CDS_pept        complement(225743..226276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0223"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88976"
FT                   /db_xref="GOA:Q5FA11"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA11"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9JVG3.1"
FT                   /protein_id="AAW88976.1"
FT                   /translation="MADFNQILTPGDVDGGIINVVNEIPAGSNHKIEWNRKLAAFQLDR
FT                   IEPAIFAKPTNYGFIPQTLDEDGDELDVLLVTEQPLATGVFLEARVIGVMKFVDDGEVD
FT                   DKIVCVPADDRNNGNAYKTLSDLPQQLIKQIEFHFNHYKDLKKAGTTKVESWGGAEEAK
FT                   KVIKESIERWNKQA"
FT   gene            complement(226378..226830)
FT                   /locus_tag="NGO_0224"
FT   CDS_pept        complement(226378..226830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0224"
FT                   /product="dihydroneopterin triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88977"
FT                   /db_xref="GOA:Q5FA10"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA10"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581850.1"
FT                   /protein_id="AAW88977.2"
FT                   /translation="MAKPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEPGE
FT                   TVAQTARREVWEETGILLEDGQLQDRHDSTVYEIYHHWRHRYPKGVFENREHVFRAEIP
FT                   RDTPVVLQPEEHVSYGWFGLEEAAEKVFSPSNRRAILELGRFLGKR"
FT   gene            227047..227123
FT                   /locus_tag="NGO_18801"
FT   tRNA            227047..227123
FT                   /locus_tag="NGO_18801"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:227081..227083,aa:Pro,seq:ggg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            227386..229272
FT                   /locus_tag="NGO_0225"
FT   CDS_pept        227386..229272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0225"
FT                   /product="septum formation inhibitor Maf"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88978"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA09"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002222818.1"
FT                   /protein_id="AAW88978.1"
FT                   /translation="MGISRKISLILSILAVCLPMHAHASDLANDPFIRQVLDRQHFEPD
FT                   GKYHLFGSRGELAERSGHIGLGNIQSHQLGNLMIQQAAIKGNIGYIVRFSDHGHEVHSP
FT                   FDNHASHSDSDEAGSPVDGFSLYRIHWDGYEHHPADGYDGPQGGGYPAPKGARDIYSYD
FT                   IKGVAQNIRLNLTDNRSTGQRLADRFHNAGAMLTQGVGDGFKRATRYSPELDRSGNAAE
FT                   AFNGTADIVKNIIGAAGEIVGAGDAVQGISEGSNIAVMHGLGLLSTENKMARINDLADM
FT                   AQLKDYAAAAIRDWAVQNPNAAQGIEAVSNIFMAAIPIKGIGAVRGKYGLGGITAHPVK
FT                   RSQMGAIALPKGKSAVSDNFADAAYAKYPSPYHSRNIRSNLEQRYGKENITSSTVPPSN
FT                   GKNVKLADQRHPKTGVPFDGKGFPNFEKHVKYDTKLDIQELSGGGIPKAKPVFDAKPRW
FT                   EVDRKLNKLTTREQVEKNVQETRRRSQSSQFKAHAQREWENKTGLDFNHFIGGDINKKG
FT                   TVTGGHSLTRGDVRVIQQTSAPDKHGVYQATVEIKKPDGSWEVKTKKGGKVMTKHTMFP
FT                   KDWDEARIRAEVTSAWESRIMLKDNKWQGTSKSGIKIEGFTEPNRTAYPIYE"
FT   gene            229300..229722
FT                   /locus_tag="NGO_0226"
FT   CDS_pept        229300..229722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA08"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002232153.1"
FT                   /protein_id="AAW88979.1"
FT                   /translation="MMKRIKCFCDKFPSGDTFRMCIILDDYDNRVDYYVGIYDYITSTL
FT                   MSDIYYRSTIDEHFKIIELIENNPNEIYDDGGGQQFCLEFHHDKVIFYHNEFDEEDGYP
FT                   VLSCSLHTFKTALIAWNAFLQLPKSIHSVVETVIEE"
FT   gene            230200..230445
FT                   /locus_tag="NGO_0227"
FT   CDS_pept        230200..230445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0227"
FT                   /product="A nuclease of the HNH/endo VII superwith
FT                   conserved WHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88980"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA07"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002237787.1"
FT                   /protein_id="AAW88980.1"
FT                   /translation="MKDSTGQMRLATKDLAEAIKRGEVRSSAFTTKQLKAIEKGKDKIP
FT                   SYTWHHHQDTGRMQLVPEWEHSKTGHIGGTAMGKGK"
FT   gene            230448..230834
FT                   /locus_tag="NGO_0228"
FT   CDS_pept        230448..230834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88981"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA06"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002245502.1"
FT                   /protein_id="AAW88981.1"
FT                   /translation="MWKIYKENSTDLNFAIGSIYCQAINLTEFKMWVEKIIREVDLHEI
FT                   PNYFFDLIDFQSLYDLIDIIGFVPENNLSKNQDNALTGIAFLRGIDVYDPPISKEKALK
FT                   ALEKHPEIYQKFQHFFPFVELPPL"
FT   gene            230861..231052
FT                   /locus_tag="NGO_01225"
FT   CDS_pept        230861..231052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01225"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63607"
FT                   /db_xref="InterPro:IPR032869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5C8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690717.1"
FT                   /protein_id="AKO63607.1"
FT                   /translation="MRLSDGIFDIKRITKEMFDGKGTSEIPNYTWHHHQDTGRMQLIRE
FT                   DSHHDTDHIGWRAMSKGK"
FT   gene            231055..231444
FT                   /locus_tag="NGO_0229"
FT   CDS_pept        231055..231444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA05"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002254666.1"
FT                   /protein_id="AAW88982.1"
FT                   /translation="MWKIIKEDSDDLGFAIKCLFSQSIDLNEFKLWIEQVIRDMPIEDI
FT                   PFYIFDLADFNGGIGDIDNIVGFVSSYSLSKSKKNALTGIAFLRGIDVYDPPISKEKAL
FT                   KALKKHPEIYHKFKRFFPFVELPLL"
FT   gene            complement(231484..232941)
FT                   /locus_tag="NGO_0230"
FT   CDS_pept        complement(231484..232941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0230"
FT                   /product="potassium transporter Trk"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88983"
FT                   /db_xref="GOA:Q5FA04"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA04"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019272823.1"
FT                   /protein_id="AAW88983.1"
FT                   /translation="MHKILPIAHVLSRLGMLFSFILLIPAALSYAFSDGAYTAFATTAT
FT                   VTLSGSCIVRLATLRFRRELRPRDGFTLVLMLWLAFAAMAAMPMYLYFPNMGFTDAFFE
FT                   SMSGLTTTGATVIPHVDGLAPSVNFWRHMLNWLGGMGIIVLAVAILPMLGVGGTQLFKA
FT                   EIPGIDKESKMSPRISQVAKKLWFGYTLITILAAACLHFAGMGWFDAVCHALATLSLGG
FT                   FSTHDASIGYYNSPLIEAVIIVFTIFGGINFASHFAALNSRSLKTYWKDEECRTMLLLL
FT                   SGSILASALYLWHTGHYAGFGESLRYTAFNFVSIGLANGLSNTDFAQWPLLISLWMFFL
FT                   ANILASSGSTGGGIKTIRALVLFKFSLREMMVLLHPKAVRTVKISGKAIPDRLALTVMS
FT                   FIFIYFMTVVLFSFLLMASGMEFTTAFTAVIACITNAGPGLGEVGPAGNYAGLDVMQKW
FT                   ICVTAMLLGRLEIFTVFILFTPAYWKK"
FT   gene            complement(232956..233786)
FT                   /locus_tag="NGO_0231"
FT   CDS_pept        complement(232956..233786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0231"
FT                   /product="diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88984"
FT                   /db_xref="GOA:Q5FA03"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5FA03"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214207.1"
FT                   /protein_id="AAW88984.1"
FT                   /translation="MAHYAIGDIQGCFDELTALLGKIGFNHGTDTLWLTGDIVNRGPKS
FT                   LETLQFCIRHENSVQIVLGNHDLYLLAVGCGEGALKRSDTIEPILKHPDGGKMLDWLRA
FT                   QPLLIREGGRVMIHAGILPQWRIAKAESLAGEAEAELRGKKYVKFFSKMYGNKPAAWDE
FT                   GLEGYARLRFIVNAFTRMRALTFKNELDFDYKSTVKKMPPYLRPWFKAPDRQNLDHTII
FT                   FGHWSSLGYTNADNVISLDTGALWGGQLTAVNLETEEITQVQAAGGIDWKSFAK"
FT   gene            complement(233863..234252)
FT                   /locus_tag="NGO_0232"
FT   CDS_pept        complement(233863..234252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0232"
FT                   /product="endoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88985"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA02"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003754044.1"
FT                   /protein_id="AAW88985.1"
FT                   /translation="MSKTVIHTDKAPAAIGAYSQAVRAGGTVYMSGQIPLDPATMTVVG
FT                   NGDFHTEARQVFQNLQAVAEAAGGSLDDIVKLNAYLTDLGNFAVFNEVMAEFITEPFPA
FT                   RAAVGVASLPKGVQVEAEAVLVLNA"
FT   gene            complement(234399..234926)
FT                   /locus_tag="NGO_0233"
FT   CDS_pept        complement(234399..234926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0233"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88986"
FT                   /db_xref="GOA:Q5FA01"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA01"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003754046.1"
FT                   /protein_id="AAW88986.1"
FT                   /translation="MKKALAALIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKG
FT                   FSPRISAGYRINDLRFAVDYTRYKNYKQAPSTDFKLYSIGASVIYDFDTQSPVKPYFGA
FT                   RLSLNRASAHLGGSDSFSKTSAGLGVLAGVSYAVTPNVDLDAGYRYNYVGKVNNVKNVR
FT                   SGELSAGVRVKF"
FT   gene            235132..235374
FT                   /locus_tag="NGO_01255"
FT   CDS_pept        235132..235374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01255"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63608"
FT                   /db_xref="GOA:A0A0H4IW04"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IW04"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692673.1"
FT                   /protein_id="AKO63608.1"
FT                   /translation="MQTVWKKPQRRGGGICQIVAGAGVRFFVCGVTLGVGHFRRRLCRL
FT                   KRPAGDAAAFPIDRHICRPRSGRVLPGRPPICLRL"
FT   gene            complement(235369..236544)
FT                   /locus_tag="NGO_0234"
FT   CDS_pept        complement(235369..236544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0234"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /note="catalyzes the oxygen-independent formation of
FT                   protoporphyrinogen-IX from coproporphyrinogen-III"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88987"
FT                   /db_xref="GOA:Q5FA00"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FA00"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002257847.1"
FT                   /protein_id="AAW88987.1"
FT                   /translation="MHTISFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGL
FT                   PEAAYIDALLTDLQLELPNIWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPE
FT                   AEITLEANPGTVEIEKFQGFKDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATA
FT                   LKLFDKVNIDLMYALPNQTVQTALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKGL
FT                   PQDEAALDIEDAVHGTLEGAGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGK
FT                   ISYPDRIERTVRRRHPNDYLALMQSQPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAA
FT                   MLQERTGVPAAKIMVQIETARQKGLLETDPTVFRPTEKGRLFLNDLLQCFL"
FT   gene            complement(236601..239090)
FT                   /locus_tag="NGO_0235"
FT   CDS_pept        complement(236601..239090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0235"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88988"
FT                   /db_xref="GOA:Q5F9Z9"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Z9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F9Z9.1"
FT                   /protein_id="AAW88988.2"
FT                   /translation="MNLYESMNPTAQRIHELTDLLNRYAYEYYTLDAPSIPDAEYDRLF
FT                   RELEALERNHPELKLPDSPTQRVGGEPLAGFAEVRHEVPMLSLTNAFSPQDENGVFDHA
FT                   EMYAFDQRVRDGLDGGNPEYVIEPKFDGLAISLLYRDGVLVQAATRGDGTTGEDVTRNV
FT                   KTVSNIPLRLHGENVPELIEVRGEVLMLKADFAALNQRQTENGQKPFANPRNAAAGSLR
FT                   QLDSRITAQRKLHFFPYSVARQQGGLIAEEHIQELAYFQALGFSLPNGNFGCFKNIGEV
FT                   LAFYEHMQQKRPELPYEIDGTVVKVNSLAQQHELGFISRAPRWAVAHKFPAEEALTIVE
FT                   AIDVQIGRTGAVTPVARLQPVFVGGVTVTNATLHNQDEVSRKDVRVGDTVVVRRAGDVI
FT                   PEVVRVIFERRPMQETAVAVSDGIGHQQDDLFAETPSAKQTESVPLHKPYRLPARCPIC
FT                   RSEIEREEGEAVARCSGGMLCQAQRAQGLIHFASRKAMDIDGLGEKQIEQLVAQDLVRH
FT                   FADLYRIDIPTLQKMKETADKGSSENENGDAETVSGDLSKYNTQNGKKQPTKWAQNILA
FT                   GIESGKTPELARFLFALGIRHVGERTAKTLAQAFGTLERVRRAPEPVLACLPDIGTVVA
FT                   RSIAHFFAQAEQQAMIDELLAAGVAPQAQAVSLPAAQYAGPQRWITRLPGFKISENKAQ
FT                   ALWELAGQSIEGLQNDKALPADWQAWRSKAQNTALLENLKTFFAQMPSEDEAAQGSDGI
FT                   NKAVAGKTFVLTGTLPTFKRDQAQALIEAAGGKVSGSVSKKTDYVVAGETAGSKLEKAN
FT                   ALGVSVLSEAELLTLLC"
FT   gene            complement(239206..240492)
FT                   /locus_tag="NGO_0236"
FT   CDS_pept        complement(239206..240492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0236"
FT                   /product="cell division protein ZipA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88989"
FT                   /db_xref="GOA:Q5F9Z8"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Z8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359823.1"
FT                   /protein_id="AAW88989.1"
FT                   /translation="MIYIVLFLAAVLAVVAYNMYQENQYRKKVRDQFGHSDKDALLNSK
FT                   TSHVRDGKPSGGPVMMPKPQPAVKKPAKPQDSAMRNLQEQDAVYIAKQKQAKASPFKTE
FT                   IETALEEIGIIGNSAHTVSEPQTGHSAPKPADAPAKPVPVPQTPAKPLITLKELSKVEL
FT                   PWFDVRFDFISYIALTEAKELHALPRLSNRCRYQIVGCTMDDHFQIAEPIPGIRYQAFI
FT                   VGIQAVSRNGLASQEELSAFNRQADAFAQSMGGQTLHTDLAAFIEVASALDAFCARVDQ
FT                   TIAIHLVSPTSISGVELRSAVTGVGFVLEDDGAFHYTDTSGSTMFSICSLNNEPFTNAL
FT                   LDNQSYKGFSMLLDIPHSPAGEKTFDDLFMDLAVRLSGQLNLNLVNDKMEEVSTQWLKD
FT                   VRTYVLARQSEMLKVGIEPGGKTALRLFS"
FT   gene            complement(240686..241258)
FT                   /locus_tag="NGO_0237"
FT   CDS_pept        complement(240686..241258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0237"
FT                   /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88990"
FT                   /db_xref="GOA:Q5F9Z7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Z7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687579.1"
FT                   /protein_id="AAW88990.1"
FT                   /translation="MDNHAGAHWQNGWLQSIRHTPSPNFSPRETGETVSLIVLHNISLP
FT                   PFEYGTDAVEKLFANRLDPDGHPFFSLIHTLHVSSHFLIARDGETVQFVSCGDMAYHAG
FT                   ASSFRGREKCNAFSIGIELEGCDFEPFAEAQYRSLETLLAALCRRYPITAVTGHQDIAP
FT                   GRKTDPGHFFDWRRIREKGFPVDRNAV"
FT   gene            241342..242338
FT                   /pseudo
FT                   /locus_tag="NGO_0238"
FT                   /note="aminodeoxychorismate lyase"
FT   gene            242398..243018
FT                   /gene="tmk"
FT                   /locus_tag="NGO_0239"
FT   CDS_pept        242398..243018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="NGO_0239"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="catalyzes the reversible phosphoryl transfer from
FT                   adenosine triphosphate (ATP) to thymidine monophosphate
FT                   (dTMP) to form thymidine diphosphate (dTDP)"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88992"
FT                   /db_xref="GOA:Q5F9Z5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Z5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003754064.1"
FT                   /protein_id="AAW88992.1"
FT                   /translation="MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPV
FT                   GEALREILLNPETKAGLRAETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQ
FT                   GGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMARIGQAREKDRFEQEQADFFM
FT                   RVRGVYLDRAAACPERYAVIDSNRSLDEVRNSIEKVLDGHFGC"
FT   gene            243240..244511
FT                   /pseudo
FT                   /locus_tag="NGO_0240"
FT                   /note="malic enzyme"
FT   gene            244633..244836
FT                   /locus_tag="NGO_0241"
FT   CDS_pept        244633..244836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88994"
FT                   /db_xref="GOA:Q5F9Z3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Z3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690725.1"
FT                   /protein_id="AAW88994.1"
FT                   /translation="MAIYPKLQNKPPPVMTTGQWVLTMIVFMIPLVNIVMFFVWAFGRG
FT                   NPNRANFCKALFLFTLLVRLSV"
FT   gene            244922..245953
FT                   /locus_tag="NGO_0242"
FT   CDS_pept        244922..245953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0242"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88995"
FT                   /db_xref="GOA:Q5F9Z2"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Z2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702330.1"
FT                   /protein_id="AAW88995.1"
FT                   /translation="MPNFFKFHTVIERHWQKPYPVLSFLLKPLSGLFAKIAAKWRADFL
FT                   SGKRQSEKLSVPVVVVGNIHAGGTGKTPIAAALVSGLQEKGVKVGIISRGYGRKSKAVY
FT                   VLNAASRAEDAGDEPLLLFRKTGAPTAVGSSRVEAGRALLAAHPELELIVADDGLQHYA
FT                   LQRDVEIAVFPAADTGRTDLDLLPNGNLREPLSRLESVDAVVVGGRAADGFMPSEHLFG
FT                   SRIEAGAVYRLNRPSEKLDISTLSGKRVAAVAGIARPQRFFDTLTHMGIRLDQTVALPD
FT                   HADIFNRDLPPADVVLVTEKDAVKFSDGICTDNVWVLPVCAIIEPDLAEFVLERLEGVP
FT                   KAV"
FT   gene            246159..246692
FT                   /locus_tag="NGO_0243"
FT   CDS_pept        246159..246692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88996"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Z1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357100.1"
FT                   /protein_id="AAW88996.1"
FT                   /translation="MKLKTLLLPFAALALCANAFAAPPGDASLARWLDTQNFDRDIEKN
FT                   MIEGFNAGFKPYADKALAEMPEAKKDQAAEAFNRYRENVLKDLITPEVKQAVRNTLLKN
FT                   AREIYTQEEIDGMIAFYGSPVGQSVVAKNPRLIKKSMSEIAVSWTALSGKIARHHLPEF
FT                   TEELRRIICGGIVD"
FT   gene            246914..247096
FT                   /locus_tag="NGO_0244"
FT   CDS_pept        246914..247096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88997"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Z0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002242425.1"
FT                   /protein_id="AAW88997.1"
FT                   /translation="MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYM
FT                   LENEARALSEEELKA"
FT   gene            247093..247854
FT                   /locus_tag="NGO_0245"
FT   CDS_pept        247093..247854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0245"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88998"
FT                   /db_xref="GOA:Q5F9Y9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Y9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359827.1"
FT                   /protein_id="AAW88998.1"
FT                   /translation="MTEFVVLIPARLDSSRLPGKALADIHGKPMVVRVAEQAAKSKAAR
FT                   VVVATDHPDIQTACQAHGIEVVMTSNRHESGTTRLAEAAAALKLPPHLIVVNVQGDEPL
FT                   IAPELIDRTAEVLVENNVQMATAGHELHDFDELMNPNAVKVVLDKNGNAIYFSRAPIPY
FT                   PRDAMRAGKREMPSETAVLRHIGIYAYRVGFLQRYAEMSVSPLETIESLEQLRVLWHGY
FT                   PIAVETAKEAPAAGVDTQEDLDRVRAVFQTV"
FT   gene            247877..248173
FT                   /locus_tag="NGO_0246"
FT   CDS_pept        247877..248173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0246"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAW88999"
FT                   /db_xref="GOA:Q5F9Y8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Y8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017146733.1"
FT                   /protein_id="AAW88999.1"
FT                   /translation="MQQHIEKWQHLSREEQKILAEVWGLVQNDDQEVHYEMLKLNAPDE
FT                   VSGEFWFRMAETLSTLPPNRSLDLRMNGGRLSTAVSILSVMIEDNPDIPQLWA"
FT   gene            248195..248392
FT                   /locus_tag="NGO_0247"
FT   CDS_pept        248195..248392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0247"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89000"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Y7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690727.1"
FT                   /protein_id="AAW89000.2"
FT                   /translation="MVHGHKARADGLVQQPDKAAEANEEEYLTKALSQNLLSTLDAALA
FT                   RFPEDAWFQEIKQDAQKHFA"
FT   gene            248370..248486
FT                   /locus_tag="NGO_01330"
FT   CDS_pept        248370..248486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01330"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISL2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687592.1"
FT                   /protein_id="AKO63609.1"
FT                   /translation="MHKSILLEDVAVRNISIQEEKKCLIGYNQGKSYFISED"
FT   gene            248549..248641
FT                   /locus_tag="NGO_18806"
FT   tRNA            248549..248641
FT                   /locus_tag="NGO_18806"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:248583..248585,aa:Ser,seq:gct)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            248915..249700
FT                   /locus_tag="NGO_0248"
FT   CDS_pept        248915..249700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0248"
FT                   /product="tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89001"
FT                   /db_xref="GOA:Q5F9Y6"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Y6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690728.1"
FT                   /protein_id="AAW89001.1"
FT                   /translation="MSRIRQAFAALDGGKALIPYIAVGDPDIRTTLALMHGMVASGADI
FT                   LELGVPFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPI
FT                   HKMGYREFAQEAAKAGVDGVLTVDSPIETIDSLYRELKDNEVDCIFLIAPTTTEDRIKT
FT                   IAELAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLRQYIDIPIGVGFGISNAESARKIG
FT                   RVAAAIIVGSRIVKEIENNAGNEAAAVGALVKELKDAVR"
FT   gene            249737..250609
FT                   /locus_tag="NGO_0249"
FT   CDS_pept        249737..250609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0249"
FT                   /product="acetyl-CoA carboxylase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89002"
FT                   /db_xref="GOA:Q5F9Y5"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Y5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687594.1"
FT                   /protein_id="AAW89002.1"
FT                   /translation="MSWLDKILPPKIKNRGKDGASNVPEGLWRKCPSCSATVYSTELQQ
FT                   NNQVCPKCNHHNPLSARQRLNLLLDEEGREEVAGNVKPTDPLKFKDSKKYPDRLSAARK
FT                   LTGEDDALVVMKGMMNGLPVVVAAFEFRFIGGSMGSVVGERFVQGVRRAVADNCPFVCV
FT                   AASGGARMQEGVNSLMQMTKTSAALHLLTEKRLPFISVLTDPTMGGVSASFAFLGDVVL
FT                   AEPNALIGFAGPRVIEQTVRETLPEGFQRAEFLLEKGAIDQIVDRRDMKRRISDLITLL
FT                   CRQDKVSAT"
FT   gene            complement(250669..251280)
FT                   /locus_tag="NGO_0250"
FT   CDS_pept        complement(250669..251280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0250"
FT                   /product="Clp protease ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89003"
FT                   /db_xref="GOA:Q5F9Y4"
FT                   /db_xref="InterPro:IPR014861"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Y4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002236809.1"
FT                   /protein_id="AAW89003.1"
FT                   /translation="MRRAILLILTLTVGTSLAAGFSQKDTPINTRYRETPEEAAAREFK
FT                   EHTAELPPLPDAHSDGWFDIYVDENYGKQPKILLDSLQIMPAPDGSIRYILNIRSDKGY
FT                   DNLTAEGIFCARSSIGFGNGKLSSYKVFGYGDTVNSRWIQPRNAEWKPIGGTLGRNDAL
FT                   RAVLYQAFCEGGVPADTQGLVQRLKERAGRYAPSMKPHDK"
FT   gene            251388..251612
FT                   /locus_tag="NGO_01355"
FT   CDS_pept        251388..251612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01355"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63610"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IV00"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003714726.1"
FT                   /protein_id="AKO63610.1"
FT                   /translation="MNSETLDVTGLKCPLPILRAKKALAQMRQGEVLTVLATDGGAPGD
FT                   FEAFCRQTGHVLLDSSEQDGVFTLVVKHK"
FT   gene            251643..252026
FT                   /pseudo
FT                   /locus_tag="NGO_0252"
FT                   /note="hypothetical protein"
FT   gene            complement(252030..252518)
FT                   /locus_tag="NGO_0253"
FT   CDS_pept        complement(252030..252518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89005"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Y2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012504151.1"
FT                   /protein_id="AAW89005.2"
FT                   /translation="MTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKARISGKR
FT                   YRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNARFRRMG
FT                   ALRGTAEKLGHKVLPPAPCSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSYFDFN"
FT   gene            complement(252826..253029)
FT                   /pseudo
FT                   /locus_tag="NGO_01370"
FT                   /note="hypothetical protein; disrupted"
FT   gene            253334..254368
FT                   /locus_tag="NGO_0255"
FT   CDS_pept        253334..254368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0255"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="catalyzes the formation of N-carbamoyl-L-aspartate
FT                   from (S)-dihydroorotate in pyrimidine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89006"
FT                   /db_xref="GOA:Q5F9Y1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Y1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687600.1"
FT                   /protein_id="AAW89006.1"
FT                   /translation="MQTLTIIRPDDMHLHLRDGDALKAVAPYTARQMGRAVIMPNLKPP
FT                   VVSVADALAYKARIMAALPEGSAFEPLMTLYLTDQATPELVREAKAAGIVAFKLYPAGA
FT                   TTNSDSGVTDLFKLIPVLEEMAKQGILFLVHGEVTDPEIDIFDREAAFIGRVMKPVLAQ
FT                   VPNLKVVFEHITTAEAARLVLEAGDNVAATVTPQHLLLNRNDLLVGGVRPHHFCLPVLK
FT                   RETHRQALVAAVTGEKAHKFFLGTDSAPHAKSAKENACGCAGMFSAMTAIELYAEVFEK
FT                   AGALDKLEAFASKNGARFYGIPENADTITLVKQSQTVPASVPYGDGELVPMRAGGEIGW
FT                   TVQY"
FT   gene            complement(254447..254872)
FT                   /locus_tag="NGO_0256"
FT   CDS_pept        complement(254447..254872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0256"
FT                   /product="antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89007"
FT                   /db_xref="GOA:Q5F9Y0"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Y0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003714720.1"
FT                   /protein_id="AAW89007.1"
FT                   /translation="MKTARRRSRELAVQAVYQSLINRTAAPEIAKNIREMSDFAKADEE
FT                   LFNKLFFGTQTNAADYIQKIRPLLDRDEKDLNPIERAVLLTACHELSAMPETPYPVIIN
FT                   EAIEVTKTFGGTDGHKFVNGILDKLAAQIRPDEPKRR"
FT   gene            complement(254950..255426)
FT                   /locus_tag="NGO_0257"
FT   CDS_pept        complement(254950..255426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0257"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89008"
FT                   /db_xref="GOA:Q5F9X9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9X9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003700969.1"
FT                   /protein_id="AAW89008.1"
FT                   /translation="MNTIAPNLDGKHLRIGIVQARFTNEIGSQMLKVCCRTLQELGVAD
FT                   ENITVATVPGALEIPIALMNFASSEKFDALIAIGVVIRGETYHFELVANESGAGIGRVA
FT                   LDYNIPIANAVLTTENDAQAIERIGEKASDAAKVAVECANLVNLLLEEQFEDEE"
FT   gene            complement(255473..255796)
FT                   /locus_tag="NGO_0258"
FT   CDS_pept        complement(255473..255796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89009"
FT                   /db_xref="InterPro:IPR018689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9X8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002229184.1"
FT                   /protein_id="AAW89009.1"
FT                   /translation="MNAFAQALSSALDRCIATNTVAKQNRPVGFLYREAPVFENDSGWR
FT                   FFSGDETDEYTDDPDNFSIVSLADITKTNPETAALLSQPEGSAWELAEDGTFQTVADWQ
FT                   PQD"
FT   gene            255967..256686
FT                   /locus_tag="NGO_0259"
FT   CDS_pept        255967..256686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0259"
FT                   /product="ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89010"
FT                   /db_xref="GOA:Q5F9X7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9X7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002221273.1"
FT                   /protein_id="AAW89010.1"
FT                   /translation="MKDDVLKRQAHTAIQKKLGYAFRDMSLLRRALTHRSHHAKHNERF
FT                   EFVGDSILNYTVARMLFDAFPKLTEGELSRLRASLVNEGVLAEMAAEMNVGDGLYLGAG
FT                   ELKSSGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFAERVRRADFQNQAKDGKT
FT                   ALQEALQARRFALPKYRIEEQIGHADDSMFVISCDLGELGFVCRAKGTSRKAAEQEAAK
FT                   EALKWLEEKLPLKKKKK"
FT   gene            256733..257656
FT                   /locus_tag="NGO_0260"
FT   CDS_pept        256733..257656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0260"
FT                   /product="GTPase Era"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89011"
FT                   /db_xref="GOA:Q5F9X6"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9X6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357134.1"
FT                   /protein_id="AAW89011.2"
FT                   /translation="MDIETFLAGERAAGGYRCGFVAIVGRPNVGKSTLMNHLIGQKISI
FT                   TSKKAQTTRNRVTGIYTDDTAQFVFVDTPGFQTDHRNALNDRLNQNVTEALGGVDVVVF
FT                   VVEAMRLTDADRVVLKQLPKHTPVILVINKIDKDKAKDRYALEAFVAQVRAEFEFAAAE
FT                   AVSAKHGLRIANLLELLKPYLPESVPMYPEDMVTDKSARFLAMEIVREKLFRYLGEELP
FT                   YAMNVEVEQFEEGDGLNRIYIAVLVDKESQKAILIGKGGERLKKISTEARLDMEKLFDN
FT                   KVFLKVWVKVKSGWADDIRFLRELGL"
FT   gene            257796..260114
FT                   /pseudo
FT                   /locus_tag="NGO_01405"
FT                   /note="ligand-gated channel; disrupted"
FT   gene            complement(260589..261215)
FT                   /locus_tag="NGO_0261"
FT   CDS_pept        complement(260589..261215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0261"
FT                   /product="N-(5'-phosphoribosyl)anthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89012"
FT                   /db_xref="GOA:Q5F9X5"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9X5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F9X5.1"
FT                   /protein_id="AAW89012.1"
FT                   /translation="MRKIRTKICGITTPEDALYAAHAGADALGLVFYPQSPRAIDIIKA
FT                   QKIAAALPPFVSVVALFVNESAQNIRRILAEVPIHIIQFHGDEDDAFCRQFDRPYIKAI
FT                   RVQTASDIRNAATRFPNAQALLFDAYHPSEYGGTGHRFDWTLLAEYSGKPWVLAGGLTP
FT                   ENVGEAVRITGAEAVDVSGGVEASKGKKDPAKVAAFIATANRLSR"
FT   gene            complement(261274..261765)
FT                   /locus_tag="NGO_0262"
FT   CDS_pept        complement(261274..261765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0262"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89013"
FT                   /db_xref="GOA:Q5F9X4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9X4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003713818.1"
FT                   /protein_id="AAW89013.1"
FT                   /translation="MSTETKNYITPAGWQALKDELYQLVNKERPEIVQIVNWAAGNGDR
FT                   SENGDYLYGKRRMREIDRRIRFLTKRLEAAVVVDPELREATDQVFFGATVGLLRGDGRE
FT                   QTVKIVGVDEIDTAQNKISWISPLARCLIKAREGDEVVLNTPEGREEIEILSVEYIKID
FT                   "
FT   gene            complement(261865..263409)
FT                   /locus_tag="NGO_0263"
FT   CDS_pept        complement(261865..263409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0263"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89014"
FT                   /db_xref="GOA:Q5F9X3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9X3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359831.1"
FT                   /protein_id="AAW89014.1"
FT                   /translation="MCGVLGLVSHEPVNQLLYDGLQMLQHRGQDAAGIATAEGGTFHMH
FT                   KGKGMVSEVFRTRNMRDLTGNAGIAHVRYPTAGNAGSSAEAQPFYVSSPFGIVLAHNGN
FT                   LTNTAELYENVCNKHLRHINTGSDSEVLLNVFAHELRREVSKNADPHRLNADNIFNAVA
FT                   EVHRLVRGAYGVVAMIAGYGMLAFRDPYGIRPLALGSQTDSEGRKSYAVASESVAFNAL
FT                   AYDLERDIRPGEAVFVGFNGTIIARQCSDRAKLSPCLFEYVYFARPDSVIDGVSVYQSR
FT                   LDMGVSLAEKIKRELPVDGIDVVMPIPDTSRPSAMELAVHLNKPYREGLIKNRYIGRTF
FT                   IMPGQSTRKKSVRQKLSPMETEFAGKSVLLVDDSIVRGTTSREIVEMVRAAGARKVYIA
FT                   SAAPEVRYPNVYGIDMPTREELIANGRSAAEIAAEIGADGIVFQDLGDLEAVVKALNPK
FT                   IESFDSSCFNGIYRTGDIDDAYLDRLSAEKSGCAGLKIHPSRMEHSISISDAGDEE"
FT   gene            complement(263603..264100)
FT                   /locus_tag="NGO_0264"
FT   CDS_pept        complement(263603..264100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0264"
FT                   /product="colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89015"
FT                   /db_xref="GOA:Q5F9X2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9X2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687616.1"
FT                   /protein_id="AAW89015.1"
FT                   /translation="MNSLPIADLLASAVIAACIVISTMRGVIAEAGSMVAWVVSFFFAK
FT                   LFAAPFADLAFASFQPRLFALALSFISLFVIACLIQKMLRSLLTGAVSAVGLGFANRIL
FT                   GGVFGALKGVLIVTLLIMLASKTDLPDTEEWQQSYTVPFFVSLSEAVLNHTDNAPESLD
FT                   DD"
FT   gene            complement(264093..265133)
FT                   /locus_tag="NGO_0265"
FT   CDS_pept        complement(264093..265133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0265"
FT                   /product="cell division protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89016"
FT                   /db_xref="GOA:Q5F9X1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9X1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687618.1"
FT                   /protein_id="AAW89016.1"
FT                   /translation="MSENKQNEVLTGYEQLKRRNRRRLVTASSLVAASCILLAAALSSD
FT                   PADSNPAPQAGETGATESQTANTAQTPALKSAAENGETAADKPQDLAGEDKPSAADSEI
FT                   SEPENVGAPLVLINDRLEDSNIKGLEESEKLQQAETAKTEPKQAKQRAAEKVSATADST
FT                   DTVAVEKPKRTAEPKPQKAERTAEAKPKAKETKTAEKVADKPKTAAEKTKPDTAKSDSA
FT                   VKEAKKADKAEGKKTAEKDRSDGKKHETAQKTDKADKTKTAEKEKSGKAGKKAAIQAGY
FT                   AEKERALSLQRKMKAAGIDSTITEIMTDNGKVYRVKSSNYKNARDAERDLNKLRVHGIA
FT                   GQVTNE"
FT   gene            complement(265147..266421)
FT                   /locus_tag="NGO_0266"
FT   CDS_pept        complement(265147..266421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0266"
FT                   /product="folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89017"
FT                   /db_xref="GOA:Q5F9X0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9X0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003753247.1"
FT                   /protein_id="AAW89017.1"
FT                   /translation="MKTLQDWLSHLETAHSGGLIDMGLERVSEVKKRMNLTPQCPVVVV
FT                   AGTNGKGSVCAYLTQIYKQAGFKTGTLTSPHLLHYNERIAINAEPVSDDTIIASFERIE
FT                   AARGEISLTYFEFNALAAVDIFIREQVDVMILEVGLGGRLDAVNAFDGDCAVVTSVDLD
FT                   HQAFLGDTVEQVGFEKAGVFRSGKPAICGQNPAPASLVAHAEAIGAKLLMVQRDFEFHA
FT                   MENIQWNYRFRPQHSDGPARNRNALPFPALRGAYQLSNAACALTVLECLDDRLPVDIGA
FT                   IKRGLLLVENPGRFQVLPGRPLTVLDVGHNPHAARALRRNLINLAYAQKRTAVFSMLSD
FT                   KDIDGVSETVKDQFDEWYIAPLDVPRGMTADALKAKLEQHHIENIQTFAAVRDAYRAAA
FT                   SKAGEDDRIVVFGSFHTVADVMSVL"
FT   gene            complement(266452..266892)
FT                   /locus_tag="NGO_0267"
FT   CDS_pept        complement(266452..266892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0267"
FT                   /product="transcriptional regulator FolI"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89018"
FT                   /db_xref="GOA:Q5F9W9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9W9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002232011.1"
FT                   /protein_id="AAW89018.1"
FT                   /translation="MRAFQTALRPSRILNILTVSLHSASIAVCLTWFYGRMMWFGLAAL
FT                   AASYAYSLRITNLKHRHAITAITIDRDGRAEIVSGKDKTAATLAGSSMVTPYALFLQWD
FT                   TGGKTVRQCIMPDMTDKESYRRLKVWVLWRQPKKTAETDTSD"
FT   gene            complement(266897..267256)
FT                   /locus_tag="NGO_0268"
FT   CDS_pept        complement(266897..267256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89019"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9W8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003713806.1"
FT                   /protein_id="AAW89019.2"
FT                   /translation="MYFVDRTAAVLKPTARFLEWLKSTDENMPDLTIEQLRADCSVFLV
FT                   PQFDEPEAVVSYFDERYRQIFEAELAGWDIDKDKWPQDMGLKAFWEFFDIEIHDMVLDM
FT                   EEADLNITPVFDNMM"
FT   gene            complement(267329..268057)
FT                   /locus_tag="NGO_0269"
FT   CDS_pept        complement(267329..268057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0269"
FT                   /product="amino acid ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89020"
FT                   /db_xref="GOA:Q5F9W7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9W7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687626.1"
FT                   /protein_id="AAW89020.1"
FT                   /translation="MIKFKNVHKHFKDLHVINGVNLEIKKGEVVVVCGPSGSGKSTLIR
FT                   TVNQLESIESGEIWVDGVNVADPKTDLNKIREEVGFVFQSFNLYPHLTVLDNITLAPMK
FT                   VKGQNAEQAEKKAMELLERVGLAHKKDAFPSQLSGGQQQRVAIARGLAMEPRVMLFDEP
FT                   TSALDPEMVGEVLKVMKDLAESGMTMMCVTHEMGFAREVADRVIFVDKGQILEDETPEA
FT                   FFTNPKHERAKQFLQQVMTH"
FT   gene            complement(268099..268554)
FT                   /locus_tag="NGO_0270"
FT   CDS_pept        complement(268099..268554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9W6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014580113.1"
FT                   /protein_id="AAW89021.1"
FT                   /translation="MKYTAALLTFLLTACMNPNDAFFQNRRYQMPEAQLNGSNAVFHYG
FT                   YSQNPDHDLLVDQVRVPDAYRASFARDWIAKEQGYRKNDCVLEKAESGGVTYYTCDAEK
FT                   GFNGTRFVIYVVNMKNDKGYVKVYRGMNKPNQEELTKLVADLNKFYP"
FT   gene            complement(268665..269234)
FT                   /locus_tag="NGO_0271"
FT   CDS_pept        complement(268665..269234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0271"
FT                   /product="GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89022"
FT                   /db_xref="GOA:Q5F9W5"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9W5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687630.1"
FT                   /protein_id="AAW89022.1"
FT                   /translation="MESNLQKTERLIREINRLHAQYSQDYFETGKVRKINLSHTLKNVP
FT                   TEHILSYRLNLHEAVNDYLAFADTRGIDFFYRVKTAESIHDKINRYLARGTQYPTNNIL
FT                   NDIFGARLIWPSETVAGILEKLDGWKTEYGLKNWYLRDAGGYIGIHIYFKNSSNFYYPW
FT                   ELQVWDEKDAKANIENHMAYKRNFVR"
FT   gene            complement(269249..270028)
FT                   /locus_tag="NGO_0272"
FT   CDS_pept        complement(269249..270028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0272"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89023"
FT                   /db_xref="GOA:Q5F9W4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9W4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B4RJV5.1"
FT                   /protein_id="AAW89023.1"
FT                   /translation="MKEHKARKRFGQNFLQDTRIIGDIVNAVRPQADDVVIEIGPGLAA
FT                   ITEPLAKKLNRLHVVEIDRDIVCRLKTLPFADKLVIHEGDVLQFDFNGISGKKKIVGNL
FT                   PYNISTPLLFKLAEVADDVADMHFMLQKEVVERMVAAPKSNDYGRLGVMLQYFFDMELL
FT                   IDVPPESFDPAPKIDSAVVRMIPVKHRIGKADDFDHFAKLVKLAFRQRRKTIRNNLKEL
FT                   ADDDDLQAVGISPQDRAEHIAPEKYVALSNYLADKAV"
FT   gene            270304..270933
FT                   /locus_tag="NGO_01470"
FT   CDS_pept        270304..270933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01470"
FT                   /product="DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01470"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63611"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRM7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357144.1"
FT                   /protein_id="AKO63611.1"
FT                   /translation="MSENLLEIETHPFDPVLPPKAAVMMMGTFPPKEDKRAMQFHYPNF
FT                   QNDMWRVYGLVFFNDAAHFRMPSHGEAAHSEKAFDAEKIKAFLHERGIASCPTVLKAAR
FT                   EHGNASDKFLKVVETVDLAAVLAKIPDCRHICTTGGKATEILLDIQGGGIKMPKTGETV
FT                   PFPFAGRDLTLTRLPSTSRAYPLSLAKKAAAYRAFFEMAGLCEKQL"
FT   gene            271016..272218
FT                   /locus_tag="NGO_0274"
FT   CDS_pept        271016..272218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0274"
FT                   /product="tryptophan synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89024"
FT                   /db_xref="GOA:Q5F9W3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9W3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019272912.1"
FT                   /protein_id="AAW89024.1"
FT                   /translation="MKNYHAPDEKGFFGEHGGLYVSETLIPALKELEQAYNEAKNDPEF
FT                   WAEFRRDLKHYVGRPSPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAR
FT                   RMGKKRVIAETGAGQHGVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVIG
FT                   VDSGSRTLKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQ
FT                   EATGRQPDVAVACVGGGSNAIGLFYPYIEEENVRLVGVEAGGLGVDTPDHAAPITSGAP
FT                   IGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALE
FT                   AFDLLCRFEGIIPALESSHAVAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIE
FT                   L"
FT   gene            complement(272294..277075)
FT                   /locus_tag="NGO_0275"
FT   CDS_pept        complement(272294..277075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0275"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89025"
FT                   /db_xref="GOA:Q5F9W2"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030396"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9W2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003700978.1"
FT                   /protein_id="AAW89025.1"
FT                   /translation="MKAKRFKINAISLSIFLAYALTPYSEAALVRDDVDYQIFRDFAEN
FT                   KGKFFVGATDLSVKNKRGQNIGNALSNVPMIDFSVADVNKRIATVVDPQYAVSVKHAKA
FT                   EVHTFYYGQYNGHNDVADKENEYRVVEQNNYEPHKAWSASNLGRLEDYNMARFNKFVTE
FT                   VAPIAPTDAGGGLDTYKDKNRFSSFVRIGAGRQLVYEKGVYHQEGNEKGYDLRDLSQAY
FT                   RYAIAGTPYKDINIDQTMNTEGLIGFGNHNKQYSAEELKQALSQDALTNYGVLGDSGSP
FT                   LFAFDKQKNQWVFLGTYDYWAGYGKKSWQEWNIYKKEFADKIKQHDNAGTVKGNGEHHW
FT                   KTTGTNSHIGSTAVRLANNEGDANNGQNVTFEDNGTLVLDQNINQGAGGLFFKGDYTVK
FT                   GANNDITWLGAGIDVADGKKVVWQVKNPNGDRLAKIGKGTLEINGTGVNQGQLKVGDGT
FT                   VILNQKADSNQKVQAFSQVGIVSGRGTLVLNSPDQINPNNLYFGFRGGRLDANGNDLTF
FT                   EHIRNVDEGARIVNHNTDHASTITLTGKSLITNPNSLSVHSIQNDYDEDNYSYYYRPRR
FT                   PIPQGKDLYYKNYRYYALKSGGSVNAPMPENGQTENNDWILMGSTQEEAKKNAMNHKNN
FT                   QRISGFSGFFGEENGKGHNGALNLNFNGKSAQNRFLLTGGANLNGKISVTQGNVLLSGR
FT                   PTPHARDFVNKSSARKDAHFSKNNEVVFEDDWINRTFKAAEIAVNQSASFSSGRNVSDI
FT                   TANITATDNAKVNLGYKNGDEVCVRSDYTGYVTCNTGNLSDKALNSFDATRINGNVNLN
FT                   QNAALVLGKAALWGQIQGQGNSRVSLNQHSKWHLTGDSQVHNLSLADSHIHLNNASDAQ
FT                   SANKYHTIKINHLSGNGHFHYLTDLAKNLGDKVLVKESASGHYQLHVQNKTGEPNQEGL
FT                   DLFDASSVQDRSRLFVSLANHYVDLGALRYTIKTENGITRLYNPYAGNRRPVKPAPSPA
FT                   ANTASQAQKATQTDGAQIAKPQDIVVAPPSPQANQAEEAKRQQAKAEQVKRQQAEAGRK
FT                   SAELSAKQRAGEEERRQTAQSQPQRRKRRAAPQDYMAVSQDRPKRRGHRSVQQNNVEIA
FT                   QAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRKAEAEEAKHQAAELAHRQEAK
FT                   RKAAESAKRKAEEEEHRQTAQSQPQRRKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSP
FT                   SFDSSAYAAPRALHNPDWYENDYEEIPLDALEDEDVSESVDTSDKQPQDNTELHEKVEA
FT                   VSLQPRAAQPRTQAAAQADAVSTNTNSALSDAMASTQSILLDTGASLTRHIAQKSRADA
FT                   EKNSVWMSNTGYGRDYASAQYRRFSSKRTQTQIGIDRSLSENMQIGGVLTYSDSQHTFD
FT                   QAGGKNTFVQANLYGKYYLNDAWYVAGDIGAGSLRSRLQTQQKANFNRTSIQTGLTLGN
FT                   TLKINQFEIVPSAGIRYSRLSSADYKLGDDSVKVSSMAVKTLTAGLDFAYRFKVGNLTV
FT                   KPLLSAAYFANYGKGGVNVGGKSFAYKADNQQQYSAGAALLYRNVTLNVNGSITKGKQL
FT                   EKQKSGQIKIQIRF"
FT   gene            277401..279680
FT                   /locus_tag="NGO_0276"
FT   CDS_pept        277401..279680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0276"
FT                   /product="competence protein ComA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89026"
FT                   /db_xref="GOA:Q5F9W1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9W1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704430.1"
FT                   /protein_id="AAW89026.2"
FT                   /translation="MTVLWLCFIIVCFLYREWGDVFRRWFLPCWVVGVAVSFALSVVPH
FT                   WPFWLAAFAVLAVLARRFAFAGLMLCVLAGAAYGVFRTEAALSSQWRAEAVSGVPLTVE
FT                   VTDMPRSDGRRVQFAAKAVDSGGRTFDLLLSDYKRREWAVGSRWRITARVHPVVGELNL
FT                   RGLNREAWALSNGVGGVGTVGADRVLLHGGSGWGIAVWRSRISRNWRQADADGGLSDGI
FT                   GLMRALSVGEQSALRPELWQAFRPLGLTHLVSISGLHVTMVAVLFAWLAKRLLACSPRL
FT                   PARPRAWVLAAGCAGALFYALLAGFSVPTQRSVLMLAAFAWAWRRGRLSAWATWWQALA
FT                   AVLLFDPLAVLGVGTWLSFGLVAALIWACAGCLYEGKRQTAVRGQWAASVLSLVLLGYL
FT                   FASLPLVSPLVNAVSIPWFSWVLTPLALLGSVVPFAPLQQAGAFLAEYTLRFLVWLADV
FT                   SPEFAVAAAPLPLLVLAVCAALLLLLPRGLGLRPWAVLLLAGFVSYRPEAVPENEAAVT
FT                   VWDAGQGLSVLVRTANRHLLFDTGTVAAAQTGIVPSLNAAGVRRLDKLVLSHHDSDHDG
FT                   GFQAVGKIPNGGIYAGQPEFYEGARHCAEQRWQWDGVDFEFLRPSERKNIDDNGKSCVL
FT                   RVVAGGAALLVTGDLDTKGEESLVGKYGGNLYSQVLVLGHHGSNTSSSGVFLNAVSPEY
FT                   AVASSGYANAYKHPTEAVQNRVRAHGIKLLRTDLSGALQFGLGRGGVKAQRLRVYKFYW
FT                   QKKPFE"
FT   gene            complement(279750..280553)
FT                   /locus_tag="NGO_0277"
FT   CDS_pept        complement(279750..280553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0277"
FT                   /product="competence protein ComL"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89027"
FT                   /db_xref="GOA:Q5F9W0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="PDB:5WAQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9W0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9K0B1.1"
FT                   /protein_id="AAW89027.1"
FT                   /translation="MKKILLTVSLGLALSACATQGTADKDAQITQDWSVEKLYAEAQDE
FT                   LNSSNYTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIERFRRLHPQ
FT                   HPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAFAELVQRFPNSKYA
FT                   ADATARMVKLVDALGGNEMSVARYYMKRGAYIAAANRAKKIIGSYQNTRYVEESLAILE
FT                   LAYKKLDKPQLAADTRRVLETNFPKSPFLTHAWQPDDMPWWRYWH"
FT   gene            280552..281676
FT                   /locus_tag="NGO_0278"
FT   CDS_pept        280552..281676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0278"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89028"
FT                   /db_xref="GOA:Q5F9V9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002258136.1"
FT                   /protein_id="AAW89028.1"
FT                   /translation="MQNTSFDNESDYSDDSDFASASGTENRIGLTVPLELAGGRLDAVL
FT                   AKLLPDYSRSRLTSWIKEGAVIVNDKPSQPKDKMIGGEQICVTVRPSEENLAFVPEPMD
FT                   LDIVYEDDTVIVVNKPAGLVVHPAAGNWTGTLLNGLLAHCPELSQIPRAGIVHRLDKET
FT                   SGLMVVAKTLPAQNSLVRQLQERTVKRIYRAVANGIVPFDGKIETQIGRDPHNRLKMAA
FT                   VKFGGKPAVTHVKVLERYLAHSYIECSLGTGRTHQIRVHMREANHPLAGDPVYGNPRHP
FT                   CGDTVKEAVKSLGARQALHAYRLSFTHPESGETVSFEAPIPDDIYHLLSVLRLEAGLDS
FT                   SLSNEEEWQDKFGADDDDDWNEDDYDVEVVYVRE"
FT   gene            complement(281803..282777)
FT                   /pseudo
FT                   /locus_tag="NGO_01500"
FT                   /note="sodium transporter; disrupted"
FT   gene            complement(282855..283046)
FT                   /locus_tag="NGO_01505"
FT   CDS_pept        complement(282855..283046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01505"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5D1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687649.1"
FT                   /protein_id="AKO63612.1"
FT                   /translation="MLQQGTAHQAPHCVLPERGCPPIRFYRYKQTGFNRKGMGIKSISD
FT                   TSRAMPSENQSPLSDGIV"
FT   gene            283231..284010
FT                   /locus_tag="NGO_0281"
FT   CDS_pept        283231..284010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0281"
FT                   /product="laccase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89030"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002242497.1"
FT                   /protein_id="AAW89030.1"
FT                   /translation="MKTITETLNLAPKGKNFLTADWPAPANVKTLITTRNGGVSQGAYQ
FT                   SLNLGTHVGDDPETVRRNREIVQQQVGLPVAYLNQIHSTIVVNAAEALDGTPDADASVD
FT                   DTGKAVCAVMTADCLPVLFCDRAGTAVAAAHAGWSGLAGGVLQNTIAAMKVPPVEIMAY
FT                   LGPAISADAFEVGQDVFDAFCTSMPEAAAAFEPIGGGKFLADLYALARLILKREGVGGV
FT                   YGGTHCTVLERDIFFSYRRDGATGRMASLIWLDGNAV"
FT   gene            284062..284541
FT                   /locus_tag="NGO_0282"
FT   CDS_pept        284062..284541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0282"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89031"
FT                   /db_xref="GOA:Q5F9V6"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704424.1"
FT                   /protein_id="AAW89031.1"
FT                   /translation="MNKIFLTAAALVLGACGFHLKGADGISPPLTYRSWHIEGGQALQF
FT                   PLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTRAAVINEYLLILTVEAQVLKR
FT                   GEPVGKPMTVSVRRILDYADNEILGKQEEEETLWAEMRQDVAEQIVRRLTFLKAE"
FT   gene            284543..285541
FT                   /locus_tag="NGO_0283"
FT   CDS_pept        284543..285541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0283"
FT                   /product="DNA polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89032"
FT                   /db_xref="GOA:Q5F9V5"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002230375.1"
FT                   /protein_id="AAW89032.1"
FT                   /translation="MAAHIGRIDTDAPLKPLYVIHGEEELLRIEAVDALRAAAKKQGYL
FT                   NREAYTADASFDWNELLQTAGNAGLFADLKLLELHIPNGKPGKNGGEALQDFAARLPED
FT                   TVTLVLLPKLEKTRLQSKWFAALAAKGEVWEAKPVGAAALPQWIRGRLDKIGLGIEADA
FT                   LALFAERVEGNLLAARQEIDKLALLYPKGHAVNIDEAQTAVANVARFDAFQLAGAWMKG
FT                   DVPRVCRLLDGLEEEGEEPVLLLWAVAEDVRTLIRLAAALKQGQSIQSVRNSLRLWGDK
FT                   QTLAPLAVKRISVVRLLDALKTCAQIDRIIKGAEDGDAWTVFKQLVVSLAE"
FT   gene            285662..286081
FT                   /locus_tag="NGO_0284"
FT   CDS_pept        285662..286081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0284"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89033"
FT                   /db_xref="GOA:Q5F9V4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002238945.1"
FT                   /protein_id="AAW89033.1"
FT                   /translation="MDNKTKLRLGGLILLTTAVLSLIIVLIVDSWPLAILLAAVIVAAA
FT                   AGGFVWTSRRQQRQFIERLKKFDIDPEKGRINEANLRRMYHSGGQHQKDAITLICLSQK
FT                   CSVDEAHAMFKKRPTRQEINQMAAKQSRGQKRPHR"
FT   gene            286157..286672
FT                   /locus_tag="NGO_0285"
FT   CDS_pept        286157..286672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0285"
FT                   /product="RDD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89034"
FT                   /db_xref="GOA:Q5F9V3"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002242491.1"
FT                   /protein_id="AAW89034.2"
FT                   /translation="MMILKTAPLKRRFAAILYEMLLVGAATCLAALLAGIAAIFLNPVS
FT                   IAVSALVTSILIMGAWWLYFRANWHGQGQTLAMRTWKIGLCDLNGIQPSLHLLRLRFIW
FT                   ACIFIVFIPMLAYAGLRHFLGIPPKGAAGAALVWLILPWGFALLNPDRQFLYDFLAGTR
FT                   LVDVKEQS"
FT   gene            complement(286763..287647)
FT                   /locus_tag="NGO_0286"
FT   CDS_pept        complement(286763..287647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89035"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219572.1"
FT                   /protein_id="AAW89035.1"
FT                   /translation="MSSGNIRIHSMTGFANAAAECGSKRINLDIRAVNHRFLDIQIRMP
FT                   DDLRHLENGIREQISSHLARGKVECKIQIQDAENGNQSLELNRVLVGQLAEINKNLRKH
FT                   YDLAKLGVADILRFPGVLASQKENTEALAKTIVELADKALKDFTAARRREGKKLGEHLL
FT                   QRIKNMEEIIDALSEIFPALVEAHKEKIRTRLAEAVGSIDNDRLQQEFALFIQKSDIDE
FT                   EFSRLRTHIAEVRRIVTEHKGSSGKRLDFLMQELNREANTLGSKSIATECTQASVELKV
FT                   LIEQMREQVQNIE"
FT   gene            287747..288223
FT                   /locus_tag="NGO_01540"
FT   CDS_pept        287747..288223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01540"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63613"
FT                   /db_xref="GOA:A0A0H4IW08"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IW08"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687659.1"
FT                   /protein_id="AKO63613.1"
FT                   /translation="MESRAFVAARKGNVSSKISKTRTGYGFFAKMIFASRWLQVPIYAG
FT                   LTVVRAICAYKFLKSLKHLVMNLDVSDENAIMLAVLNLIDVVMIANLLTMVQIGGYESF
FT                   VSRLRIDDHPDRPEWLSHVNAPVLKVRLSMSIIGIHPSICSKHLSIPPICRKSS"
FT   gene            complement(288380..289252)
FT                   /locus_tag="NGO_0288"
FT   CDS_pept        complement(288380..289252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0288"
FT                   /product="RNA polymerase factor sigma-32"
FT                   /note="binds with the catalytic core of RNA polymerase to
FT                   produce the holoenzyme; this sigma factor is responsible
FT                   for the expression of heat shock promoters"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89036"
FT                   /db_xref="GOA:Q5F9V1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581161.1"
FT                   /protein_id="AAW89036.1"
FT                   /translation="MPQMNNAFALPAIQSGNGSLEQYIHTVNSIPMLSQEEETRLAERR
FT                   IKGDLNAAKQLILSHLRVVVSIARGYDGYGLNQADLIQEGNIGLMKAVKRYEPGRGARL
FT                   FSFAVHWIKAEIHEFILRNWRLVRVATTKPQRKLFFNLRSMRKNLNVLSPKEAQDIADD
FT                   LGVKLSEVLEMEQRMTGHDIAIMADNSDDEDSFAPIDWLADHDSEPSRQLSKQAHYALQ
FT                   TEGLQNALAQLDDRSRRIVESRWLQDDGGLTLHQLAAEYGVSAERIRQIEAKAMQKLRG
FT                   FLTEEAEAV"
FT   gene            complement(289507..291045)
FT                   /locus_tag="NGO_0289"
FT   CDS_pept        complement(289507..291045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0289"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89037"
FT                   /db_xref="GOA:Q5F9V0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9V0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002259867.1"
FT                   /protein_id="AAW89037.1"
FT                   /translation="MFSKLDKYWQHPALYWPLLILFAAATPFAFAPYYHFWLMPLIFGA
FT                   FVRLIELRPRFAASSAYLFGLTAYTAQFYWIHTALHDVSGLPDLYAVPLTFLLPAYLAL
FT                   YPALCFWLWKKFTLPQGIKTGLVLPILWTLTEFARERFLTGFGWGAIGYSQITPDSPLA
FT                   GFAPLGGIHMVTLATAFLGVWLVLAIDNTARSGKRLLPAILIAALLAAGYTAQQTDFTR
FT                   PDGSRSTVALLQGNIAQTLKWREDQVIPTIQKYYEQVGKTTADIVILPETAIPIMRQNL
FT                   PENILAQFAEQAQNNGSALAVGISQYTSDGNGYENAVINLTGYQENNQDGIPYYAKNHL
FT                   VPFGEYKPLPLLTTPLYKMMDMPLSDFRKGGGKQSAMMMKNQKIAFNICYEDGFGDELI
FT                   AAAKDATLLANVSNMAWYGKSNAMYQHLQQSQARAMELGRYMVRATNTGATAIISPKGN
FT                   IIAQAQPDTETVLEGHIKGYIGETPYMKTGSSWWLMGILTLAALILFIFRNKEH"
FT   gene            complement(291115..291855)
FT                   /locus_tag="NGO_0290"
FT   CDS_pept        complement(291115..291855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89038"
FT                   /db_xref="GOA:Q5F9U9"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9U9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690764.1"
FT                   /protein_id="AAW89038.1"
FT                   /translation="MAFASLFTLPDYIAAVLDDVALMTKAAAKKTAGVAGDDLAPNANR
FT                   VTGVSAERELPIVWPVAKGSFANKPVLVSAALLLSAFLPQLITPLLTAGGIYLCFEGVE
FT                   KLLHKFLHRHDAHDDGGETAVNEQAKIKGAIRTDFILSAEIIIIALCVVEQYSLMTRSL
FT                   VMAAIGIGMTVLVYGIVAVIVKLDDLGMLLMRRPQPRPFARFPARATLERWLDRVFRQP
FT                   RCRAAFRFDCLRPALSLMNRFGRH"
FT   gene            292050..293780
FT                   /locus_tag="NGO_0291"
FT   CDS_pept        292050..293780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0291"
FT                   /product="potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89039"
FT                   /db_xref="GOA:Q5F9U8"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9U8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687668.1"
FT                   /protein_id="AAW89039.2"
FT                   /translation="MDWMNSLFLLGGALLFLSVVSTTLSARLGMPLLLVFLAVGMLAGE
FT                   EGVGGIAFNNVVMANFISQLALAVILLDGGLRTQLSSFRIALKPASVLASWGVFATVLP
FT                   LGLFATFYLGLDWKFGVLMAAIVGSTDAGAVFSLLRNSGVRLNERVQATLEIESGANDP
FT                   MAVFLVTALITMIMQPAESGAAAFVRMLALQIGFGLLTGWAGGKILAKLVRRLNLAEGL
FT                   YALMIVSGGLLVFAFTNTIGGSGFLAVYLAGIIVGNQRNRATEHVLRVMDGLAWLAQAT
FT                   LFVMLGLLVSPAGVLDRAAEALAIAAFLMLVARPLAVFGGLWKFNYSLREKAYISWLGL
FT                   RGAVPISLAMMPLVMGVPNSHLLFDVAFAVVVLSLLIQGTTIPVMARLLKVAMPNKPEP
FT                   KDTHDIWLAEKEIVRMSAFKVVAESEAEGHHPDTVEPISDSFDARCFALIRNGSRIEMQ
FT                   SDTVLQAEDLAWYILADGKVDKMAKYFTETGIGVRENFDFFGEFVVSPAARSGDLALAY
FT                   GLKLEAGEEGLSLAELFDKRSDSQEPVEGDRIDIGGFMLTAKEVDGGGNIGSMGLKVPR
FT                   "
FT   gene            complement(293849..294244)
FT                   /pseudo
FT                   /locus_tag="NGO_0292"
FT                   /note="cytochrome C"
FT   gene            complement(294435..295445)
FT                   /locus_tag="NGO_0293"
FT   CDS_pept        complement(294435..295445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0293"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89041"
FT                   /db_xref="GOA:Q5F9U6"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9U6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002261728.1"
FT                   /protein_id="AAW89041.1"
FT                   /translation="MLPFLPEPSLSYTQQNRTAVLLLNLGTPDAPTAQAVRPYLKSFLT
FT                   DRRIVELPKWLWYPILHGLVLTFRPKKSAHAYEKIWFKEGSPLEVYTARQAAALAERMP
FT                   DLIVRHAMTYGNPSIADVLAELKSQGVGRLLAIPLYPQYAASSSGAAVDKVCEQLLLQR
FT                   NQMSVRTISRFYDDAGYIDAMKNHILRYWAEHGRGKKLMLSFHGVPQKHYDLGDPYPDE
FT                   CRHTAKLLAEALELTEDEYTVSFQSQFGRAKWVTPSTQDLFGKLPKQGVTELDVFCPGF
FT                   LADCLETMEEIALMGREQFYEAGGKNYRYIPCLNDNPDWIDALVALAEENLGGWR"
FT   gene            complement(295527..296642)
FT                   /locus_tag="NGO_0294"
FT   CDS_pept        complement(295527..296642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0294"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89042"
FT                   /db_xref="GOA:Q5F9U5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9U5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357167.1"
FT                   /protein_id="AAW89042.1"
FT                   /translation="MLKFTLHKKDGLARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQ
FT                   NLHDIKAQIILGNTYHLWLRPGLEVVEQFGGLHGFIGWDKPILTDSGGFQVFSLSDMRK
FT                   LTEEGCTFKSPINGDKLFLSPEISMKIQTVLNSDIAMQLDECTPGETTREQARKSLQMS
FT                   LRWAERSKKAFEDLKNPNALFGIVQGAMYEDLREESLRGLEEFDFPGLAVGGLSVGEPK
FT                   PEMYRMLHAVGPMLPERKPHYLMGVGTPEDLVYGVAHGIDMFDCVMPTRNARNGWLFTR
FT                   FGDLKIKNAKHKPDKRPIDESCTCYACQNFSRAYLHHLHRAGEILGAQLNTIHNLHFYQ
FT                   VIMAEMRDAVEQGKFADWQAQFHENRARGVD"
FT   gene            296821..296897
FT                   /locus_tag="NGO_18811"
FT   tRNA            296821..296897
FT                   /locus_tag="NGO_18811"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:296855..296857,aa:Val,seq:gac)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            296950..298863
FT                   /locus_tag="NGO_0295"
FT   CDS_pept        296950..298863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0295"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89043"
FT                   /db_xref="GOA:Q5F9U4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9U4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692728.1"
FT                   /protein_id="AAW89043.1"
FT                   /translation="MLNITLPDCSVRQYESPVTVAQIAASIGAGLAKAAVAGKVNGKLV
FT                   DACDPIVEDSAVQIITPKDQEGIEIIRHSCAHLVGHAVKQLYPNAKMVIGPVIEEGFYY
FT                   DIATEKPFTPEDVAAIEARMKELIAQDYDVVKIMTPRAEAIKIFQERGEEYKLRLIDDM
FT                   PEVEAMGIYHHQEYVDMCRGPHVPNTRFLKNFKLTKLAGAYWRGDSNNEMLQRIYGTAW
FT                   ATKDELKDYIQRIEEAEKRDHRKLGKQLDLFHLQDEAPGMVFWHPKGWALWQTIEQHMR
FT                   KELNAAGYKEVKTPQIMDKTFWEKSGHWDNYKDNMFVTSSEKREYAVKPMNCPGHVQIF
FT                   NNGLRSYRDLPMRLAEFGSCHRNEPSGALHGLMRVRGFVQDDAHIFCTEDQIVSEARAF
FT                   NELLVRIYKQFGFHDVSVRLSLRPEKRAGSDDVWDKAEQGLREALTACGVEWGELPGEG
FT                   AFYGPKIEYHVKDALGRSWQCGTLQLDFVLPERLDAEYVTENNDRARPVMLHRAILGSL
FT                   ERFIGILIENHAGSFPLWLAPVQMVIMNITENQADYCREVAAKLQAAGFRAELDLRNEK
FT                   IGYKIRDNSQYRFPYQIVIGDKEKQENKVAVRRKAEDLGSLDLDDFIAQLQQEITDALV
FT                   NH"
FT   gene            298881..299402
FT                   /locus_tag="NGO_0296"
FT   CDS_pept        298881..299402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0296"
FT                   /product="putative translation initiation factor IF-3"
FT                   /note="Best Blastp Hit: pir||C81939 probable translation
FT                   initiation factor IF-3 NMA0930 [imported] - Neisseria
FT                   meningitidis (group A strain Z2491)
FT                   >gi|7379635|emb|CAB84202.1| (AL162754) putative translation
FT                   initiation factor IF-3 [Neisseria meningitidis]; COG0290
FT                   Translation initiation factor IF3"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89044"
FT                   /db_xref="GOA:Q5F9U3"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9U3"
FT                   /protein_id="AAW89044.1"
FT                   /translation="MIAQEREARINGEITAKEVRLISESGEQLGVVSVREALAMAEGQD
FT                   VDLVEISPTAKPPVCKLMDYGKYKYQQAKKRDEAKKNQKQVQIKEIKFRPGTDEGDYQI
FT                   KMRNINRFLADGDKVKVTLRFRGREMAHQQLGAQLLERVKEDLAEVAQIESFPKMEGRQ
FT                   MVMMIAPKKK"
FT   gene            299549..299746
FT                   /locus_tag="NGO_0297"
FT   CDS_pept        299549..299746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0297"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89045"
FT                   /db_xref="GOA:Q5F9U2"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9U2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002641005.1"
FT                   /protein_id="AAW89045.1"
FT                   /translation="MPKMKTKSSAKKRFKVLGNGGVKRAHAFKRHILTKKTTKNKRQLR
FT                   GTSMVNDRDLASVAKMLPYA"
FT   gene            299759..300118
FT                   /gene="rplT"
FT                   /locus_tag="NGO_0298"
FT   CDS_pept        299759..300118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="NGO_0298"
FT                   /product="50S ribosomal protein L20"
FT                   /note="binds directly to 23S ribosomal RNA prior to in
FT                   vitro assembly of the 50S ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89046"
FT                   /db_xref="GOA:Q5F9U1"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9U1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9K093.1"
FT                   /protein_id="AAW89046.1"
FT                   /translation="MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQY
FT                   AYRDRRQRKRQFRQLWIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKA
FT                   AFAQLVEKAKAALAA"
FT   gene            300359..301348
FT                   /locus_tag="NGO_0299"
FT   CDS_pept        300359..301348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0299"
FT                   /product="phenylalanine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89047"
FT                   /db_xref="GOA:Q5F9U0"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9U0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F9U0.2"
FT                   /protein_id="AAW89047.2"
FT                   /translation="MENVNRIVAEGIAAVEAAQDFNALEQIKARYLGKTGELTGLLKTL
FT                   GQMSPEERKTIGAHINECKNRFQTAFNAKRDALNEAKLQARLAAEALDITLPGRAQEGG
FT                   SLHPVTLTLQRVVELFHGMGFEVADGPEIEDDFHNFQALNIPANHPARAMQDTFYVENG
FT                   DVLRTHTSPIQIRYMLDKKEPPIRIIAPGRVYRVDSDATHSPMFHQAEGLWVEEGVTFA
FT                   DLKAVFTDFIRRFFERDDLQVRFRPSFFPFTEPSAEIDIMGENGKWLEVGGCGMVHPNV
FT                   LKNVNIDPEKYTGFAFGIGLDRFAMLRYNVNDLRLFFDNDLNFLKQFE"
FT   gene            301365..301778
FT                   /locus_tag="NGO_0300"
FT   CDS_pept        301365..301778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0300"
FT                   /product="restriction endonuclease HpaII"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89048"
FT                   /db_xref="GOA:Q5F9T9"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9T9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690774.1"
FT                   /protein_id="AAW89048.1"
FT                   /translation="MDKLTPEQRKKCMQSNKSTGTKPELVLAKAMWALGLRYRKNSGSI
FT                   FGKPDFSFKKYKVAVFVDGEFWHGKDWEQKKAVIKGNREFWIAKIERNIQRDIEVTGRL
FT                   KAEGWTVLRFWSNDVVKNTTCCAEKVKEIIQTR"
FT   gene            301780..302118
FT                   /locus_tag="NGO_01615"
FT   CDS_pept        301780..302118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01615"
FT                   /product="methylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01615"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63614"
FT                   /db_xref="GOA:A0A0H4ISL7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISL7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687679.1"
FT                   /protein_id="AKO63614.1"
FT                   /translation="MIYKNKIKEDGQDERLKEKAAQYRLFENNDTFQTALKPKFTFIDL
FT                   FAGIGGFRIAMQNLGGEYVFSSEWDEKAKLTYEANFGEVPFGDITLEEIKQYIPKQFDV
FT                   LCGFTLSK"
FT   gene            302132..302377
FT                   /locus_tag="NGO_0302"
FT   CDS_pept        302132..302377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89049"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9T8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687680.1"
FT                   /protein_id="AAW89049.1"
FT                   /translation="MRLSDYILNNKININNLSDKQVQEIIDYFSSEIDDWLLASEKELK
FT                   DYDVYLYKLVLDGQQYVQGIRKSVLYDFLMENQKDS"
FT   gene            302383..303132
FT                   /locus_tag="NGO_0303"
FT   CDS_pept        302383..303132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0303"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89050"
FT                   /db_xref="GOA:Q5F9T7"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9T7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003704414.1"
FT                   /protein_id="AAW89050.1"
FT                   /translation="MKKWTRDETLVALYLYYIIPFQKVSKDNPVIQEYAEILGRTPSAL
FT                   GMKIGNLGRLDPTLKVKNISGLSNGSKMDVVVWNEFSGDWEQLNKEFEGVISQYQSNDE
FT                   NSNIEIESPEIPKGRERFARISVRVNQGFFRSSVLAAYNNQCCITGLKQPELLVASHIK
FT                   PWGEDKDNRLNPRNGLCLNALHDKAFDRGLLGIDENFKIIFSPLLAKTEGFDDLFKPYE
FT                   NRMIRLPERLNPSLEFLKFHRENIFQS"
FT   gene            303223..305586
FT                   /locus_tag="NGO_0304"
FT   CDS_pept        303223..305586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0304"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89051"
FT                   /db_xref="GOA:Q5F9T6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9T6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F9T6.1"
FT                   /protein_id="AAW89051.1"
FT                   /translation="MQFSYSWLKTQANPDLSADKLEHLLTMAGLEVEEIDTAAPAFSGV
FT                   VVAEVKSVEKHPDADRLNVTQVDAGTGELVQIVCGAPNVKPGIKVPCSLPVAVLPGNFK
FT                   IKPTKMRGVPSNGMLCSTNELGLPDDGVDGLHILPEDAPVGTNIREYLDLDDMLFTLKI
FT                   TPNRADCLSVKGIAREVSALTQCAFTPVEIQTAPIGSEKKQAVRIDAPADCGRFISRVI
FT                   ENVNAKAATPDWMKQRLERSGIRSISALVDIGNYVMLEIGQPMHVFDADKLSGSLIVRR
FT                   AQNGETLACLNEKTVTLADNTLVVADEKGALSLAGLMGGAASAVSDGTQNIVLEAAWFE
FT                   PEIIVGKSRQYGFGSDSSFRFERGVDYRLQADAIERATELVLQICGGAAGEMVEAQGKL
FT                   PEAKQVGLRLGRLKTVLGVDIPAEQVETILQHLGLQPEKTAEGFRITAPSFRFDIEIEA
FT                   DLIEEIGRVYGYENIPDDYTSGRLKMSELPETRRPRFAVYNEMAARGYREVISYAFVDE
FT                   QWELDFAANAAPIRLQNPLAAQYAVMRSTLIGGLVEILQNNLNRKQNRVRVFEIACVFG
FT                   KGSDGRFVQNERIGGLWYGAAMPEQWGEKTRNADFYDIKADVENLLKNKAVEFVKTGHP
FT                   ALHPGRAANIVSDGKVIGFVGELHPKWLQKYDLPQAPLVFEIDMAAVLECGKTRYRAVS
FT                   KFQPVRRDLAFVMPEVMNHDDLLLVLKGAANKLVQEISVFDVYRGTGLPEGMKSVAVKV
FT                   ILQDMENTLTDEAVEPLIGKLIGVATEAGARLRS"
FT   gene            305660..305962
FT                   /locus_tag="NGO_0305"
FT   CDS_pept        305660..305962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0305"
FT                   /product="integration host factor subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89052"
FT                   /db_xref="GOA:Q5F9T5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9T5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003680933.1"
FT                   /protein_id="AAW89052.1"
FT                   /translation="MTLTKAELADILVDKVSNVTKNDAKEIVELFFEEIRSTLASGEEI
FT                   KISGFGNFQLRDKPQRPGRNPKTGEEVPITARRVVTFHASQKLKGMVEHYYDKQR"
FT   gene            305946..306254
FT                   /locus_tag="NGO_0306"
FT   CDS_pept        305946..306254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89053"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9T4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214078.1"
FT                   /protein_id="AAW89053.1"
FT                   /translation="MTNNVDLTIPAKRYFTLDELCGLLQISPYGFAQWQHDHGVVVGYG
FT                   GERYTRLDVVKLLKLKSTFAPYAEGAESGSDGNRPVTLQEIGDGLKDLLEDLDKELC"
FT   gene            306430..306915
FT                   /locus_tag="NGO_0307"
FT   CDS_pept        306430..306915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0307"
FT                   /product="exclusion suppressor FxsA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89054"
FT                   /db_xref="GOA:Q5F9T3"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9T3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009349087.1"
FT                   /protein_id="AAW89054.1"
FT                   /translation="MRFFGIGFLVLLFLEIMSIVWVADWLGGGWTLFLMAATFAAGVLM
FT                   LRHTGLSGLLLAGAAVKSSGKVSVYQMLWPIRYTVAAVCLMSPGFVSSVLAVLLLLPFK
FT                   GGAVLQAGGAENFFNMNQSGRKEGFFHDDDIIEGEYTVEEPYGGNRSRNAIEHKKDE"
FT   gene            307107..307331
FT                   /locus_tag="NGO_01650"
FT   CDS_pept        307107..307331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01650"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63615"
FT                   /db_xref="GOA:A0A0H4IV03"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IV03"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687691.1"
FT                   /protein_id="AKO63615.1"
FT                   /translation="MSVWDIWDRMVEIYHKYKKPCLVLAVDFVMGMVFIEPNEEPCIGR
FT                   CYAPMPESPDFANAVAMAVAMICIVFIYD"
FT   gene            307549..308850
FT                   /locus_tag="NGO_0308"
FT   CDS_pept        307549..308850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0308"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89055"
FT                   /db_xref="GOA:Q5F9T2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9T2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002234755.1"
FT                   /protein_id="AAW89055.1"
FT                   /translation="MPSEHQHTSSLLNFDRTHLLHPYTSMTDPLPVYPVKRAEGVFIEL
FT                   ADGTRLIDGMSSWWCAIHGYNHPVLNQAVENQMKQMAHVMFGGLTHEPAVELGKLLVGI
FT                   LPQGLDRIFYADSGSVSVEVALKMAVQYQQARGLTAKQNIATVRRGYHGDTWNAMSVCD
FT                   PETGMHHIFGSALPQRYFVDNPKNRFDDEWDGADLQPVRALFEAHHVDIAAFILEPVVQ
FT                   GAGGMYFYHPQYLRGLRDLCDEFDIVLIFDEIATGFGRTGKMFACEHAEVVPDIMCIGK
FT                   GLSGGYMTLAAAITSQKVTETISRGEAGVFMHGPTFMANPLACAVACASVKLLLSQDWQ
FT                   ANIRRIESILKGRLKAAWDIRGVKDVRVLGAIGVIELEKGVDMARFQADCVAQGIWVRP
FT                   FGRLVYLMPPYIISDGILTKLADKTVQILKEHSK"
FT   gene            308847..309494
FT                   /locus_tag="NGO_0309"
FT   CDS_pept        308847..309494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0309"
FT                   /product="dethiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89056"
FT                   /db_xref="GOA:Q5F9T1"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9T1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706645.1"
FT                   /protein_id="AAW89056.1"
FT                   /translation="MKGVYFVSGIDTDIGKTVATGMLAKQLLQQGKSVITQKPVQTGCQ
FT                   DIAEDIAVHRKIMGIPMQEADEQRLTMPEIFSHPASPHLAARLDGRGLDLDKIRTATQE
FT                   LAAQYEVVLVEGAGGLMVPLTEKLLTIDHIQQQAYPVILVTSGRLGSINHTLLSFVVLK
FT                   QYGIRLHSLVFNHIHDSRDAHVAQDSLNYLQCRLKADFPEAEWMELAKTGAV"
FT   gene            309509..309985
FT                   /locus_tag="NGO_0310"
FT   CDS_pept        309509..309985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0310"
FT                   /product="chorismate--pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89057"
FT                   /db_xref="GOA:Q5F9T0"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9T0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687697.1"
FT                   /protein_id="AAW89057.2"
FT                   /translation="MEHLFGKWLPDLPAPVSDGIDLPMSRLLKARSLTAALCALPHTFS
FT                   VELLKLGEAETEYGRRRVRDVLLKLDGTAVVQARSACSVGSAFWQNILDCGTRPLGERL
FT                   FQADLEGARSAFEFAVSSEGCGRYFAARRSRFSHQGEEMLLTEYFLPELKRFIG"
FT   gene            310109..310516
FT                   /locus_tag="NGO_0311"
FT   CDS_pept        310109..310516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9S9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687699.1"
FT                   /protein_id="AAW89058.1"
FT                   /translation="MNIIEIISRNRFLKQIYPSGIMDISLVSFSTDLSNCILTIRTSTK
FT                   PSVEIEKWGLWLKDYDTVEIELRNSFIKGMKCQNWSHNNRNICQVEIKNQEDGLKIIRF
FT                   YDNNSNWLLELEVYGLVFQGCKTYMKEGYES"
FT   gene            310506..311396
FT                   /locus_tag="NGO_0312"
FT   CDS_pept        310506..311396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0312"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89059"
FT                   /db_xref="GOA:Q5F9S8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9S8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B4RK00.1"
FT                   /protein_id="AAW89059.1"
FT                   /translation="MNLKSPLFLRLSDRLDVYIRLMRADKPIGTLLLLWPTYWALWLAS
FT                   DGIPDLAVLAAFTIGTFLMRSAGCVINDFADRDFDGAVERTKNRPFAQGRVKKKEALLL
FT                   TAFLCLLAALCLIPLNHLTWLMSLPALFLALTYPFTKRFFPIPQFYLGFAFSFGIPMAF
FT                   AAVGNSVPVEAWILFAANVLWTLAYDTVYAMADKEDDLKIGIKTSAVTFGRYDIAAVML
FT                   CHGGFTLLMAVLGAVIGAAWAYWTAIPIVLLLQYRQYAAIKSRVRQICFETFLANNRIG
FT                   WVWFAAIFAHTFFAK"
FT   gene            311581..312030
FT                   /locus_tag="NGO_0313"
FT   CDS_pept        311581..312030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0313"
FT                   /product="PTS sugar transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89060"
FT                   /db_xref="GOA:Q5F9S7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9S7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687701.1"
FT                   /protein_id="AAW89060.1"
FT                   /translation="MSLIGEILPLSHIVLDMEVGSKKRLFEEAGLLLERESSLSHADVF
FT                   ECLFAREKLGSTGLGQGVAIPHGRHASVKQATGAFIRTREPVGFDAPDGKPVSLVFILL
FT                   VPENATGEHLEVLSKLAGKFSQKSIRESLMTVASAEEARAILTEE"
FT   gene            312034..312996
FT                   /locus_tag="NGO_0314"
FT   CDS_pept        312034..312996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0314"
FT                   /product="serine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89061"
FT                   /db_xref="GOA:Q5F9S6"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9S6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581160.1"
FT                   /protein_id="AAW89061.1"
FT                   /translation="MPSISVRRLFDDNQYKLQLAWAAGNSGADNRIGVEADKPVLALVG
FT                   HLNFIHPNQIQVVGLAESEYLNRLESGETGYQFGDLFDISMSLVIVANDLPVSPGLRDY
FT                   CHKNDIPLLTSKLESPYLMDVLRIYLQRTLAASSVKHGVFLDVFEIGVLITGHSGLGKS
FT                   ELALELISRGHSLIADDAVELFRIGPETLEGRCSPMLRDFLEVRGLGILNIRHIFGETS
FT                   IRPKKILQLIINLVEADDEYMKQLDRLSIRTETESILNVNVRSVTLPVAVGRNLAVLVE
FT                   AAVRNYILQLRGKDSTREFLERHQTQLKENEQNHENRPD"
FT   gene            312977..313831
FT                   /locus_tag="NGO_0315"
FT   CDS_pept        312977..313831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0315"
FT                   /product="nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89062"
FT                   /db_xref="GOA:Q5F9S5"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9S5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002238962.1"
FT                   /protein_id="AAW89062.1"
FT                   /translation="MKIVLISGLSGSGKSVALRQMEDLGYFCVDNLPLEMLPSLVSYHI
FT                   ERADETELAVSVDVRSGIDIAQAREQIAYLRGLGHRVEVLFVEAEEAVLVRRFSETRRG
FT                   HPLSNQDMTLLESLKKEREWLFPLKEIAYCIDTSKMNAQQLRHAVRQWLKVERTGLLVV
FT                   LESFGFKYGVPNNADFMFDMRSLPNPYYDPELRPYTGMDKPVWDYLDGQPLAQEMVDGI
FT                   ERFVTRWLPRLEDESRSYVTVAIGCTGGQHRSVYIVEKLARRLKGRYELLIRHRQAQNL
FT                   SGR"
FT   gene            313912..314853
FT                   /locus_tag="NGO_0316"
FT   CDS_pept        313912..314853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0316"
FT                   /product="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89063"
FT                   /db_xref="GOA:Q5F9S4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9S4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581884.1"
FT                   /protein_id="AAW89063.1"
FT                   /translation="MAIQWFPGHMNKARKAIAERAKSVDMVIEMLDARMPASSENPLLA
FT                   QLSKGKPKLKILNKQDLADPERTKVWLDHYNSRPDTRAIALDSSETGAHGKITQACRAM
FT                   IPHRQGIDKPLRVLICGIPNVGKSTLINGMIGKKSAKTGNEPGITKAEQRLFLADDFWL
FT                   YDTPGMLWPKIIVEESGYNLAAGGAVGRNALDEEEVALELLDYLRRHYLPMLQERYQAD
FT                   KDPSSHWDDNSWLEWIAKKRGAVLSGGRVNYQKAAENILTDFREGKIGRITLETPNQWE
FT                   TWLKKARQKEAELKAIREARKAERKGQKPSEA"
FT   gene            314954..315556
FT                   /locus_tag="NGO_0317"
FT   CDS_pept        314954..315556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0317"
FT                   /product="chromosome segregation protein ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89064"
FT                   /db_xref="GOA:Q5F9S3"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9S3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003749777.1"
FT                   /protein_id="AAW89064.1"
FT                   /translation="MTDKISPDALIEAALLTQTEPLTEKSMRELCVPPLSQDKLIDVLA
FT                   QLKTRWQDRALQLVHTQEGWRFQIVQTAFERLGSLQEQRAPRYSRAVMETLAIIAYQQP
FT                   VTRGDIEGIRGVAVSQNVMQTLQDRGWIEVIGHRDTLGKPALWATTATFLSDLRLDGLE
FT                   ELPPLTELGELVLPDLIEMPPTDEEEPETVPSDTLPN"
FT   gene            315740..317413
FT                   /locus_tag="NGO_0318"
FT   CDS_pept        315740..317413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0318"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89065"
FT                   /db_xref="GOA:Q5F9S2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9S2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503441.1"
FT                   /protein_id="AAW89065.1"
FT                   /translation="MLLTLSLRDFVIVENLNLDFQSGFTVLTGETGAGKSITLDAIGLL
FT                   LGDKADYSQVRSGAKEAQLSALFDISHLPALKAELREQGLLDEGGEELSIRRIIDAKGK
FT                   SRSFINNQAATLAQLKAVGGQLIDIHGQNDHHSLNQEAAQRELLDAFVGGRVQAETVRQ
FT                   LYQNWANAKKALQEAQEHADAVIIERERLEWQFNELNQLDIKQGEWEAFSQSHDSLAHS
FT                   AELLQAAEEVGSKIDGDNGIQRHIYQCQKLLANLQNIEPRFAESLNMLASIEAELGEIS
FT                   ANMRDVAGHSDINPNELAAQEQRMGELMGMARKYRIEPEELPAKLAEIEERLQSLQAAA
FT                   DLDALEHNVAHNFAEYQEAAHILSAMRHQAAGRLSSDTTEHMQHLAMKGARFDIVLLPS
FT                   SPTAHGLEQVQFQVAANKGNPPRPLNKVASGGELARISLALQVVASQYTQVPTLIFDEV
FT                   DTGIGGGVAEMVGKALRALGRKHQVLAVTHLPQVASCGENHWRVRKHSEGEQTVSEISI
FT                   LDEIQRIEEVARMLGGEVITDTTRQHAAELLQLASKNSLF"
FT   gene            317524..317600
FT                   /locus_tag="NGO_18816"
FT   tRNA            317524..317600
FT                   /locus_tag="NGO_18816"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:317558..317560,aa:Arg,seq:acg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            317618..317692
FT                   /locus_tag="NGO_18821"
FT   tRNA            317618..317692
FT                   /locus_tag="NGO_18821"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:317651..317653,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(318158..319777)
FT                   /locus_tag="NGO_0319"
FT   CDS_pept        complement(318158..319777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0319"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89066"
FT                   /db_xref="GOA:Q5F9S1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9S1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687708.1"
FT                   /protein_id="AAW89066.1"
FT                   /translation="MDNLVWDGIPDIRTLDQTIRKHAHPLNLIVCLPDNQIPDFQTAQD
FT                   ASDSECRLKHRLDQATQCLQFDSINLIEHILPDVRFWLVPPSRTRRLHEHFHHISWQTE
FT                   AIPQTESKSDKPWFALPQTSERKKPEHVLVIGAGIAGASTAHALASHGISVTVLEARKA
FT                   AQAASGNRQGLLYAKISPHDTGQTELLLAGYGYTKRLLGHILPDSDTWGGNGIIHLNYS
FT                   RTEQQRNHELGLQKHHNHLYRSITSAEAEKIAGIPLNTPYAEPLCGLYWQHGVWLNPPA
FT                   FVRTLLSHPLIELYENTTLTGISHDGEKWIASTPNGTFTATHIIYCTGAHSPCLPETNL
FT                   AALPLRQIRGQTGLTPSTPFSEQLRCAVSGESYISPSWHGLHCYGASFIPNSSNTGWNE
FT                   AEEASNRQALAHLNPALAESLFAANPNPQKHQGHAAIRCDSPDHLPVVGALGDIAAMRQ
FT                   TYAKLALDKNYRIDTTCPYLPNAYTNTAHGTRGLATAPICAAAVAAEILGLPHLFSQRL
FT                   RHALHPNRTVIRAIVRRQNLIP"
FT   gene            319897..320265
FT                   /locus_tag="NGO_0320"
FT   CDS_pept        319897..320265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89067"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9S0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221446.1"
FT                   /protein_id="AAW89067.2"
FT                   /translation="MNNIPVEIRLLKNRAVLVLTYGDEPKNLPAEFLRVYSPSAEVRGH
FT                   GVGQDVLQTGKADVQITDLQPVGQYALKISFSDGHDSGLYDWAYLHRLAYGYDAMWQEY
FT                   LDKLAAAGASRFEKQSDC"
FT   gene            320308..321045
FT                   /locus_tag="NGO_0321"
FT   CDS_pept        320308..321045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0321"
FT                   /product="ubiquinone biosynthesis methyltransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89068"
FT                   /db_xref="GOA:Q5F9R9"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9R9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271874.1"
FT                   /protein_id="AAW89068.1"
FT                   /translation="MGGQKTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLH
FT                   RVWKHFTIHTAHLKKGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDR
FT                   LLNEGMILPVSLADAEKLPFPDNYFNLVSVAFGLRNMTYKDAALKEMYRVLKPGGTLLV
FT                   LEFSKIYKPLEGAYDFYSFKLLPVMGRLIAKDADSYQYLAESIRMHPDQETLKQMMLDA
FT                   GFDSVDYHNMSAGIVALHKGVKF"
FT   gene            321265..321744
FT                   /locus_tag="NGO_0322"
FT   CDS_pept        321265..321744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9R8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002240420.1"
FT                   /protein_id="AAW89069.1"
FT                   /translation="MPESIFKQISSDILRLHRDSVYSLLATSGCNCQVHEAAYVNIDGK
FT                   YYIALSCEPEVGEVETGILLIEDESRNLRLSWVGSARELDRKDNAYKRALSALSRKLGR
FT                   CKDKLHTAVQPFLLELVPEKGRFSVGDEEVWISRNDLVRALYPVGYSMRQAVLQI"
FT   gene            complement(321872..322366)
FT                   /locus_tag="NGO_0323"
FT   CDS_pept        complement(321872..322366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0323"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89070"
FT                   /db_xref="GOA:Q5F9R7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9R7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002221222.1"
FT                   /protein_id="AAW89070.1"
FT                   /translation="MNNRHFAVIALGSNLDNPAQQIRGALDALSSHPDIRLEQASSLYM
FT                   TAPVGYDNQPDFINAVCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDF
FT                   DGISSDDPRLTLPHPRAHERSFVIRPLAEILPDFILGKYGKVVELSKRLGNQGIRLLPD
FT                   R"
FT   gene            complement(322376..322750)
FT                   /locus_tag="NGO_0324"
FT   CDS_pept        complement(322376..322750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0324"
FT                   /product="SirB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89071"
FT                   /db_xref="GOA:Q5F9R6"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9R6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003677527.1"
FT                   /protein_id="AAW89071.1"
FT                   /translation="MQYLIVKYSHQIFVTITILVFNIRFFLLWKNPEKPLVGFWKALPH
FT                   LNDTMLLFTGLWLMKITHFSPFNAPWLGTKILLLFAYIALGMVMMRARPRSTKFYTVYL
FT                   LAMCCIACIVYLAKTKVLPF"
FT   gene            complement(322804..323370)
FT                   /pseudo
FT                   /locus_tag="NGO_01750"
FT                   /note="rRNA methyltransferase; disrupted"
FT   gene            complement(323455..323748)
FT                   /locus_tag="NGO_0326"
FT   CDS_pept        complement(323455..323748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0326"
FT                   /product="RNA-binding protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89072"
FT                   /db_xref="GOA:Q5F9R5"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9R5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F9R5.1"
FT                   /protein_id="AAW89072.1"
FT                   /translation="MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVV
FT                   LLRNTSVTQMVYKHAISTIVPARSVNLQHENKPQAAPASTLVQVETVQQPAE"
FT   gene            complement(323877..324815)
FT                   /locus_tag="NGO_0327"
FT   CDS_pept        complement(323877..324815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0327"
FT                   /product="D-alanyl-D-alanine endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89073"
FT                   /db_xref="GOA:Q5F9R4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9R4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014574132.1"
FT                   /protein_id="AAW89073.1"
FT                   /translation="MSIRTLKRLPSSLLLGLCLSLPSAHLFADNDILGQFLEQNMLTSS
FT                   DPIEIFAESTIYPADTQAITGGLILSSQSALVVNNKTGQILYQKNADRIMPIASISKLM
FT                   SAMVVLDANLDMNETVTITPDEIDRLKGTGSRLAIGTALTRKELLHLSLMSSENRATHA
FT                   LGRTYPGGMGAFVAAMNRKAQSLGMYGSRFYEPTGLNFQNVSTAKDLSLMVNAAAQYPQ
FT                   IRTNSTSNYASVQTKNGQQNYKNSNALVREGMWNIELQKTGYIREAGRSMVVKANIQNQ
FT                   PVTIVLLNSPTSATRVNDARKIESWMLQQRS"
FT   gene            325136..325576
FT                   /locus_tag="NGO_0328"
FT   CDS_pept        325136..325576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0328"
FT                   /product="thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89074"
FT                   /db_xref="GOA:Q5F9R3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9R3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357251.1"
FT                   /protein_id="AAW89074.2"
FT                   /translation="MDMKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDF
FT                   NARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFRFELLSDKDETVCRLFDVIKLKKLY
FT                   GKESLGIERSTFVLNKDGEIVREWRKVKVAGHAQEVLETLSR"
FT   gene            325628..326503
FT                   /gene="xerD"
FT                   /locus_tag="NGO_0329"
FT   CDS_pept        325628..326503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="NGO_0329"
FT                   /product="site-specific tyrosine recombinase XerD"
FT                   /note="site-specific tyrosine recombinase which cuts and
FT                   rejoins DNA molecules; binds cooperatively to specific DNA
FT                   consensus sites; forms a heterotetrameric complex with
FT                   XerC; XerCD exhibit similar sequences; essential to convert
FT                   chromosome dimers to monomers during cell division and
FT                   functions during plasmid segregation; XerD specifically
FT                   exchanges the bottom strands; cell division protein FtsK
FT                   may regulate the XerCD complex; enzyme from Streptococcus
FT                   group has unusual active site motifs"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89075"
FT                   /db_xref="GOA:Q5F9R2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9R2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9K068.1"
FT                   /protein_id="AAW89075.1"
FT                   /translation="MENGLIDRLLETLWLDRRLSRNTLDSYRRDLEKIARRLSLCGRTL
FT                   KDADEADLAAAVYVDGEQRSSQARALSACKRLYVWMEREGMRADNPTRLLKPPKIDRNI
FT                   PTLITEQQISRLLAAPDTDTPHGLRDKALLELMYATGLRVSEAVGLNFGNVDLDRGCIT
FT                   TLGKGDKQRMVPMGQESAYWVERYYTEARPLLLKGRSCDALFVSQKKTGISRQLAWMIV
FT                   KEYAGRAGIGHISPHSLRHAFATHLVRHGLDLRVVQDMLGHADLNTTQIYTHVANVRLH
FT                   SVVKEHHSRN"
FT   gene            326675..326875
FT                   /locus_tag="NGO_01775"
FT   CDS_pept        326675..326875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_01775"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_01775"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63616"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRN3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687722.1"
FT                   /protein_id="AKO63616.1"
FT                   /translation="MFVCICNAVTDHQIKETIAAGATTMGDLQSQLGVASCCGCCGELA
FT                   ASFLTAHNAQPTVTAGINVQA"
FT   gene            327041..327274
FT                   /locus_tag="NGO_0331"
FT   CDS_pept        327041..327274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0331"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89077"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9R0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219546.1"
FT                   /protein_id="AAW89077.1"
FT                   /translation="MKLTLMFREYCSLCHKMRDALKPFQDEYGFGLEVVDVDENPVLEE
FT                   KYNELIPVLLAGDEEICHWFLDEDRLKQFLER"
FT   gene            complement(327646..328509)
FT                   /locus_tag="NGO_0332"
FT   CDS_pept        complement(327646..328509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0332"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89078"
FT                   /db_xref="GOA:Q5F9Q9"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503444.1"
FT                   /protein_id="AAW89078.1"
FT                   /translation="MRILLTGSKSQLAHCLRDRLPEDWETIATDSASLDITDADAVCNM
FT                   VKSFQPDAIVNTAAYTAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYVF
FT                   DGKGKIPYQESDFTNPSNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTML
FT                   NLARERSPLSAVHNQIGCPTYAGDLSAAIIRLLQQSNPVRGIYHYAGGKSVSWYEFARH
FT                   IFQTALQQDASFPVPELKAVSDEGSAAAAPRPAYSILDCRKIENDFGIKPSDWQKALAQ
FT                   VVSKLL"
FT   gene            328702..329565
FT                   /locus_tag="NGO_0333"
FT   CDS_pept        328702..329565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0333"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="catalyzes the formation of
FT                   (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-
FT                   carboxamido)succinate from
FT                   5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate and
FT                   L-aspartate in purine biosynthesis; SAICAR synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89079"
FT                   /db_xref="GOA:Q5F9Q8"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359866.1"
FT                   /protein_id="AAW89079.2"
FT                   /translation="MSEIGLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIP
FT                   GKGEILTQISNFWFKKLAHIMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEA
FT                   IVRGYLAGSGWKDYQKTGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVGDHDENISFEE
FT                   CGRIIGKELAEEVRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTP
FT                   DSSRFWPADQYEVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEAL
FT                   TLLTQD"
FT   gene            329802..331922
FT                   /locus_tag="NGO_0335"
FT   CDS_pept        329802..331922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0335"
FT                   /product="polynucleotide phosphorylase/polyadenylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89080"
FT                   /db_xref="GOA:Q5F9Q7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9Q7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F9Q7.1"
FT                   /protein_id="AAW89080.2"
FT                   /translation="MFNKYVKTFQYGNQTVTLETGEIARQAAAAVKVSMGDTVVFVAVT
FT                   TNKEVKEGQDFFPLAVDYLERTYAAGKIPGGFFKREGKQSEKEILTSRLIDRPIRPLFP
FT                   EGFYHDIQIVAMVVSVDPEIDSDIPAMLGASAALVLSGVPFAGPIGAARVGYINGVYVL
FT                   NPTKAELAKSQLDLVVAGTSKAVLMVESEAKILPEDVMLGAVVYGHDQMQVAINAINEF
FT                   ADEVNPEVWDWKAPETNEELVAKVRGIAGETIKEAFKIRQKQARSAKLDEAWNAVKEAL
FT                   ITEETDTLAANEIKGIFKRLEADVVRSQILDGQPRIDGRDTRTVRPLNIQTGVLPRTHG
FT                   SALFTRGETQALAVATLGTSRDEQIIDALSGEYTDRFMLHYNFPPYSTGEVGRMGAPKR
FT                   REIGHGRLAKRALLAVLPKPEDFSYTMRVVSEITESNGSSSMASVCGGCLSLLSAGVPL
FT                   KAHVAGIAMGLILEGNKFAVLTDILGDEDHLGDMDFKVAGTTEGVTALQMDIKIQGITK
FT                   EIMQIALAQAKEARLHILDQMKAAVAGPQELSAHAPRLFTMKISQDKIRDVIGKGGETI
FT                   RSITAETGTEINIAEDGTITIAATTQEAGDAAKKRIEEITAEVEVGKVYEGTVVKILDN
FT                   NVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL
FT                   LDAPVREENAAE"
FT   gene            complement(331995..332663)
FT                   /locus_tag="NGO_0336"
FT   CDS_pept        complement(331995..332663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0336"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89081"
FT                   /db_xref="GOA:Q5F9Q6"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217616.1"
FT                   /protein_id="AAW89081.1"
FT                   /translation="MNHDITFLTLFLLGFFGGTHCIGMCGGLSSAFALQLPPHINRFWL
FT                   ILLLNTGRISSYTAIGLMLGLIGQLGISLDQTRVLQNILYTASNLLLLFLGLYLSGISS
FT                   LAAKIEKIGKPIWRNLNPILNRLLPIKSIPACLAVGILWGWLPCGLVYSASLYALGSGS
FT                   ATTGGLYMLAFALGTLPNLLAIGIFSLQLKKIMQNRYIRLCTGLSVSLWALWKLAVLWL
FT                   "
FT   gene            complement(332660..332974)
FT                   /locus_tag="NGO_0337"
FT   CDS_pept        complement(332660..332974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0337"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687735.1"
FT                   /protein_id="AAW89082.1"
FT                   /translation="MSRLFLLLFPWATLAACTRNIPASPAVSNCAHLHNRTVLYFDAHG
FT                   KPADSTAKGGFYRTVEIHDTNRILIQDFNSTGNALVKPYWSDCRKLSVFPDKHLTMSHP
FT                   "
FT   gene            333111..333962
FT                   /locus_tag="NGO_0338"
FT   CDS_pept        333111..333962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0338"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89083"
FT                   /db_xref="GOA:Q5F9Q4"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002234768.1"
FT                   /protein_id="AAW89083.1"
FT                   /translation="MKTLKFTKMHGLGNDFMVIDAVSQDFTPEDVPIAAWADRFRGVGF
FT                   DQLLVVGCSETEGVDFRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAK
FT                   GIIFPKLSDNGMVTVNMGKPKFMPSEIPFVPESGEGDDACIYGVHLESGIQPVSCVNMG
FT                   NPHAVIVVDDVECAPVRETGSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQ
FT                   ACGTGACAAVVAGIRLGLLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGELA
FT                   YS"
FT   gene            333959..334564
FT                   /locus_tag="NGO_0339"
FT   CDS_pept        333959..334564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0339"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89084"
FT                   /db_xref="GOA:Q5F9Q3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271888.1"
FT                   /protein_id="AAW89084.1"
FT                   /translation="MILLHLDFLSALLYAAVFLFLIFRAGMLQWFWASIALWLGISVLG
FT                   VKLMPGMWGMTRAAPLFIPHFYLTLGSIFFFIGYWNRKTDGNGWQADPEHPLLGLFAVS
FT                   NVSMTLAFVGICALVHYCFSGTVQVFVFAALLKLYALKPVYWFVLQFVLMAVAYVHRCG
FT                   IDRQPPSTFGGSQLRLGVLAAMLMQVAVTAMLLAEIGR"
FT   gene            334760..335692
FT                   /locus_tag="NGO_0340"
FT   CDS_pept        334760..335692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0340"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89085"
FT                   /db_xref="GOA:Q5F9Q2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687742.1"
FT                   /protein_id="AAW89085.1"
FT                   /translation="MKIANSITELIGNTPLVKLNRLTKGLKAEVAVKLEFFNPGSSVKD
FT                   RIAEAMIEAAEKAGKINKNTVIVEATSGNTGIGLAMVCAARGYKLAITMPESMSKERKM
FT                   LLRTFGAELILTPAAEGMAGAIAKAQSLVDAHPDTYFMPRQFDNEANPEVHRKTTAEEI
FT                   WNDTDGKVDVFVAGVGTGGTITGVGEVLKKYKPEIEVCAVEAGASPVLSGGEKGPHPIQ
FT                   GIGAGFIPTVLNTKIYDSIAKVPNEAAFETARAMAEKEGILAGISSGAAVWSALQLAKQ
FT                   PENEGKLIVVLLPSYGERYLSTPLFADLA"
FT   gene            336001..336908
FT                   /pseudo
FT                   /locus_tag="NGO_01825"
FT                   /note="membrane protein; disrupted"
FT   gene            337103..337339
FT                   /locus_tag="NGO_0342"
FT   CDS_pept        337103..337339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89086"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687749.1"
FT                   /protein_id="AAW89086.1"
FT                   /translation="MSVFPYAAHTVSRTKCPLFNGMGFHTNGNNRLFTCRRIKSTDDLN
FT                   TGKSYAARTHHFSRQSICAAHIDNAGKAVHIVD"
FT   gene            complement(337539..338558)
FT                   /locus_tag="NGO_0343"
FT   CDS_pept        complement(337539..338558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0343"
FT                   /product="signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89087"
FT                   /db_xref="GOA:Q5F9Q0"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9Q0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503447.1"
FT                   /protein_id="AAW89087.1"
FT                   /translation="MNTMLMSGAAAALLAGIILYFKSDKKRQENGEWSSGLEYAYILTA
FT                   VGVFAALSLFMSFTAVFLIFVVLCGTAWGVYKYRLKTHPEISESSHFGDYFGSFFPTVL
FT                   VLFLIRSFIAEPFQIPSSSMRPGLIKGDFILVGKFSYGLRVPVLNNVFIPTGKIERGDV
FT                   VVFNYPLQPEMTYIKRIVGIPGDIVEYRDKVLTVNGKPASDIPDGTYRYPDDTDPSEIH
FT                   NTDMFRSGLDGKSFNILKKEGQPAVSLPVLGKYTSDIMSENGYSIDQSGLNHCQYADDG
FT                   SGFVCKVPEGRYFAMGDNRDNSADSRYWGFVDDKLVVGKAMFILMNFGDFGRAGTAIR"
FT   gene            complement(338704..340497)
FT                   /locus_tag="NGO_0344"
FT   CDS_pept        complement(338704..340497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0344"
FT                   /product="elongation factor 4"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89088"
FT                   /db_xref="GOA:Q5F9P9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9P9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004464199.1"
FT                   /protein_id="AAW89088.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMD
FT                   IEKERGITIKAQTAALNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDA
FT                   SQGVEAQTVANCYTAIDLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSA
FT                   KSGIGVEDVLEEIVAKIPAPTGDENAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDK
FT                   VRFMSTKAETQVEQLGVFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPA
FT                   TEPLPGFQEVQSQVFAGLYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRC
FT                   GFLGLLHLEIVQERLEREFDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETI
FT                   LEPIITATILVPQEYVGNVMTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKL
FT                   KSTSRGYASLDYHFKEFQPSDLIKLDIMVNGEKVDALSLIVHRQSAVHKGRELASKMRE
FT                   LIPRQMFDIAVQAAIGSRIIARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMK
FT                   QVGNVEIPQSAFLAILQVSDK"
FT   gene            complement(340639..341340)
FT                   /locus_tag="NGO_0345"
FT   CDS_pept        complement(340639..341340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0345"
FT                   /product="5'-methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="enables the cleavage of the glycosidic bond in both
FT                   5'-methylthioadenosine and S-adenosylhomocysteine"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89089"
FT                   /db_xref="GOA:Q5F9P8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9P8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357299.1"
FT                   /protein_id="AAW89089.1"
FT                   /translation="MSLKTVAVIGAMEQEIELLREMMENVKAVSFGRFSAYEGELAGKR
FT                   IVLALSGIGKVNAAVATAWLIRQFAPDCVINTGSAGGLGKGLKVGDVVIGTETEHHDVD
FT                   VTAFGYARGQVPQLPARFASDGILIETAKRAARTFEGAEVEQGLIVSGDRFVHSSEGVA
FT                   EIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFEEFLKTAAASS
FT                   AKMVAEIVKSL"
FT   gene            341508..342638
FT                   /locus_tag="NGO_0346"
FT   CDS_pept        341508..342638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0346"
FT                   /product="twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89090"
FT                   /db_xref="GOA:Q5F9P7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9P7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002248706.1"
FT                   /protein_id="AAW89090.2"
FT                   /translation="MFTDENMTAKEELFAWLRHMNKNKGSDLFVTTHFPPAMKLDGKIT
FT                   RITDEPLTAEKCMEIAFSIMSAKQAEEFSSTNECNFAISLPDTSRFRVNAMIQRGATAL
FT                   VFRAITSKIPKFESLNLPPALKDVALKKRGLVIFVGGTGSGKSTSLASLIDYRNENSFG
FT                   HIITIEDPIEFVHEHKNCIITQREVGVDTENWMAALKNTLRQAPDVILIGEIRDRETMD
FT                   YAIAFAETGHLCMATLHANSTNQALDRIINFFPEERREQLLTDLSLNLQAFISQRLVPR
FT                   DGGKGRVAAVEVLLNSPLISELIHNGNIHEIKEVMKKSTTLGMQTFDQHLYQLYEKGEI
FT                   SLQDALKNADSAHDLRLAVQLRSRRAQSSDPDLELL"
FT   gene            342672..343649
FT                   /locus_tag="NGO_0347"
FT   CDS_pept        342672..343649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0347"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="catalyzes the DNA-template-directed extension of the
FT                   3'-end of a DNA strand; the delta' subunit seems to
FT                   interact with the gamma subunit to transfer the beta
FT                   subunit on the DNA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89091"
FT                   /db_xref="GOA:Q5F9P6"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9P6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702370.1"
FT                   /protein_id="AAW89091.1"
FT                   /translation="MIYPWHQEQWRQIAEHWTSRPNAWLFVGKKGTGKTAFARFAAKAL
FT                   LCETPAPGCKPCGECMSCHLFGRGSHPDFYEITPLADEPENGRKLLRIKIDAVREIIDN
FT                   VYLTSVRGGLRVILIHPAESMNVQAANSLLKVLEEPPPQVVFLLVSHAADKVLPTIKSR
FT                   CRKMVLPAPSHGEALAYLRDRGVAEPEERLAFHSGAPLFQEEGELRELRAKLLEILAEP
FT                   RLLKILDYAALFDKEKLPLAVFVGWMQKWLVDLGLCLQHMKPVYYPAYEDRLLQTASGF
FT                   RPRNVFAAEDMLKQLAPYGFHTLNVKMQIEHLLINYLELKKENR"
FT   gene            343653..344003
FT                   /locus_tag="NGO_0348"
FT   CDS_pept        343653..344003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0348"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89092"
FT                   /db_xref="GOA:Q5F9P5"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9P5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002249304.1"
FT                   /protein_id="AAW89092.1"
FT                   /translation="MSDGQNIPAKMMSLQLKDMNLLYSSYMPFLEHGGLFVQTDDVFSI
FT                   GDDILLAVEILNFPKLFLPTKVAWINPASTSSKPKGVGLAFTKHENCLKVKDQIEVELG
FT                   STISGSRPTFTM"
FT   gene            344008..344787
FT                   /locus_tag="NGO_0349"
FT   CDS_pept        344008..344787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0349"
FT                   /product="DNAase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89093"
FT                   /db_xref="GOA:Q5F9P4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9P4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217600.1"
FT                   /protein_id="AAW89093.1"
FT                   /translation="MHIIDSHCHLNFEGLKERLPEVLSNMEANGVGQALAISVSRESFS
FT                   EVFAVAEAHEHIYCTIGVHPDSKEAEEFSIAEMVEAAAHPKVVGIGETGLDYYWCKGDL
FT                   SWQHKRFADHIEAANQTGLPVIVHTRDAAADTLAILKECKTNSGVIHCFSEDVGFARAA
FT                   MDLGLYISFSGIVTFKNAPLVQEAAKYVPDDRILVETDAPFLAPVPKRGRQNEPAFVRH
FT                   TAEHIAKLRNQTLEQVAAYTTENFYRLFKKVPDMRVV"
FT   gene            344813..345028
FT                   /locus_tag="NGO_0350"
FT   CDS_pept        344813..345028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89094"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9P3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219531.1"
FT                   /protein_id="AAW89094.1"
FT                   /translation="MKAIHPYACPRCCRLPANTFRTGMANSASKFCIAKGGRREVKKDE
FT                   SGGGYALCHLPDSRIVEEWEYCRSQH"
FT   gene            345129..345440
FT                   /locus_tag="NGO_0351"
FT   CDS_pept        345129..345440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0351"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89095"
FT                   /db_xref="GOA:Q5F9P2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9P2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002214004.1"
FT                   /protein_id="AAW89095.1"
FT                   /translation="MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGC
FT                   TDYVAVNVLENPEVRQGIKEYSDWPTIPQLYVNGEFVGGSDILMEMYEAGELQELLKA"
FT   gene            345440..345556
FT                   /locus_tag="NGO_0352"
FT   CDS_pept        345440..345556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89096"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9P1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002242507.1"
FT                   /protein_id="AAW89096.1"
FT                   /translation="MDSAMPSERVSDGIFFSGKLKKSIMTRLKITLEHRDER"
FT   gene            345546..346172
FT                   /gene="upp"
FT                   /locus_tag="NGO_0353"
FT   CDS_pept        345546..346172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="NGO_0353"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="Catalyzes the formation of uracil and
FT                   5-phospho-alpha-D-ribosy 1-diphosphate from UMP and
FT                   diphosphate"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89097"
FT                   /db_xref="GOA:Q5F9P0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9P0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9K048.1"
FT                   /protein_id="AAW89097.1"
FT                   /translation="MNVNVINHPLVRHKLTLMREADCSTYKFRTLTTELARLMAYEASR
FT                   DFEIEKYLIDGWCGQIEGDRIKGKTLTVVPILRAGLGMLDGVLDLIPTAKISVVGLQRD
FT                   EETLKPISYFEKFVDSMDERPALIIDPMLATGGSMVATIDLLKEKGCRNIKALVLVAAP
FT                   EGVKAVNDAHPDVTIYTAALDSRLNENGYIIPGLGDAGDKIFGTR"
FT   gene            346195..346515
FT                   /locus_tag="NGO_0354"
FT   CDS_pept        346195..346515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0354"
FT                   /product="RNA polymerase subunit sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89098"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690805.1"
FT                   /protein_id="AAW89098.1"
FT                   /translation="MNFQDYLATFPSIDHLGGLDVQDAEGKTVHHIPAVQGKLGSLKLY
FT                   NALAERFDGKLGKEAAEQGLIWFAEHVADARAHPGKHPNIDLLENVVQSGETLLLKPLA
FT                   AQ"
FT   gene            346684..347331
FT                   /locus_tag="NGO_0355"
FT   CDS_pept        346684..347331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89099"
FT                   /db_xref="GOA:Q5F9N8"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687766.1"
FT                   /protein_id="AAW89099.2"
FT                   /translation="MSGVTKELDILKQLFENLSDTDKQAFLTSVSSKEQVKKVIEPRKV
FT                   TKCPHCQSTHFVKNGKDCGNQRFLCRDCKKSFVEQTGTILYNTQKDIEVWEKYIHCMIE
FT                   KYPLRKCAEICKINLATAFTWRHKILDALQNMMNEVELDGIVQADETYSTISYKGHHKN
FT                   FNLPRPAHKRGTRATKRGISKEQVCVPCGINLDGKSVARISNLGKPSLKNIN"
FT   gene            347355..348179
FT                   /locus_tag="NGO_0356"
FT   CDS_pept        347355..348179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89100"
FT                   /db_xref="GOA:Q5F9N7"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690807.1"
FT                   /protein_id="AAW89100.1"
FT                   /translation="MFALAASNMILRGDGKANLHQSSCFMTDFQDLIKNPKPETGLKRP
FT                   NVGFLNPPYAQSKSDAELHELYFVKEMLDMLAEGGTGIAIIPVSCVIAPSKAKSEIVKY
FT                   HRLKAVMSMPSELFYPVGTVTCIVVFEAHKPHFQTVVIDPDTQEEISTKKACRKTWFGY
FT                   WRDDGFEKTKHLGRIDLYDRWQGIKARWLEHYLNNEVHTGESVTAFVTDNDEWVAEAYL
FT                   ETDYSKITRADFEQVVREFALFQLLGAEVGPTENLDNESYEDDDNNDFGDDE"
FT   gene            348179..349147
FT                   /locus_tag="NGO_0357"
FT   CDS_pept        348179..349147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0357"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89101"
FT                   /db_xref="GOA:Q5F9N6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687768.1"
FT                   /protein_id="AAW89101.1"
FT                   /translation="MVELQEIFDVSYGSKLDLNKMSSFNPTINFVGRSGKNNGVTASVD
FT                   LLKNTKPYPAGLLTVALGGSVLSTFLQNKPFYTAQNVAVLNPKTEMTEQQKLFYCAAIF
FT                   ANAYRFSACGREANRTLRQLFVPSLDEIPSWVESVNLNPSAGVTEPKLKESLDLPVVRQ
FT                   SKRLDEIFTIQNGIAATKLKEFEQRQKDTVVYIRPASTQARTLRSYIARDSVDEKHIFP
FT                   CHTLFTSTNGEGSHTYSYVSTCEFVANSDVAVLTPIQSDMPIEVKLYYAKCITANRYLF
FT                   SYGRKPKGEKLKSIMLPYFDQQEDFDYICRFIHTLLFSNNL"
FT   gene            349429..349851
FT                   /locus_tag="NGO_0358"
FT   CDS_pept        349429..349851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0358"
FT                   /product="chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89102"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706639.1"
FT                   /protein_id="AAW89102.2"
FT                   /translation="MKKMFLSAALLLSAAAQTVWADTVFSCKTDNNKYIEVQKINRNLY
FT                   EYSFGSAAKKEIAIRNSKADLLGRSDRWQGMGSGRRATMKFQNGEFMYTVWTGFDSVTH
FT                   TESSGVVVERRGKEVARVGCTPKTAQANFNDDDFSR"
FT   gene            349869..350633
FT                   /locus_tag="NGO_0359"
FT   CDS_pept        349869..350633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0359"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89103"
FT                   /db_xref="GOA:Q5F9N4"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003699580.1"
FT                   /protein_id="AAW89103.1"
FT                   /translation="METAKPVMLIVRPSGRAKDDVEVCRRAGWQAEVLSPIEIETDEAS
FT                   LKRLPEMYARADAVFWVSPAAVETAVPYLNLSDGIKAHIAVGQGSRRALARYAGAGVFA
FT                   PEDGNDSEAVLRLPVWNSLPEGARVLSVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHK
FT                   PLNFQNFQTENIAAAYITSTELVQSLFAQLPPQFSRFFKSLLYFTHHPRIAEALKREGV
FT                   CSVETVPTLEAALSYSSISVSDGMVFPGTSNQ"
FT   gene            350645..351979
FT                   /locus_tag="NGO_0360"
FT   CDS_pept        350645..351979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0360"
FT                   /product="uroporphyrin-III methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89104"
FT                   /db_xref="GOA:Q5F9N3"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002245525.1"
FT                   /protein_id="AAW89104.2"
FT                   /translation="MGEPENKSSEPVREIQASKEMPSETSSPRKENETEVHIPAAPFIV
FT                   KQSGSNALAACALVLAALGLGASGFLFVQGQNVLKNQELAFNQKIDKAALGESENAALL
FT                   KDNLNRQSAIQSELDRLDSGVKANGEQILMTQKAYRELTKGRADWLVDETETILNLAAQ
FT                   QLVLTGNIQTAVGVLEHIDSRLSRFDQAELLPIKQAVSSDLAELKNRPYVDISGTALRL
FT                   DRLETAVSGLPLILDGVLKPGVQARNEAVSASWWQNVWEKSLGTLKGLVEIRRLENNDA
FT                   MLISPEQAYFVRENLRLRLLDARTALMQRNGEVYQGDLNNAEAAVRQYFDAKSPATQSW
FT                   LKELAELKTLDVRMTADDGLKTSLNAVRAYRDGTRMTAAENQEAEQAASEPANENTASE
FT                   PAAASDVKAIEAPSLPSERKPEQPAKKQPAPEKAGRSPSAKGERA"
FT   gene            351976..353193
FT                   /locus_tag="NGO_0361"
FT   CDS_pept        351976..353193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0361"
FT                   /product="heme biosynthesis protein HemY"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89105"
FT                   /db_xref="GOA:Q5F9N2"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702373.1"
FT                   /protein_id="AAW89105.1"
FT                   /translation="MKTVVWIVVLFAAAVGLALASGIYTGDVYIVLGQTMLRINLHAFV
FT                   LGSLIAVVVWYFLFKFIIGVLNIPENMRRSGSARKGRKAALALNKAGLAYFEGRFEKAE
FT                   LEASRVLGNKEAGDNRTLALMLGAHAAGQMENIELRDRYLAEIAKLPEKQQLSRYLLLA
FT                   ESALNRRDYEAAEANLHAAAKMNANLTRLVRLQLRYAFDRGDALQVLAKTEKLSKAGAL
FT                   GKSEMERYQNWAYRRQMADAADAAALKTCLKRIPDSLKNGELSVSVAEKYERLGLYADA
FT                   VKWVKQHYPHNRRPELLEAFVESVRFLGEREQQKAIDFADSWLKEQPDNALLLMYLGRL
FT                   AYGRKLWGKAKGYLEASIALKPSIPARLVLAKVFDETAQSQKAEAQRNLVLASVAGENR
FT                   PSAETR"
FT   gene            353268..354332
FT                   /locus_tag="NGO_0362"
FT   CDS_pept        353268..354332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0362"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89106"
FT                   /db_xref="GOA:Q5F9N1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9N1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581900.1"
FT                   /protein_id="AAW89106.1"
FT                   /translation="MTLLKNDTFLRALLKQPVEYTPIWMMRQAGRYLPEYKATRTKAGS
FT                   FLDLCKNTGLATEVTIQPLERFDLDAAILFSDILTVPDAMGLGLYFAEGEGPKFKRALQ
FT                   HESDIAKLHVPDMEKLQYVFDAVTSIRKALDGRVPLIGFSGSPFTLACYMVEGGGSKEF
FT                   RTIKTMMYSRPDLLYKILDTNAQAVTAYLNAQIDAGAQAVQIFDTWGGVLSDAAFKEFS
FT                   LKYIRQIVAGLKRESEGRRVPVIVFAKGGGLWLESMAQIGADALGLDWTCNIGEARRRV
FT                   GNQVALQGNFDPSALFGTPESIRTEVARILTGYGHGSGHVFNLGHGINQHADPEHAKIL
FT                   VDTVHELSRQYHGG"
FT   gene            complement(354395..356284)
FT                   /locus_tag="NGO_0363"
FT   CDS_pept        complement(354395..356284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0363"
FT                   /product="DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89107"
FT                   /db_xref="GOA:Q5F9N0"
FT                   /db_xref="InterPro:IPR018310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9N0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221462.1"
FT                   /protein_id="AAW89107.1"
FT                   /translation="MLRTYLNQLTPPELADSVKNTVDGFMEKLSQTEPKIAQNVLLLGN
FT                   VQSGKTAQVLGVLSALADDGDHKVFLYLTTDSVDLQDQTVKRAKANLKNFIVLSEADDR
FT                   SFMEVMKAENPILVVIKKNARVLKRWRNLFASQSSLKGYPLVIVDDEADAASLNTNSDK
FT                   PAKDASTINKLLNDIKNSCCQSLFIQLTATPQSLLLQHEESDWQPEFIHFFEAGEKYIG
FT                   GNFVFSDPPSYIVRFIDSELDDMKDESGEIAEGAKQALLSFLITCAEFALCDKANCNFA
FT                   LHPSYKIQDHQAFSKKIQAFLNDLVQAVNNGEDLAGSFKESYLDLQKTKPDIHHFDEIY
FT                   EKLTALLENKQISTLVVNSQTETDFDLEKGFNIIIGGNVIGRGLTIPKLQTVYYSRTAK
FT                   KPNADTFWQHSRIFGYDRDKSLLRLYIPFDVYYFFVQLNQANNLIIGQAKNSGGNIQVI
FT                   YPKNINPTRKNVLKFDSINQIVGGVNYFPLHPNEDNLSEINKILPSILKDEIQSDLYQI
FT                   DIEDLFLVLDKLGRYVPDDWNKEKFIAGVEALKAQRPSFKTYVLIKTGRKLSRATGTML
FT                   SEDDRKLGEKYPNDLFLTLYQVVGNKDKGWQGKDFWLPNIKLPHNGLVYQSAK"
FT   gene            complement(356285..357322)
FT                   /locus_tag="NGO_0364"
FT   CDS_pept        complement(356285..357322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0364"
FT                   /product="restriction endonuclease NgoFVII"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89108"
FT                   /db_xref="GOA:Q5F9M9"
FT                   /db_xref="InterPro:IPR019065"
FT                   /db_xref="PDB:4RCT"
FT                   /db_xref="PDB:4RD5"
FT                   /db_xref="PDB:4RDM"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687776.1"
FT                   /protein_id="AAW89108.1"
FT                   /translation="MNTVFSNIANAKITEKSLNAVWMDLFKSADEVLMATGYVSNDAVV
FT                   ELHKILELNDHIQKIDLLVGMHYLEGFSHLQYDSLCKLNDFLRHEKRGAVYVSPFVKFH
FT                   GKMYSFKNYQKINGLIGSANLTCFWDSTERTYETMLHLNGKPAQILQADIQSTIHKLGK
FT                   NIQEVERPSKFIEHNSHLENCLGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVF
FT                   FGEGRRDKRGFVKPRPWYEVELIVSKDITSQEGYPVLKSFTVITDDGWQFQCKTSGDYS
FT                   KNFRSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELRSTDNPDVWLLS
FT                   FKGKN"
FT   gene            complement(357319..358443)
FT                   /locus_tag="NGO_0365"
FT   CDS_pept        complement(357319..358443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0365"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89109"
FT                   /db_xref="GOA:Q5F9M8"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702376.1"
FT                   /protein_id="AAW89109.1"
FT                   /translation="MLSKQISNLNSSSNKPKILSLFSGCGGLDLGFHQAGCETVWANDF
FT                   SHWACESFRKNIGDVIVEGDIEQINPNDPTIPDCDIILGGFPCQDFSMIWKQPGLEGER
FT                   GNLYKSFLRFVNAKKPKVFVAENVKGLLTANKKKAIQQIITDFENCGYYVQAKLYNFAE
FT                   FGVPQFRERVLIVGVRLDTGFDFRHPEPTHNETGENGLKPYVTAGQAISNIPQNASNNE
FT                   LLKISDKTRRMLELIPEGGNFTDIPKDHPLYVKGMISHVYRRMHRNEPSKTIIAAGGGG
FT                   TWGYHFPEPRAFTNRERARLQSFPDDFEFVGSTTEVRRQIGNAVPPQGVVELAKSILPI
FT                   FSDNYEKVDLHEKLVEEKEILFHDRLSKIRGGKQ"
FT   gene            358468..358725
FT                   /locus_tag="NGO_0366"
FT   CDS_pept        358468..358725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89110"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951033.1"
FT                   /protein_id="AAW89110.1"
FT                   /translation="MIKILVWILKVNYALNATQRNATQRNATQRNATQRNATQRNATQR
FT                   NATQRNSTIIFNGKVIVWDSCFVFSVIMPQNNRKPPLFVS"
FT   gene            358830..360209
FT                   /locus_tag="NGO_0367"
FT   CDS_pept        358830..360209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0367"
FT                   /product="DNA repair protein RadA"
FT                   /note="Sms; stabilizes the strand-invasion intermediate
FT                   during the DNA repair; involved in recombination of donor
FT                   DNA and plays an important role in DNA damage repair after
FT                   exposure to mutagenic agents"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89111"
FT                   /db_xref="GOA:Q5F9M6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221465.1"
FT                   /protein_id="AAW89111.1"
FT                   /translation="MAKTLKTLYQCTECGGTSPKWQGKCPHCGEWNTLQESFAAPEPKN
FT                   ARFQSWAADASTVQSLSAVTAAEVPRNPTGMGELDRVLGGGLVDGAVILLGGDPGIGKS
FT                   TLLLQTIAKMAQSRKVLYVSGEESAQQVALRSQRLELHAEGVNLLAEIRMEAIQAALKQ
FT                   HQPEVVVIDSIQTMYSDQITSAPGSVSQVRECAAQLTRMAKQMGIAMILVGHVTKDGAI
FT                   AGPRVLEHMVDTVLYFEGDQHSNYRMIRAIKNRFGAANELGVFAMTENGLKGVSNPSAI
FT                   FLASYRDDTPGSCVLVTQEGSRPLLVEIQALVDDAHGFTPKRLSVGLEQNRLAMLLAVL
FT                   NRHGGIACFDQDVFLNAVGGVKIGEPAADLAVILAMLSSFRNRPMPEKTVVFGEIGLSG
FT                   EVRPVARGQERLKEAEKLGFKRAIVPKANMPRNAKEFPNLKIHGVSSLQEAIDICRDSR
FT                   E"
FT   gene            complement(360484..360864)
FT                   /locus_tag="NGO_0368"
FT   CDS_pept        complement(360484..360864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0368"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: pir||D81158 conserved hypothetical
FT                   protein NMB0783 [imported] - Neisseria meningitidis (group
FT                   B strain MD58) >gi|7226015|gb|AAF41196.1| (AE002432)
FT                   conserved hypothetical protein [Neisseria meningitidis
FT                   MC58]"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89112"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M5"
FT                   /protein_id="AAW89112.1"
FT                   /translation="MTTHTLTSKYSFDETVSRLETAIKSKGMDIFAVIDHQEAARRNGL
FT                   TMQPAKVIVFGTPKAGTPLMVKDPAFALQLPLRVLVTETDGKVRTAYTDTRALIVGSRI
FT                   SFDEVANTLANAEKLIQKTVGE"
FT   gene            complement(361088..361447)
FT                   /locus_tag="NGO_0369"
FT   CDS_pept        complement(361088..361447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0369"
FT                   /product="phage-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89113"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013449230.1"
FT                   /protein_id="AAW89113.2"
FT                   /translation="MNIKQLITAALIASAAFATQAAPQKPVSAAQTAQHSAVWIDVRSE
FT                   QEFSEGHLHNAVNIPVDQIVRRIYEAAPDKDTPVNLYCRSGRRAEAALQELKKAGYTNV
FT                   ANHGGYEDLLKKGMK"
FT   gene            complement(361486..365088)
FT                   /locus_tag="NGO_0370"
FT   CDS_pept        complement(361486..365088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0370"
FT                   /product="exodeoxyribonuclease V subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89114"
FT                   /db_xref="GOA:Q5F9M3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003694917.1"
FT                   /protein_id="AAW89114.1"
FT                   /translation="MSAPIRAFDPLTAPISGTNLIEASAGTGKTYGIAALFTRLIVLEQ
FT                   KSVERVLVVTFTKAATAELKTRLRARLDDVLQVLESKEIAELGDDTLSDGIAAYCAEHH
FT                   EGDTFLPALLEQALQKESRTRLIVRLKAAIGQFDNAAIYTIHGFCQRILRDYAFLCQAP
FT                   FDVELTEEDGDRLLVPAQDFWRERVSGDPVLAALAFKRKAVPQTVLAQIRAYLSRPYLN
FT                   FRRPQADLKQAQRDAETSWQTVCRLLPELEAGFWRIHPDLNGNSYRKNSFGNLFKELAQ
FT                   KSAAGQLPCLDKDTHERLLKLSSDKLEAGLKKGKTPDAAVFAELQKLADFGRDLNALEE
FT                   AEETTMIRLQLDLIEYLNSSLAEMKKSRRERGFDDLLLDVHTALTDNPHAETPARAVAE
FT                   NWEIALIDEFQDTDPLQYEIFQKIFIARNRPLFLVGDPKQAIYSFRGADIYAYLQAAED
FT                   ARHRYTLATNYRSHAALIGSIGALFRLKERPFVLENIGYSEVGAARAESRLSPKRPAVQ
FT                   LRWLHENDNEKANKDVLRRRAADYCADEIARALNEASGGRLNFKDRPLQSGDIAVLVRT
FT                   HNEAVMISAALKKRQVQSVLLSRESVFASPEAAALSALIGFWLEPRRAGTLRFVLTSGI
FT                   FGYDAQQLHDFNQNESEILHWAESARTALDIWQKYGIFAAMQQFSQTHGIETRLLSRNN
FT                   GRSLTNYFQLLELLAAEDAQNRNPAALHKWLRDQISLAGNNGGDNRAIRLESDEDLVKI
FT                   VTMHASKGLQYPLVYCPFAWDAQDTGPSDWQILHQGANRAELLAKAQLSESEQKQYADE
FT                   EMAERLRLLYVALTRAEEQLNIYAAYSSDTADNPLAYLIEGLPQDSRETVRRTYACEKD
FT                   GITMLKRNWRRVADNAPAGTDFTFTEDAPPPAAYRGNADQAAEFAANSIPERGFRFVRH
FT                   TSFTALSRHTQTPDGGEEDACPSLDAAETSVPAMPSETPTASDGISIHDFPKGTQAGLC
FT                   LHEILEDFKFGQAAAEQETLIADKLKKYGFEEIWLPAVAEMAEACRKTPLTGAYGLSDI
FT                   PPGCRRPEMGFTLHTEDFGLKRLRDWLARDDIRLPEVCRAAAETLDFHTVNGFLNGFID
FT                   MVCQDPDGNICIIDYKSNHLSAYTRQAMDEAVAHQHYYLQALIYAVAAARYFKLRGQPP
FT                   AAVSVRYLFLRGLDGKGGGVWRWDIDAAALEQIK"
FT   gene            complement(365165..366073)
FT                   /locus_tag="NGO_0371"
FT   CDS_pept        complement(365165..366073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0371"
FT                   /product="peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89115"
FT                   /db_xref="GOA:Q5F9M2"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271909.1"
FT                   /protein_id="AAW89115.1"
FT                   /translation="MNTPQSAIIPDHAQAGIFIEADFAANRLNDIKAACRASLDALSAL
FT                   KARFPDDILGLTIAFGSKAWATFGHTDEGSEIKPFPEMGNGLAPSTQHDMSIHIQSFRQ
FT                   NAAYALAQSVLGAFGDSICVASEEHGLRLYQDRGLDGFVDGTENPQGDETIREVAIIPE
FT                   GLPDAGGSYVLLQKYLHDLKKWDAVPVAEQEASVGRSKETDDEFSRDVRLPDSHLGRVN
FT                   LKENGVGLKIVRRSLPFGKISGEHGLMFTAYCRTLHNIEAQLLSMFGDTDGKTDLLLRH
FT                   LSAAVSGGYYYAPSVERLQNL"
FT   gene            366361..367185
FT                   /locus_tag="NGO_0372"
FT   CDS_pept        366361..367185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0372"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89116"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="PDB:2YLN"
FT                   /db_xref="PDB:3ZSF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357327.1"
FT                   /protein_id="AAW89116.2"
FT                   /translation="MLKKFVLGGIAALVLAACGGSEGGSGASSAPAQSAISGSLIERIN
FT                   NKGTVTVGTEGTYAPFTYHDKDGKLTGYDVEVTRAVAEKLGVKVEFKETQWDSMMAGLK
FT                   AGRFDVVANQVGLTSPERQATFDKSEPYSWSGAVLVAHNDSNIKSIADIKGVKTAQSLT
FT                   SNYGEKAKAAGAQLVPVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNPNAGVKIVWS
FT                   APADEKVGSGLIVNKGNDEAVAKFSTAINELKADGTLKKLGEQFFGKDISVQ"
FT   gene            367175..367891
FT                   /locus_tag="NGO_0373"
FT   CDS_pept        367175..367891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0373"
FT                   /product="cysteine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89117"
FT                   /db_xref="GOA:Q5F9M0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9M0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003683343.1"
FT                   /protein_id="AAW89117.1"
FT                   /translation="MFNNFLASLPFMTETRADMLISAFWPMVKAGFTVSLPLAIASFVI
FT                   GMIIAVAVALVRIMPSGGIFQKCLLKLVEFYISVVRGTPLLVQLVIVFYGLPSVGIYIN
FT                   PIPAAIIGFSLNVGAYASETIRAAILSVPKGQWEAGFSIGMTYMQTFRRIVAPQAFRVA
FT                   VPPLSNEFIGLFKNTSLAAVVTVTELFRVAQETANRTYDFLPVYIEAALVYWCFCKVLF
FT                   LIQARLEKRFDRYVAK"
FT   gene            367901..368656
FT                   /locus_tag="NGO_0374"
FT   CDS_pept        367901..368656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0374"
FT                   /product="amino acid ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89118"
FT                   /db_xref="GOA:Q5F9L9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9L9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010980846.1"
FT                   /protein_id="AAW89118.1"
FT                   /translation="MIKIRNIHKTFGENTILRGIDLDVGKGQVVVILGPSGSGKTTFLR
FT                   CLNALEMPEDGQIEFDNARPLRIDFSKKTSKHDILALRRKSGMVFQQYNLFPHKTVLEN
FT                   VMEGPVAVQGKPAAQAREEALKLLEKVGLGDKVDLYPYQLSGGQQQRVGIARALAIQPE
FT                   LMLFDEPTSALDPELVQDVLDAMKELAREGWTMVVVTHEIKFTLEVATNVVVMDGGVIV
FT                   EQGSPKELFDHLKHERTRRFLSQIQSAKI"
FT   gene            complement(368712..370094)
FT                   /locus_tag="NGO_0375"
FT   CDS_pept        complement(368712..370094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0375"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89119"
FT                   /db_xref="GOA:Q5F9L8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9L8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002213982.1"
FT                   /protein_id="AAW89119.1"
FT                   /translation="MASITRDIFKAYDIRGIVGKTLTDDAAYFIGRAIAAKAAEKGIAR
FT                   IAIGRDGRLSGPELMEHIQRGLTDSGIGVLNVGMVTTPMLYFAAVNECGGSGVMITGSH
FT                   NPPDYNGFKMMLGGDTLAGEAIQELLAIVEKDGFVAADKQGSVTEKDISGAYHDHIVGH
FT                   VKLKRPINIAIDAGNGVGGAFAGKLYKGLGNEVTELFCEVDGNFPNHHPDPSKPENLQD
FT                   LIAALKNGDAEIGLAFDGDADRLGVVTKDGNIIYPDRQLMLFAQDVLNRNPGAKVIFDV
FT                   KSTRLLAPWIKEHGGEAIMEKTGHSFIKSAMKKTGALVAGEMSGHVFFKERWFGFDDGL
FT                   YAGARLLEILSASDNPSEVLDNLPQSISTPELNISLPEGSNGHQVIEELAAKAEFEGAT
FT                   EIITIDGLRVEFPDGFGLMRASNTTPILVLRFEADTQAAIERIQNRFKAVIESNPHLIW
FT                   PL"
FT   gene            complement(370262..370771)
FT                   /locus_tag="NGO_0376"
FT   CDS_pept        complement(370262..370771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0376"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89120"
FT                   /db_xref="GOA:Q5F9L7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9L7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003683610.1"
FT                   /protein_id="AAW89120.1"
FT                   /translation="MIILHTNKGDIKIELDFDKAPVTAKNFEQYVKDGFYDGVIFHRVI
FT                   KGFMIQGGGMDENMNEKETRDPIQNEASNGLPNDKYTIAMARTSDPHSAGAQFFINTAD
FT                   NAFLNFRSKELYGKTVVQDWGYAVFGKVVDGFDVVDAIESVSTKRHGYHDDVPTEPVII
FT                   IKAEAV"
FT   gene            complement(370891..372306)
FT                   /locus_tag="NGO_0377"
FT   CDS_pept        complement(370891..372306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0377"
FT                   /product="anion:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89121"
FT                   /db_xref="GOA:Q5F9L6"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9L6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002239608.1"
FT                   /protein_id="AAW89121.1"
FT                   /translation="MNLHAKDKTQHPENVELLSAQKPITDFKGLLTTIISAVVCFGIYH
FT                   ILPYSPDANKGIALLIFVAALWFTEAVHITVTALMVPILAVVLGFPDMDIKKAMADFSN
FT                   PIIYIFFGGFALATALHMQRLDRKIAVSLLRLSRGNMKVAVLMLFLVTAFLSMWISNTA
FT                   TAAMMLPLAMGMLSHLDREKEHKTYVFLLLGIAYCASIGGLGTLVGSPPNLIAAKALNL
FT                   DFVGWMKLGLPMMLLILPLMLLSLYVILKPNLNERVEIKAESIPWTLHRVIALLIFLAT
FT                   AAAWIFGSKIKTAFGISNPDTVIALSAAVAVVVFGVAQWKEVARNTDWGVLMLFGGGIS
FT                   LSTLLKTSGASEALGQQVAATFSGAPAFLVILIVAAFIIFLTEFTSNTASAALLVPIFS
FT                   GIAMQMGLPEQVLVFVIGIAASCAFMLPVATPPNAIVFGTGLIKQREMMNVGILLNILC
FT                   VVLVALWAYAVLM"
FT   gene            complement(372535..372897)
FT                   /locus_tag="NGO_0378"
FT   CDS_pept        complement(372535..372897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0378"
FT                   /product="VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89122"
FT                   /db_xref="GOA:Q5F9L5"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9L5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002249626.1"
FT                   /protein_id="AAW89122.1"
FT                   /translation="MKLPRNRFSLLSALWFAGGIYSLLFKAADTAPPPFPHFDKAAHLA
FT                   LFFAQILLLAKAFKTGKLPIPYRSLIAFAFCFAVGSECAQAWFTATRTGSLGDVLADLT
FT                   GAALALFAARSACRPD"
FT   gene            complement(372894..373100)
FT                   /locus_tag="NGO_02015"
FT   CDS_pept        complement(372894..373100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02015"
FT                   /product="dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02015"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63617"
FT                   /db_xref="GOA:A0A0H4J5D6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5D6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002243416.1"
FT                   /protein_id="AKO63617.1"
FT                   /translation="MTELKQLIQTESIPVIEETLDFLLYECSIDDAPSAEEVAQWRDIL
FT                   AARGGKFLRLSKICQTWLDEEAA"
FT   gene            complement(373161..373739)
FT                   /locus_tag="NGO_0379"
FT   CDS_pept        complement(373161..373739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0379"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="Enables the recycling of peptidyl-tRNAs produced at
FT                   termination of translation"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89123"
FT                   /db_xref="GOA:Q5F9L4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9L4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F9L4.1"
FT                   /protein_id="AAW89123.1"
FT                   /translation="MSNTIKMVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFKEEK
FT                   KFFGEVARAALPDGDVWLLKPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGR
FT                   IKFKLGGGNGGHNGLKDIQAKLGTADYYRLRLGIGHPGDRNLVVGYVLNKPSAEHRRQI
FT                   DDAVAKSLQAVPDIISGKWEEATRFLHSK"
FT   gene            complement(373792..374070)
FT                   /locus_tag="NGO_0380"
FT   CDS_pept        complement(373792..374070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0380"
FT                   /product="protein RnfH"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89124"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9L3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003712748.1"
FT                   /protein_id="AAW89124.1"
FT                   /translation="MLEIEIVYGLPDRQVLKTMQLAEGTTVRTAALQSGLDGIFENLNL
FT                   HSAPLGIFGKAVKDDTPLRDGDRIEVYRPLLIDPKEARRKRVQNQEE"
FT   gene            complement(374063..374494)
FT                   /locus_tag="NGO_0381"
FT   CDS_pept        complement(374063..374494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0381"
FT                   /product="cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89125"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9L2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221474.1"
FT                   /protein_id="AAW89125.2"
FT                   /translation="MKKVEKNILVLHGADKMFELVDKVEDYPHFLPWYSKTEVIGRSGN
FT                   ELKARLFMDYMRVRQSFATHNRNIPGREIRMELLEGPFKTLRGTWKFIDLGDDMCKIEF
FT                   NLEYDFSNAVLSALISPVFNHLSATLVEAFVKEADRRYA"
FT   gene            complement(374716..376683)
FT                   /locus_tag="NGO_0382"
FT   CDS_pept        complement(374716..376683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0382"
FT                   /product="cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89126"
FT                   /db_xref="GOA:Q5F9L1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9L1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219513.1"
FT                   /protein_id="AAW89126.1"
FT                   /translation="MGNTFKSILVWVALGIGLMAAFNALDGKKEDNGQIEYSQFIRQVN
FT                   NGEVSGVNIEGSVVSGYLIKGERTDKSTFFTNAPLDDNLIQTLLNKNVRVKVTPEEKPS
FT                   ALTALFYSLLPVLLLIGAWFYFMRMQAGGGGKGGAFSFGKSRARLLDKDANKVTFADVA
FT                   GCDEAKEEVQEIVDYLKAPNRYQSLGGRVPRGILLAGSPGTGKTLLAKAIAGEAGVPFF
FT                   SISGSDFVEMFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQ
FT                   TLNQLLVEMDGFESNQTVIVIAATNRPDVLDPALQRPGRFDRQVVVPLPDIRGREQILN
FT                   VHSKKVPLDESVDLLSLARGTPGFSGADLANLVNEAALFAGRRNKVKVDQSDFEDAKDK
FT                   IYMGPERRSMVMHEDEKRATAYHESGHAIVAESLPFTDPVHKVTIMPRGRALGLTWQLP
FT                   ERDRISMYKDQMLSQLSILFGGRIAEDIFVGRISTGASNDFERATQMAREMVTRYGMSD
FT                   KMGVMVYAENEGEVFLGRSVTRSQNISEKTQQDIDAEIRRILDEQYQVAYKILDENRDK
FT                   METMCKALMEWETIDRDQVLEIMAGKQPSPPKDYSHNLRENADAAEDNAPHAPTREKTE
FT                   APAPADTASTESGQQPENKA"
FT   gene            complement(376747..377367)
FT                   /locus_tag="NGO_0383"
FT   CDS_pept        complement(376747..377367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0383"
FT                   /product="23S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89127"
FT                   /db_xref="GOA:Q5F9L0"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9L0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271922.1"
FT                   /protein_id="AAW89127.1"
FT                   /translation="MAVRSKSSKAWLHEHINDQYVHMAQKDGYRARAAYKLLEINEKDK
FT                   IIKPGTVLADLGSAPGSWSQVAAKLTGTSGAVFALDILPMEAIGGVSFIQGDFRENDVL
FT                   AQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVKV
FT                   FQGAGYQEYMAAMREIFGTVQTRKPEASRNRSSEIYLLGKNKR"
FT   gene            377477..377761
FT                   /locus_tag="NGO_0384"
FT   CDS_pept        377477..377761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0384"
FT                   /product="ribosome assembly protein YhbY"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89128"
FT                   /db_xref="GOA:Q5F9K9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9K9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690833.1"
FT                   /protein_id="AAW89128.1"
FT                   /translation="MADTKLNTKEILELKARAHHLHPVVMVGQQGLTDAVIKETDAALT
FT                   AHELIKVRVFGDDRAERIEICNTLCEAVDAQPVRHIGKLLVLWRKNIEA"
FT   gene            377945..378946
FT                   /locus_tag="NGO_0385"
FT   CDS_pept        377945..378946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0385"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="catalyzes the formation of porphobilinogen from
FT                   5-aminolevulinate"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89129"
FT                   /db_xref="GOA:Q5F9K8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9K8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357346.1"
FT                   /protein_id="AAW89129.2"
FT                   /translation="MQFPYRNVPASRMRRMRRDDFSRRLMREHMLTADDLIYPVFVLEG
FT                   AAREEDVPSMPGVKRQSLDRLLFTAEEAVKLGIPMLALFPVVTANKTGRAQEAYNPEGL
FT                   VPSTVRALRERFSELGIMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAE
FT                   AGTQVVAPSDMMDGRIGAIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLG
FT                   KADKKTYQMDPANTDEALHEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQ
FT                   VSGEYAMLQAAVANGWLDGGKVVLESLLAFKRAGADGILTYYAIEAAKMLKR"
FT   gene            complement(379010..380167)
FT                   /locus_tag="NGO_0386"
FT   CDS_pept        complement(379010..380167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0386"
FT                   /product="cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89130"
FT                   /db_xref="GOA:Q5F9K7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9K7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271925.1"
FT                   /protein_id="AAW89130.1"
FT                   /translation="MKFPTRTIHSGYDCDEHNRALMPPIYQNSMFALHEIGENVPYRYS
FT                   RLSNPTRQILEDTVADLEHGAAGFAFSSGMAGIDAVWRTFLRPGDTIVAVADIYGGAYD
FT                   LLVDVYQKWGVNVVFADLGNPDNLDELLKAHNVKLVWLEMPSNPLLRLVDIKALAAKAK
FT                   AADALVGIDNTFATPYLQQPLDMGCDFAFHSATKYLCGHSDVLMGIVVAKTKELAQPLH
FT                   DMMVHTGAIAGPTDCWLVLRGIKTLALRMEAHCKNALEIARRLEAHPAIEKVFHPGLPS
FT                   HEHYALAQAQMPKGIGGVVTVYLKNDTREAANSVIKNMKLVKMTSSLGGVESLVNHCYS
FT                   QSHSGVPHNVKMEMGIRVGLLRFSIGIEDVDDIWNDISAALDTTL"
FT   gene            380370..381143
FT                   /locus_tag="NGO_0387"
FT   CDS_pept        380370..381143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0387"
FT                   /product="GTP cyclohydrolase"
FT                   /note="similar protein in Methanocaldococcus converts GTP
FT                   to 7,8-dihydro-D-neopterin 2',3'-cyclic phosphate as the
FT                   first step in methanopterin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89131"
FT                   /db_xref="GOA:Q5F9K6"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="PDB:3D2O"
FT                   /db_xref="PDB:5K95"
FT                   /db_xref="PDB:5K9G"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9K6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002243420.1"
FT                   /protein_id="AAW89131.1"
FT                   /translation="MNAIADVQSSRDLRNLPINQVGIKDLRFPITLKTAEGTQSTVARL
FT                   TMTVYLPAEQKGTHMSRFVALMEQHTEVLDFAQLHRLTAEMVALLDSRAGKISVSFPFF
FT                   RKKTAPVSGIRSLLDYDVSLTGEMKDGAYGHSMKVMIPVTSLCPCSKEISQYGAHNQRS
FT                   HVTVSLTSDAEVGIEEVIDYVETQASCQLYGLLKRPDEKYVTEKAYENPKFVEDMVRDV
FT                   ATSLIADKRIKSFVVESENFESIHNHSAYAYIAYP"
FT   gene            381340..382005
FT                   /locus_tag="NGO_0388"
FT   CDS_pept        381340..382005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0388"
FT                   /product="NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89132"
FT                   /db_xref="GOA:Q5F9K5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9K5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357347.1"
FT                   /protein_id="AAW89132.1"
FT                   /translation="MTVLSKEQVLSAFKNRKSCRHYDAARKISAEDFQFILELGRLSPS
FT                   SVGSEPWQFVVVQNPEIRQAIKLFSWGMADALDTASHLVVFLAKKNARFDSPFMLESLK
FT                   RRGVTEPDAVEKSLARYQAFQADDIKILDDSRALFDWCCRQTYIALANMMTGAAMAGID
FT                   SCPVEGFNYADMERVLSGQFGLFDAAEWGVSVAATFGYRVQEIVTKARRPLEETVIWA"
FT   gene            complement(382060..382818)
FT                   /locus_tag="NGO_0389"
FT   CDS_pept        complement(382060..382818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0389"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89133"
FT                   /db_xref="GOA:Q5F9K4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9K4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002225415.1"
FT                   /protein_id="AAW89133.1"
FT                   /translation="MNSKISSDHTEDTIRLSKRMAQLGLCSRREADGHIEQGWVTVNGK
FT                   TAVLGQKVSPADRIELNKKAHEQQAARITILLNKPVGYVSAQAEKGYKSAAELITPENC
FT                   WEGDTSRISFDPKHKIGLAPAGRLDIDSVGLLVLTQDGRIAKQLIGENSGSEKEYLVRV
FT                   RGKLDEKGLALLNHGLSLDGDKLRPAKVEWQNEDQLRFVLKQGKKRQIRRMCELVGLRV
FT                   VGLKRIRMGKVKLGRLPPGKWRYLAPGESF"
FT   gene            complement(382843..383733)
FT                   /locus_tag="NGO_0390"
FT   CDS_pept        complement(382843..383733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0390"
FT                   /product="inorganic polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89134"
FT                   /db_xref="GOA:Q5F9K3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9K3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016688388.1"
FT                   /protein_id="AAW89134.1"
FT                   /translation="MNSPFHNIGIVTRPNTPDIQDTAHTLITFLKQHGFTVYLDEVGVR
FT                   ECCIYTQDTDGCHIVNKTELGQYCDLVAVLGGDGTFLSAAREITPRAVPIIGINQGHLG
FT                   FLTQIPREYMTDKLLPVLEGKYLAEERILIEAALIREGKTAERALALNDAVLSRGGAGQ
FT                   MIEFEVFVNQEFVYTQRSDGLIVSTPTGSTAYSLAAGGPIMQAGLHAFTLVPICPQSMT
FT                   NRPIAIPDTSEIEILVTQGGDARVHFDGQSFIDVQNLDRIIIRRYHNPLRILHPTDYQY
FT                   FKTLRQKLHWGEQLV"
FT   gene            complement(383753..384319)
FT                   /locus_tag="NGO_0391"
FT   CDS_pept        complement(383753..384319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89135"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9K2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271930.1"
FT                   /protein_id="AAW89135.1"
FT                   /translation="MSALLPIINRLILQSPDSRSELTSFAGKTLTLNIAGLKLAGRITE
FT                   DGLLSAGNGFADTEITFRNSAIRKILQGGEPGAGDIRLEGDLILGIAVLSLLGSLRSRA
FT                   SDELARIFGTQAGIGSRATDIGHGIKQIGRNIAEQIGGFSREPESANTGNEALADCLDE
FT                   ISRLRDGVERLNERLDRLERDIWID"
FT   gene            complement(384369..385145)
FT                   /locus_tag="NGO_0392"
FT   CDS_pept        complement(384369..385145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89136"
FT                   /db_xref="GOA:Q5F9K1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9K1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581909.1"
FT                   /protein_id="AAW89136.1"
FT                   /translation="MRAVPPPHISITGLGYLGLPLAQKFYRHGSRVAAIKRSLTSDDIN
FT                   LPIHLDTFDLNRTDAFQTALWRHHADKPVWFFLLPPSFLAHYADTVKQWAELARACNVQ
FT                   HLIFTSSTSVYGDKARECDETAAPDPQTESARQILAAEQHLLDNGVPNIDILRLGGLYC
FT                   AERHPVSRLVQKQNIQGGNRPVNIVHRDIAVENLFQTASNPGGRRLKNIIEPRHPTRRE
FT                   FYTEEAAKLGLPAPDFSPDDSVGKIIRTVCDNGLSL"
FT   gene            complement(385200..385850)
FT                   /locus_tag="NGO_0393"
FT   CDS_pept        complement(385200..385850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0393"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89137"
FT                   /db_xref="GOA:Q5F9K0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9K0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221484.1"
FT                   /protein_id="AAW89137.1"
FT                   /translation="MPVTRIAKTNTYTRIIDASLALFNEEGERNISTNHIAAHLGISPG
FT                   NLYYHFRNKDEIIVQLFKRYSEALLAYLNEAVLPSDVEDSINYMAGIYDVMWEYRFLFS
FT                   DVNTLLARSAELLGEHNTFTQAKVSPLLVKLLTQLNGLNVINADQTAMNDLAVNMWMVT
FT                   KYWFDFDSSLRGRTKLTEDSKARGVRRTLSLLRPYLLPEHRAEYDRKIGNGNP"
FT   gene            complement(385862..386902)
FT                   /locus_tag="NGO_0394"
FT   CDS_pept        complement(385862..386902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0394"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89138"
FT                   /db_xref="GOA:Q5F9J9"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9J9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702397.1"
FT                   /protein_id="AAW89138.1"
FT                   /translation="MQPIRYRTDLTPYNTFGLHAQARAFIALKHADELRDIVRLPEFDR
FT                   DTVLWLGGGSNILLMQDYDGLVVHMENKGIREIARSDGMVLIEAQAGEIWHDFVLHTVA
FT                   LGLSGLENLSLIPGTVGASPVQNIGAYGVEAKDVIHSVRCFDLDTETFVTLSNADCRFA
FT                   YRESLFKQEGKGRYVIVSVVFALKTHFVPNLGYGDLAAKVAELSAGREATAKDVSDAVS
FT                   AIRNSKLPDPKVLGNVGSFFKNPVVSAEKAATLLQRHPDMPRYPQPDGSVKLAAGWLID
FT                   QCRLKGFQIGGAAVHDKQALVLVNKNNASANDVRQLAQHIKFTVFARFQVELHAEPNWL
FT                   PTSFSL"
FT   gene            complement(386946..388325)
FT                   /locus_tag="NGO_0395"
FT   CDS_pept        complement(386946..388325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0395"
FT                   /product="multidrug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89139"
FT                   /db_xref="GOA:Q5F9J8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="PDB:5C6P"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9J8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503455.1"
FT                   /protein_id="AAW89139.1"
FT                   /translation="MLLDLDRFSFSVFLKEIRLLTALALPMLLAQVAQVGIGFVDTVMA
FT                   GGAGKEDLAAVALGSSAFATVYITFMGIMAALNPMIAQLYGAGKTGEAGETGRQGIWFG
FT                   LILGIFGMILMWAAITPFRNWLTLSDYVEGTMAQYMLFTSLAMPAAMVHRALHAYASSL
FT                   NRPRLIMLVSFAAFVLNVPLNYIFVYGKFGMPALGGAGCGVATMAVFWFSALALWIYIA
FT                   KEKFFRPFGLTAKFGKPDWAVFKQIWKIGAPIGLSYFLEASAFSFIVFLIAPFGEDYVA
FT                   AQQVGISLSGILYMIPQSVGSAGTVRIGFSLGRREFSRARYISGVSLVSGWVLAVITVL
FT                   SLVLFRSPLASMYNDDPAVLSIASTVLLFAGLFQPADFTQCIASYALRGYKVTKVPMFI
FT                   HAAAFWGCGLLPGYLLAYRFDMGIYGFWTALIASLTIAAVALVWCLEKYSMELVKSHKA
FT                   V"
FT   gene            388382..388570
FT                   /locus_tag="NGO_0396"
FT   CDS_pept        388382..388570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89140"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9J7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003701031.1"
FT                   /protein_id="AAW89140.1"
FT                   /translation="MRNNGAHYIVKNTVPSDGGYGVYKVYSDCVYFMVKFGFNDLTALS
FT                   RRTGAVRILNRKEASPF"
FT   gene            388662..389813
FT                   /gene="hisZ"
FT                   /locus_tag="NGO_0397"
FT   CDS_pept        388662..389813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="NGO_0397"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /note="May allow the feedback regulation of ATP
FT                   phosphoribosyltransferase activity by histidine"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89141"
FT                   /db_xref="GOA:Q5F9J6"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9J6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B4RK97.1"
FT                   /protein_id="AAW89141.1"
FT                   /translation="MQTWQLPEHIADVLPTNARQLESAREQLLALFRVHGYELVQPPLM
FT                   EYAHSLLTHIDAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSANQGINRLCY
FT                   AGPVLHAQPDGLPNMREPLQAGAEMYGFADIRGDIELIDLMLKSMKIADMGKVLLSLGH
FT                   IGIFRALSDAAHLDAGQSAALLALMQDKDTGSVEAQVKAWKLDGMWAKAFSLLPRLYGG
FT                   REVLSDARGRLPDLSAVGGALDELQAVCDAFPDNEIHIDLSELRVDNYHTGLLYAAYAA
FT                   DFHDAVARGGRYDGLGGYFGRARPATGFSFDLRSFIGRLPAVERQPAVLVDAEDAEAAR
FT                   EAVEALREQGQCVVIDYGIGHNVSEELAGRLKKTDGVWQVVKR"
FT   gene            389918..391216
FT                   /locus_tag="NGO_0398"
FT   CDS_pept        389918..391216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0398"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="catalyzes the formation of
FT                   N6-(1,2,-dicarboxyethyl)-AMP from L-aspartate, inosine
FT                   monophosphate and GTP in AMP biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89142"
FT                   /db_xref="GOA:Q5F9J5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9J5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F9J5.1"
FT                   /protein_id="AAW89142.2"
FT                   /translation="MAKNVVVIGAQWGDEGKGKIVDWLAEEAGGVVRFQGGHNAGHTLV
FT                   VGGKKTILRLIPSGILHEGLDCFIGSGVVVSPEALLGEIDELNAAGVKNVEGRLKIAPT
FT                   CPLILPYHIALDQAREASRGKGKIGTTGRGIGPAYEDKVARRAIRAADLLHPEKLREKL
FT                   DAVLAYYNVQLQYLHNAGPVKAEDVMAVIEKVAPRIAPMIADVSRVLNEKNKNGEKLLF
FT                   EGAQGALLDIDYGTYPFVTSSNCLAGAASAGAGVGPQMLDYVLGIVKAYTTRVGSGPFP
FT                   TELFDEVGAGLAERGHEFGSVTGRARRCGWFDAAALKRSIQINGISGMCITKLDVMDGV
FT                   ETINICVGYELPGGGKTDILPCGSDAVETCKPIYETMPGWRESTVGVKSYDALPANAKA
FT                   YLKRIEEVCGAPVAIVSTGPDREETIVLHHPFA"
FT   gene            complement(391452..392291)
FT                   /locus_tag="NGO_0399"
FT   CDS_pept        complement(391452..392291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0399"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89143"
FT                   /db_xref="GOA:Q5F9J4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9J4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019272636.1"
FT                   /protein_id="AAW89143.1"
FT                   /translation="MKRIFLFLATNIAVLVVINIVLAVLGINSRGGAGSLLAYSAVVGF
FT                   TGSIISLLMSKFIAKQSVGAEVIDTPRTEEEAWLLNTVEAQARQWNLKTPEVAIYHSPE
FT                   PNAFATGASRNSSLIAVSTGLLDHMTRDEVEAVLAHEMAHVGNGDMVTLTLIQGVVNTF
FT                   VVFLSRIIANLIARNNDGSQSQGTYFLVSMVFQILFGFLASLIVMWFSRQREYRADAGA
FT                   AKLVGAPKMISALQRLKGNPVDLPEEMNAMGIAGDTRDSLLSTHPSLDNRIARLKSL"
FT   gene            392506..393153
FT                   /locus_tag="NGO_0400"
FT   CDS_pept        392506..393153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0400"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89144"
FT                   /db_xref="GOA:Q5F9J3"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9J3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002232195.1"
FT                   /protein_id="AAW89144.1"
FT                   /translation="MKALLLGAPGAGKGTQAQFITAAFGIPQISTGDMLRAAIKAGTPL
FT                   GLEAKKIIDEGGLVRDDIIIGMVKERIAQDDCKNGFLFDGFPRTLAQAEAMVEAGVGLD
FT                   AVVEIDVSDSVIVDRMSGRRVHLASGRTYHVTYNPPKTEGKDDVTGEDLIQRDDDKEET
FT                   VKKRLAVYHEQTEVLVDFYSKLEGEHAPKYIKVDGTQAVEAVKAEVLGALGK"
FT   gene            393677..394417
FT                   /locus_tag="NGO_0401"
FT   CDS_pept        393677..394417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0401"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89145"
FT                   /db_xref="GOA:Q5F9J2"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9J2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003756133.1"
FT                   /protein_id="AAW89145.1"
FT                   /translation="MNPLITDFQTPQQRTPVIVALDFANEKDTLGFVRNLDPALCQIKI
FT                   GKELFTATGRSLAESLIHQGFKLFLDLKYHDIPHTVAQACKVAADMGVWMVDMHASGGR
FT                   RMMEAAAEAVAGYGTKPLLIGVTVLTSMEQSDLAEIGLNTAPEEQVIRLAKLAQSSGLD
FT                   GVVCSAQEAAPLRRELGRDFVLVTPGIRLDVAGNNDDQRRIMTPAEALAAGSTYLVMGR
FT                   PVTRAADPVAVLREVNRVANLEAN"
FT   gene            394473..395429
FT                   /pseudo
FT                   /locus_tag="NGO_0402"
FT                   /note="hypothetical protein"
FT   gene            395499..396503
FT                   /locus_tag="NGO_0403"
FT   CDS_pept        395499..396503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0403"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89147"
FT                   /db_xref="GOA:Q5F9J0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9J0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015815422.1"
FT                   /protein_id="AAW89147.1"
FT                   /translation="MTIIVTGAAGFIGSNIVKALNQRGITDIVAVDNLTKGEKFKNLAE
FT                   CEIAHYLDKHEFIRQVREHILPYQNIEAVFHQGACSDTMNHDGLYMMENNYQYTLDLLD
FT                   WCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYGYSKFLFDQVLRRRMKEGLTAQ
FT                   VVGFRYFNVYGQHEQHKGRMASVAFHHFHQYREHGYVNLFGSNDGYGNGEQTRDFVSVE
FT                   DVAKINLYFFDHPELSGIYNLGTGRSQQFNELAAAAVNACRAAEGKSELSLKELVEEEL
FT                   IRYIPFPDALKGKYQGFTQADITKLREAGYKEEFFDVKAGVNRYVKWMLENLA"
FT   gene            396578..398122
FT                   /locus_tag="NGO_0404"
FT   CDS_pept        396578..398122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0404"
FT                   /product="restriction endonuclease, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89148"
FT                   /db_xref="GOA:Q5F9I9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687840.1"
FT                   /protein_id="AAW89148.1"
FT                   /translation="MMTEMQQRAQLHRQIWKIADEVRGAVDGWDFKQYVLGTLFYRFIS
FT                   ENFTDYMQAGDSSIDYAAMPDSIITPEIKDDAVKVKGYFIYPGQLFCNIAAEAHQNEEL
FT                   NTKLKEIFTAIESSASGYPSEQGIKGLFDDFDTTSSRLGSTVADKNKRLAAVLKGVAEL
FT                   DFGNFEDHRIDLFGDAYEYLISNYAANAGKSGGEFFTPQSVSKLIARLAVHGQEKVNKI
FT                   YDPACGSGSLLLQAKKQFDEHIIEEGFFGQEINHTTYNLARMNMFLHNVNYNKFHIELG
FT                   DTLTNPKLKDSKPFDAVVSNPPYSIDWIGSDDPTLINDDRFAPAGVLAPKSKADFAFIL
FT                   HALNYLSGRGRAAIVSFPGIFYRGGAEQKIRQYLVEGNYVETVIALAPNLFYGTCIAVN
FT                   ILVLSKHKDNTDIQFIDASGFFKKETNNNVLTEEHIAEIVKLFADKADVPHIAQNAAQQ
FT                   TVKDNGYNLAVSSYVEAEDTREVIDIRQLNAEISETVAKIERLRREIDEVIAEIET"
FT   gene            398238..399089
FT                   /gene="dinD"
FT                   /locus_tag="NGO_0405"
FT   CDS_pept        398238..399089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinD"
FT                   /locus_tag="NGO_0405"
FT                   /product="damage-inducible protein D"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89149"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503458.1"
FT                   /protein_id="AAW89149.1"
FT                   /translation="MTTENNAFENAKHIDETGNEYWSARTLQQILEYSEWRNFQRAIDK
FT                   AITACETSGNDKNHHFVETNKMIALGKGGQREVADYRLSRYACYLIVQNGDPSKSVIAA
FT                   GQTYFAVQARRQELQDEAAFRSLGEDKQRLLLRRQLREHNTDLAAAAKDAGVEKPVEYA
FT                   VFQNHGYRGLYGGLDKQGIHSRKGLKKSQRILDHMNASEPAANLFRATQTEEKLRRKNI
FT                   QGKTQANRVHFEVGQKVRQTIEELGGIMPENQPVPEKSIKQLENEEQKRLAATEQHQNG
FT                   KK"
FT   gene            399256..399882
FT                   /locus_tag="NGO_02155"
FT   CDS_pept        399256..399882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02155"
FT                   /product="restriction endonuclease EcoprrI subunit S"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02155"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63618"
FT                   /db_xref="GOA:A0A0H4IW12"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IW12"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357374.1"
FT                   /protein_id="AKO63618.1"
FT                   /translation="MDMQSKAKKLIEMIQTAPVEWKPLGEVLVRTKGTKITAGQMKEMH
FT                   KDNAPLKIFAGGKTFALVDFDDVPDKDIHREPSIIVKSRGIIEFEYYDKPFSHKNEMWS
FT                   YHSVNKHIYIKYVYYFLKTQENYFRNIGSKMQMPQIATPDTDNYKIPIPSLETQQKIVK
FT                   ILDKFTELEATLEATLEAELALRKRQYRYYRDLLLDFDNQIGGDS"
FT   gene            399854..400477
FT                   /locus_tag="NGO_02160"
FT   CDS_pept        399854..400477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02160"
FT                   /product="restriction endonuclease subunit S"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02160"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63619"
FT                   /db_xref="GOA:A0A0H4ISM2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISM2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503463.1"
FT                   /protein_id="AKO63619.1"
FT                   /translation="MTIKSGGIADGYQCRLKNVVWKTLGEVAEYSKNRICSDKLNEHNY
FT                   VGVDNLLQNREGKKLSGYVPSEGKMTEYIVNDILIGNIRPYLKKIWQADCTGGTNGDVL
FT                   VIRVTDEKVNPKYLYQVLADDKFFAFNMKHAKGAKMPRGSKAAIMQYKIPIPPLPEQEK
FT                   IVAILGKFDTLTHSVSEGLPHEIALRRKQYEYYREQLLAFPKAA"
FT   gene            400709..403807
FT                   /locus_tag="NGO_0407"
FT   CDS_pept        400709..403807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0407"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89150"
FT                   /db_xref="GOA:Q5F9I7"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503464.1"
FT                   /protein_id="AAW89150.1"
FT                   /translation="MNLETKPIAETPNFIVLDQYEKIEQSGSYQSENRLEAELIADLQN
FT                   QGYEYRKDLNSQSRLLENLRAQLQRLNDVAFSDGEWARFLTEYLDRPAENITDKTRKIH
FT                   DDHIYDFAFDDGRLKNIYLLDKKNLARNHVQLINQFEQTGTHANRYDVTVLVNGLPLVQ
FT                   IELKKRGVAVREAFNQVHRYSKESFNSGNSLFKFLQIFVISNGTDTRYFANTTKRDKNS
FT                   FDFTMNWARSDNHPIKDLKDFTATFLQKSVLLSVLLHYSVFDANDTLLIMRPYQIAAAE
FT                   RILWKINSSAQAKNWSGPESGGYVWHTTGSGKTLTGFKAARLATESAFIDKVFFVVDRK
FT                   DLDYQTMKEYQRFSPDSVNGSESTAGLKRNLEKDGNKIIVTTIQKLNNLMKSEDNLPVY
FT                   HRQVVFIFDECHRSQFGEAQKNLKKKFKKFCQFGFTGTPIFPENALGAETTAGVFGREL
FT                   HSYVITDAIRDEKVLKFKVDYNDVRPQFKAVEAEQDEKELSAAENRQALLHPERIREIT
FT                   QYILSRFRQKTHRLNAGGKGFNAMFAVSSVDAAKCYYEAFKTQQAGSLHPLKTATIFSF
FT                   AANEEQNAVGEIVDETFEPEAMDSSAKEFLQAAINDYNACFKTNFGTDSKAFQNYYRDL
FT                   AKRVKNREVDLLIVVGMFLTGFDAPTLNTLFVDKNLRYHGLMQAFSRTNRIYDATKTFG
FT                   NIVCFRDLEQATIDAITLFGDKNTKNVVLEKSYEEYMNGYTDSQTGEARRGYLDVAKEL
FT                   HERFPDPDKIETEKDKKDFAKLFGEYLRAENVLQNYDEFAALRELQNVDAADEDAMKAF
FT                   QEKYYLSDEDVQEMRKVPMPSERAVQDYRSAYNDIRDWLRRQKAGEQKEQSKIDWDDVV
FT                   FEVDLLKSQEINLDYILQLVFEHHKKIKGKAELVEEIRRIIRASIGHRAKEGLIVDFIN
FT                   DTDLDKVPDVPAILETFYTYAQEVMRHEAAGLIAAEGLNETAAKRYLTGSLKRGYASEN
FT                   GTELTETLPKMSPLNPQYLTKKQSVFQKIAAFVEKFAGIGADI"
FT   gene            complement(403847..406138)
FT                   /gene="clpA"
FT                   /locus_tag="NGO_0408"
FT   CDS_pept        complement(403847..406138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="NGO_0408"
FT                   /product="Clp protease ClpX"
FT                   /note="ATPase and specificity subunit of the ClpA-ClpP ATP
FT                   dependent serine protease; directs protease to specific
FT                   substrates"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89151"
FT                   /db_xref="GOA:Q5F9I6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692802.1"
FT                   /protein_id="AAW89151.1"
FT                   /translation="MLAPELEQILQQLYREARKAHYEFISLEHLLLVLIEEDAAVPNVL
FT                   KLCGADLKAVSEQLAASVAENTPLIPDHLLDTVETRPTLGFQRVIQRAMVHTQSAGKGL
FT                   AEPLDVLVALMSETDSHAVYFLGLQSVTRFEVLRCIAHGSPDEDEDDGNYFSDGMDDDN
FT                   ENRTKPGKNPLSAYTVNLNAEVKAGRIDPLIGRKHEMERLVQILCRRRKNNPLLVGEAG
FT                   VGKTALADGLAHQIVNDDIPDALKEAEVYALDMGSLLAGTKYRGDFEARVKSVLKQLEK
FT                   IPHAILFIDEIHTIIGAGSTGGGTMDASNLLKPALAKGSLRCIGATTYDEYRTIFDKDH
FT                   ALSRRFQKIDVVEPTVAETVQILRGLKPMFEAFHQVRYTQGALEAAAELSARYINERFL
FT                   PDKAIDVMDEAGAAQRILPKSKQKKVIGKAQIETVIAKVARIPEKTVSHDDKQVLQFLG
FT                   RDLNNMVYGQEDAIDALVSAVKMSRSGLGLPDKPIGSFLFSGPTGVGKTEVAKQLAYSM
FT                   GVPLQRFDMSEYMERHAVSRLIGAPPGYVGFEQGGLLTEAVNKQPHCVLLLDEIEKAHP
FT                   DIFNVLLQVMDAGKLTDNNGKSADFRNVILIMTTNAGAESLSRPSLGFTAKRERGDEMQ
FT                   AINKLFTPEFRNRLDAIIPFAPLSEPIIVKVVDKFLLQLEHRLLDKKVEAEFTPALRKY
FT                   LAEKGFDPQMGARPMHRLIQEKIRKPLADELLFGKLADGGFVRIDWDAAKEEAVLKFKK
FT                   SKVKIKTASA"
FT   gene            complement(406140..406454)
FT                   /locus_tag="NGO_0409"
FT   CDS_pept        complement(406140..406454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0409"
FT                   /product="Clp protease ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89152"
FT                   /db_xref="GOA:Q5F9I5"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9I5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003712799.1"
FT                   /protein_id="AAW89152.2"
FT                   /translation="MGHAMTAQHQSDTLLHRLNTLPPKRYGVFLLNDDYTTMEFVVEIL
FT                   TEIFMLGQEQAVAVMLSVHHEGKGLCGTYTRDIAQTKQQQVMQRAKAEGHPLQCIVEEI
FT                   "
FT   gene            406687..406890
FT                   /locus_tag="NGO_0410"
FT   CDS_pept        406687..406890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0410"
FT                   /product="cold-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89153"
FT                   /db_xref="GOA:Q5F9I4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016687461.1"
FT                   /protein_id="AAW89153.1"
FT                   /translation="MATGIVKWFNDAKGFGFITPDEGGEDLFAHFSAINMEGFKTLKEG
FT                   QRVSFDVTTGPKGKQAANIQAA"
FT   gene            complement(407189..408520)
FT                   /gene="pmbA"
FT                   /gene_synonym="tldE"
FT                   /locus_tag="NGO_0411"
FT   CDS_pept        complement(407189..408520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /gene_synonym="tldE"
FT                   /locus_tag="NGO_0411"
FT                   /product="peptidase PmbA"
FT                   /note="protease involved in proteolytic processing of the
FT                   antibiotic Microcin B17 and in sensitivity to the DNA
FT                   gyrase inhibitor LetD"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89154"
FT                   /db_xref="GOA:Q5F9I3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013449192.1"
FT                   /protein_id="AAW89154.1"
FT                   /translation="MLFNHTASELLDLCRRTLDLAKAAGATAAEADFSESLGQSVSVRL
FT                   GEIEQIEFQQDKSLDITVYVGKRKGRAGTADFSEQALRDTVRAAADIARHTAEDGCAGL
FT                   ADPELMAQHIGDPDLYHEWDLDTEAAVGLAKQCEQAALDTDSRIENSEGAAVQTGHYQY
FT                   VYGNTHGFAAHRQSTHHSISCSVVAADENGMQRDYWYDSACRHPDMDSPETIGQTAARR
FT                   TLRRLGSRSIPTGSYPVLFDTTVSGGLIGHLVGTLSGGALYRQSSFLIDSIGKKVLPDF
FT                   LNLREEPHIPRSFRSSYFDAEGVATAPRFVIQNGIVEGYFLGSYSARKLGMQTTGNAGG
FT                   AHNLYLNHTHETQSDLLKEMGTGLLVTELMGQGANTITGDYSRGAAGFWVENGVIAYPV
FT                   HEITVAGRLQDMYRDIVGVADDALRRSSNKIGSILIAGMTVAGS"
FT   gene            408674..409180
FT                   /locus_tag="NGO_0412"
FT   CDS_pept        408674..409180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89155"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357415.1"
FT                   /protein_id="AAW89155.1"
FT                   /translation="MFEQEDEWISKTQMKKQMNGLQDLGMELTRLSNDTLKKIGLDEDL
FT                   YEAVVTYKKITSNGALKRQAQFIGRLMRDTDPAPIEAFLAKLRGDDAAHNAFLQRVEQA
FT                   RVRLLADEGALTQFMSDFPNAGAGRLRTLVRNTKKEQEQDKPPKNFRALFQELKTVMEN
FT                   GGAEI"
FT   gene            409227..409940
FT                   /locus_tag="NGO_0413"
FT   CDS_pept        409227..409940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0413"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89156"
FT                   /db_xref="GOA:Q5F9I1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706625.1"
FT                   /protein_id="AAW89156.1"
FT                   /translation="MLFRKTTAAVLAATLILNGCTMMLRGMNNPVSQTITRKHVDKDQI
FT                   RAFGVVAEDNAQLEKGSLVMMGGKYWFAVNPEDSAKLTGLLKAGLDKPFQIVEDTPSYA
FT                   RHQALPVKFEAPGSQNFSTGGLCLRYDTGRPDDIAKLKQLEFKAVKLDNRTIYTRCVSA
FT                   KGKYYATPQKLNADYHFEQSVPADIYYTVTEKHTDKSKLFGNILYTPPLLILDAAAAVL
FT                   VLPMALIAAANSSDK"
FT   gene            410009..411709
FT                   /locus_tag="NGO_0414"
FT   CDS_pept        410009..411709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0414"
FT                   /product="single-stranded DNA exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89157"
FT                   /db_xref="GOA:Q5F9I0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9I0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015815431.1"
FT                   /protein_id="AAW89157.1"
FT                   /translation="MSVKIQTRPVNTDVFNHLLAAGADPLIARLCASRGVQSPAELDDK
FT                   LASLLPYQSLTNCEAAAGRLADAVERKEKILIVADYDADGATACAVGLDGLAAMGAKVD
FT                   FLVPNRFEHGYGLTPELAEIAAAQGVDLLITVDNGIASIAGVARAQALGLDVIVTDHHL
FT                   PADTVPDCIIVNPNQKGCGFPSKSLAGVGVIFYVLTALRAELRRRNYFSDGIKEPNLGG
FT                   LLDLVALGTVADVVPLDHNNRILVSQGLKRMRSGKMRPGIRALFEVARRDWRKAQPFDM
FT                   GFALGPRINAAGRLDDMSVGIACLLARDDSEAQELAARLNNLNIERREIEQSMLRDALN
FT                   AFPETLPSGQTTLVAYRDDFHQGVVGIVASRLKDRFYRPTIVFAPADNGEVRGSGRSIP
FT                   NLHLRDALDLVSKRHPDLILKFGGHAMAAGLSILEHNIPAFQTAFEEAVREMVCEDDLS
FT                   QTYITDGSLPACDITLEQAQNLACHVWGQGFAPPSFTDEFHVVRQQPLGAEGKHKKAWL
FT                   QKDGCEFEAMFWRCSEDIPEYIRTVYRPVANEWRNNLELQLYIDYWEAA"
FT   gene            412067..413425
FT                   /locus_tag="NGO_0415"
FT   CDS_pept        412067..413425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0415"
FT                   /product="PcnB"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89158"
FT                   /db_xref="GOA:Q5F9H9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9H9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359904.1"
FT                   /protein_id="AAW89158.1"
FT                   /translation="MLKKWLNKMLPSGRSSKKAESKTVIPAERHNISAEMLSFAAENVI
FT                   RRLKGAGFQAYVVGGAVRDLLLGIEPKDFDVATDATPEQVHKLFRRSRIIGRRFQIVHV
FT                   MNGAEIIEVTTFRGGAKVHQNAHGRIMKDNTYGSIEEDAMRRDFTCNALYYDPEKEEIL
FT                   DFHNGIADVAARRLVMIGNAAERYQEDPVRILRAIRLSGKLGFELSEETAAPIAESICR
FT                   LKHEPVARLFDEIMKLLFSGHARECLKRLNGFDIPDIHPLLNALRVSDGIAGKMTALAL
FT                   KNTDERLRADKSVSVGFVLAALMWPELDRHWKSNLQQGLKPTPALSDAINTMRETVERG
FT                   WGVPQRFSATMREIWMFQPQFENRKGARPHKLFAQARFRAAYDFLLLRAETGNADRALA
FT                   EWWTAFQTASAEQRTEMTKNEAAARHEKNEGQAKKRRRRRRKPKPKVVGTDWE"
FT   gene            413598..413921
FT                   /locus_tag="NGO_0416"
FT   CDS_pept        413598..413921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0416"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9H8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002213914.1"
FT                   /protein_id="AAW89159.1"
FT                   /translation="MKKCILGILTACAAMPAFADRISDLEARLAQLEHRVAVLESGGNT
FT                   VKIDLFGSNSTMYVCSVTPFQKTFEASDRNEGVARQKVRQACNRETSAMFCGDEAIRCR
FT                   KFD"
FT   gene            complement(414026..414979)
FT                   /locus_tag="NGO_0417"
FT   CDS_pept        complement(414026..414979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0417"
FT                   /product="phosphate starvation protein PhoH"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89160"
FT                   /db_xref="GOA:Q5F9H7"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9H7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002258530.1"
FT                   /protein_id="AAW89160.1"
FT                   /translation="MTHTVHLHLEETDNPTLQRLCGSFDSNLDSLAKALDIHISRRFEH
FT                   FTFNGAFAHAGKRALLKLLETAQTRDLNDSIIRLAAVETQTEDAGHQEKNHEHAYYFRT
FT                   KRGSIGGRTPRQNGYIRALLDHDIVFGLGPAGTGKTYLAVAAAVDAMEKHQVERIILVR
FT                   PAVEAGEKLGFLPGDLTQKVDPYLRPLYDALYDLMGFDRVTKLIEKGLIEIAPLAYMRG
FT                   RTLNGAYIILDEAQNTTPEQMKMFLTRIGFGAKAVITGDTSQIDLPKNIKSGLKDAREK
FT                   LHGVAGLYFHTFTGEDVVRHPLVQKIVEAYESAEHD"
FT   gene            complement(415005..415562)
FT                   /locus_tag="NGO_0418"
FT   CDS_pept        complement(415005..415562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0418"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89161"
FT                   /db_xref="GOA:Q5F9H6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9H6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503466.1"
FT                   /protein_id="AAW89161.2"
FT                   /translation="MFCTVSHLRRLKGHDVLLTAFARALAQCPQLRLNIGGSGQEEQRL
FT                   KQQAADLGIAHAVTFLGALQPEAILDLMRNSDAFILASRTETFGVVYIEALSQGLPVIA
FT                   IHCGGAESIVSDGNGYLVSVDDADVLALLKIYEHHADFSAEQLRTDCLATFGEDAVIGR
FT                   LIAVFRQAARNTARKRPKNRLK"
FT   gene            complement(415590..416177)
FT                   /locus_tag="NGO_0419"
FT   CDS_pept        complement(415590..416177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0419"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89162"
FT                   /db_xref="GOA:Q5F9H5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9H5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951039.1"
FT                   /protein_id="AAW89162.1"
FT                   /translation="MVSTIRTGCGRNIFPKSSTDPPTQRHQNRHPRPHVPLSAERNSKH
FT                   PDRSLRFCPIPAKRFGHLRMAQHVFLPRFPFIDIDRIRWVRAGLKAFKHYIRENGLPDL
FT                   IHAHCMNYAGILAQKISEKYGIPYVLTEHSSTITRGLIRHHQWQPMEKAAAPASARLAV
FT                   SRHFAHVLQHKYGCEWQYLPNIPGGIFKQTFE"
FT   gene            416315..417049
FT                   /locus_tag="NGO_0420"
FT   CDS_pept        416315..417049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0420"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: pir||A81871 probable periplasmic
FT                   protein NMA1059 [imported] - Neisseria meningitidis (group
FT                   A strain Z2491) >gi|7379755|emb|CAB84323.1| (AL162755)
FT                   putative periplasmic protein [Neisseria meningitidis]"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89163"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9H4"
FT                   /protein_id="AAW89163.1"
FT                   /translation="MAVFQVRIRICCVLFWRLPCWRYLFPAAAEALNYNIVEFSESAGI
FT                   EVAQDTMSARFQVAAEGRDKNAVNAEFVKKFNNFTRKSKNGSFKTELVSRSAMPRYQYT
FT                   NGRRIQTGWEERAEFKAEGRDFDALNRFIADVQTDASLEDTDFSVSRERRNEVIDQVSK
FT                   DAVLRFKARAEKLAGVLGASGYKIVKLNFGQIGSHIAGDGAVRAKMLRAMPMAASVNMK
FT                   GTDSAAPGVEEISISINGTVQF"
FT   gene            complement(417115..417681)
FT                   /gene="dcd"
FT                   /locus_tag="NGO_0421"
FT   CDS_pept        complement(417115..417681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="NGO_0421"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="Catalyzes the formation of dUTP from dCTP in
FT                   thymidylate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89164"
FT                   /db_xref="GOA:Q5F9H3"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9H3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003823864.1"
FT                   /protein_id="AAW89164.1"
FT                   /translation="MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGQRIISYGTSSYGY
FT                   DIRCANEFKIFTNINSTIVDPKNFDPKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNV
FT                   LTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGVAQVLFFESD
FT                   EVCETSYKDRNGKYMGQTGVTLPKA"
FT   gene            complement(417777..418166)
FT                   /locus_tag="NGO_0422"
FT   CDS_pept        complement(417777..418166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0422"
FT                   /product="MORN repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89165"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9H2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687866.1"
FT                   /protein_id="AAW89165.1"
FT                   /translation="MLKHLAFLLPAMMFALPAQTAVLSPYQETGCTYEGGIGKDGLPSG
FT                   KGIWRCRDGRGYTGSFKNGKFDGQGVYTVAAGREVFLEPFNSDSTKFRNMALSGTFKQG
FT                   LAHGRFAASQNGETLFYYEMRTRHD"
FT   gene            complement(418218..419117)
FT                   /locus_tag="NGO_0423"
FT   CDS_pept        complement(418218..419117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0423"
FT                   /product="recombinase RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89166"
FT                   /db_xref="GOA:O87408"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87408"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:O87408.1"
FT                   /protein_id="AAW89166.1"
FT                   /translation="MWFKQISFYPLNKEKLPEADVLADKLAEAEFTHCQGLDWFSEGFT
FT                   APVSFSPELVFPADFTLRVALKKEEKVLPAGVIRDILEEKVAEIQNNEARNVGRKEKQE
FT                   LKEQITDDLLPRAFTRSSRTEAVFNTRHGYLLVNNAASAKAENILTKLREALGGLEASL
FT                   PNTKQSPSSLMTGWLLQGHCEGGFELDSDCELKGTGDIVPVVKVSKQDLTADEVVQHVK
FT                   NGKTVTRLGLVWREQIAFILTQDFTLKRIQYLDVLQEEAESNGDDAAGLAFASQILMAE
FT                   SVSTMLEELVSYLGGWQD"
FT   gene            complement(419148..420605)
FT                   /locus_tag="NGO_0424"
FT   CDS_pept        complement(419148..420605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0424"
FT                   /product="GTP-binding protein Der"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89167"
FT                   /db_xref="GOA:O87407"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87407"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009311940.1"
FT                   /protein_id="AAW89167.1"
FT                   /translation="MKPTIALIGRPNVGKSTLFNRLTRTKDALVHDLPGLTRDRHYGHG
FT                   KVGSKPYFVIDTGGFEPVVDSGILHEMAKQTLQAVDEADAVVFLVDGRTGLTPQDKIIA
FT                   DRLRQSPRPVYLAVNKGEGGDRAVLAAEFYELALGEPHVISGAHGDGVYYLIEEILENF
FT                   PEPEAEEADAKHPVFAVIGRPNVGKSTLVNAILGEKRVIAFDMAGTTRDSIHIDFEREG
FT                   KPFTIIDTAGVRRRGKVDEAVEKFSVIKAMQAVEAANVAVLVLDAQQDIADQDATIAGF
FT                   ALEAGRALVVAVNKWDGISEERREQVKRDISRKLYFLDFAKFHFISALKERGIDGLFES
FT                   IQAAYNAAMIKMPTPKITRVLQTAVERQQPPRAGLVRPKMRYAHQGGMNPPVIVVHGNS
FT                   LHAISDSYTRYLTQTFRKAFNLQGTPLRIQYNVSENPYENAEDKPKKKPLRRVSLSNRI
FT                   EKREGRKEEKNRFKKKTKVSVKKQFSK"
FT   gene            complement(420755..421384)
FT                   /locus_tag="NGO_0425"
FT   CDS_pept        complement(420755..421384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89168"
FT                   /db_xref="GOA:O87406"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87406"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019742838.1"
FT                   /protein_id="AAW89168.1"
FT                   /translation="MAAHLEEQQELDNFKYFWKTTGKWLFALLILAALGYLGYTVYQNR
FT                   AASQNQEAAAVLANIVEKAQNKAPQSEINAELSKLQQSYPHSISAAQATLMAAATEFDA
FT                   QRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEADFAPLL
FT                   METKGDVYAAQEKSQEALKNYGQALEKMPQDSVGRELLQMKLDSLK"
FT   gene            complement(421385..422680)
FT                   /locus_tag="NGO_0426"
FT   CDS_pept        complement(421385..422680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0426"
FT                   /product="histidyl-tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89169"
FT                   /db_xref="GOA:Q5F9G8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9G8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503468.1"
FT                   /protein_id="AAW89169.1"
FT                   /translation="MAQKIQSVKGMNDLLPVGQKDFKLTAVFWQAFEDTVNRWTRAYGY
FT                   QQIRTPIVEQTGLFVRSIGEETDVVGKEMYTFSDSNDSLSLSLRPEGTASCLRAVVEHN
FT                   LLYNSPQKLWYMGPMFRRERPQKGRYRQFHQVGIEALGFEGPDIDAEIIAMSADLWEKL
FT                   GIREYLTLEINSLGNREERAAHRAALVEYLTRYEAQLDEDSKRRLKTNPLRVLDTKNPD
FT                   LQEICNAAPRLVDYLGEASQNHYARFKAMLDGLGIQYIENSRLVRGLDYYNQTVFEWTT
FT                   DKLGAQATVCGGGRYDGLIEELGGKPAPSIGFAMGIERLLLLVSEYGSLEVNAAPDVYA
FT                   MHQGEGADLQVMKYAQALRAQGFNVIQHSGYQSLKAQMKKADNSGARFALIVAQDELAD
FT                   GTVTLKDMNGAHGQQTVSATDLTDTLQQWKNA"
FT   gene            complement(422808..423464)
FT                   /locus_tag="NGO_0427"
FT   CDS_pept        complement(422808..423464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0427"
FT                   /product="peptidase C39"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89170"
FT                   /db_xref="GOA:Q5F9G7"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9G7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503469.1"
FT                   /protein_id="AAW89170.1"
FT                   /translation="MEQKRRFAASLLLAAALPLCAHSFPFAEENPIAYGKVKIQSWKAR
FT                   RDFNIVKQDLDFSCGAASVATLLNNFYGQTLTEEEVLEKLGKEQMRASFEDMRRIMPDL
FT                   GFEAKGYALSFEQLAQLKIPVIVYLKYRKDDHFSVLRGIGGNTVLLADPSPGHVSMSRA
FT                   QFLEAWQTREGNLAGKILAVVPKKAEAISNKLFFTHHPKRQTEFAVGQIRQGRAE"
FT   gene            complement(423520..423744)
FT                   /locus_tag="NGO_0428"
FT   CDS_pept        complement(423520..423744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0428"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89171"
FT                   /db_xref="GOA:Q5F9G6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9G6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002230141.1"
FT                   /protein_id="AAW89171.1"
FT                   /translation="MMKNKYILIKAAIGITAISIFYLLTQGSIGKTEEPSYFLMFMFLN
FT                   SLWFEENKTVMAAVTAMIAAHFIFVALSD"
FT   gene            complement(423973..424110)
FT                   /locus_tag="NGO_0429"
FT   CDS_pept        complement(423973..424110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89172"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9G5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690878.1"
FT                   /protein_id="AAW89172.1"
FT                   /translation="MELKYCNREAKASVVTFTIYFIILISSKNKIQDYTYRQSFLDCFV
FT                   "
FT   gene            complement(424690..424962)
FT                   /locus_tag="NGO_02280"
FT   CDS_pept        complement(424690..424962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02280"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02280"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63620"
FT                   /db_xref="GOA:A0A0H4IV06"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IV06"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002220648.1"
FT                   /protein_id="AKO63620.1"
FT                   /translation="MFAVIFFSTLGCILAWIRDIPKIKSKKILARSLYIIGIINVIISY
FT                   VLIKNILVSVSDGGGIKYVAIYLSNLFFWTVLMYVLVKRLSKKPS"
FT   gene            complement(425228..425518)
FT                   /locus_tag="NGO_0430"
FT   CDS_pept        complement(425228..425518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0430"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89173"
FT                   /db_xref="GOA:Q5F9G4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9G4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690880.1"
FT                   /protein_id="AAW89173.1"
FT                   /translation="MDDLILYFLSGIFGNQVAEYIIKNNREIKVPFIALYAIFFTLIYT
FT                   VALLFLSLIYWVNGAEIAWKGIGIFSMSVSFCIVFCLYLIDKAGRCKDKKQ"
FT   gene            complement(425839..426042)
FT                   /locus_tag="NGO_02290"
FT   CDS_pept        complement(425839..426042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02290"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRN9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359911.1"
FT                   /protein_id="AKO63621.1"
FT                   /translation="MGGQYSSLENFALSVLREKIINNTVSSDEKLLIINDFLSGFLEFD
FT                   PETGEPVGETLKIEQMIDFFLV"
FT   gene            complement(426078..426620)
FT                   /locus_tag="NGO_0432"
FT   CDS_pept        complement(426078..426620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89174"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9G3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706619.1"
FT                   /protein_id="AAW89174.1"
FT                   /translation="MKRIFLPALPAILPLSAYADLPLTIEDIMTDKGKWKLETSLTYLN
FT                   SENSRAALAAPVYIQTGATSFIPIPTEIQENGSNTDMLAGTLGLRYGLTGNTDIYGSGS
FT                   YLWHEERKLDGNGKTRNKRMSDISAGISHTFLKDGKNPALISFLESTVYEKSRNKASLI
FT                   KKRGLCPFYNLRINYEY"
FT   gene            426786..427709
FT                   /locus_tag="NGO_0433"
FT   CDS_pept        426786..427709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0433"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89175"
FT                   /db_xref="GOA:Q5F9G2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9G2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002213884.1"
FT                   /protein_id="AAW89175.1"
FT                   /translation="MKKRNNPLPLLNGVKPSYLVLPHEKQFYGLPLLHFLCIRFPFLGA
FT                   DDWRRRLNSGFVVGSDGAALDEHSLFEPGKTMFYYRETGCESEPRIPFEEKILFVDEHL
FT                   IVVDKPHFLPVIPGGRFLRETLLTRLRLRPELQHLNVEDITPIHRLDKDTAGVMLLSHN
FT                   PATRGAYQTMFQNKTVWKTYEALAPTKTDLPYPLDVVSRLVRGEKFFTTQEAEGVPNAH
FT                   TTVELIENRGEFSLYRLTPHTGKKHQLRVHMMGLGMPLLNDALYPVPSEAGSEDYRKPL
FT                   KLLAKKIAFADPLSGRERVFCSGFCL"
FT   gene            complement(427788..428429)
FT                   /locus_tag="NGO_0434"
FT   CDS_pept        complement(427788..428429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0434"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89176"
FT                   /db_xref="GOA:Q5F9G1"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9G1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221511.1"
FT                   /protein_id="AAW89176.1"
FT                   /translation="MLKPETIHIPGPAGILETIHIPSEQVPARGVAVINHPNPLQGGTN
FT                   TNKVIQTAAKALSKLGFHCYLPNLRGVGGSEGTHDYGRGETQDCLAVIDYARAQHPEAP
FT                   EFALSGFSFGGYVATFAAQVSIPDLLLLIGAAVCHYTDRPEPSAVPNVAKTLMIHGAED
FT                   EVVEIEKALKWAEPQDLPVITIAGSTHFFHGKLIVLRDTILRFAPVCLNG"
FT   gene            complement(428484..429275)
FT                   /locus_tag="NGO_0435"
FT   CDS_pept        complement(428484..429275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0435"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="catalyzes the formation of spermidine from
FT                   putrescine and S-adenosylmethioninamine"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89177"
FT                   /db_xref="GOA:Q5F9G0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9G0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016670666.1"
FT                   /protein_id="AAW89177.1"
FT                   /translation="MARHPYRRLRPAKSGFPEVGISEEGNIRSLHLGSDTVQSSMNLDR
FT                   PSELVLSYSRAMMGWLLFAERLPQHITQIGLGGGSFARWTDTYLPDTRQTAVDINPQVI
FT                   AIARNLFELPFEGGKFEIIEADGAEYIKVFRHNTDIILVDGFDGEQIIDTLVEEPFFRD
FT                   CRNALSSDGIFVTNWWSGDKRYQRFIERLLSVFEGRVLELPAESHGNVAVMAFQSSPKE
FT                   QNIDKLKKRADKLSNAYGLDFHRMLAGLKASNPNNGKHFHL"
FT   gene            429441..429516
FT                   /locus_tag="NGO_18826"
FT   tRNA            429441..429516
FT                   /locus_tag="NGO_18826"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:429474..429476,aa:Thr,seq:tgt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            429658..430449
FT                   /gene="panB"
FT                   /locus_tag="NGO_0436"
FT   CDS_pept        429658..430449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="NGO_0436"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="catalyzes the formation of tetrahydrofolate and
FT                   2-dehydropantoate from 5,10-methylenetetrahydrofolate and
FT                   3-methyl-2-oxobutanoate"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89178"
FT                   /db_xref="GOA:Q5F9F9"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9F9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9JZW6.1"
FT                   /protein_id="AAW89178.1"
FT                   /translation="MITVNTLQKMKAAGEKIVMLTAYESSFAALMDDAGVDVLLVGDSL
FT                   GMAVQGRQSTLPVSLRDMCYHTECVARGAKNAMIVSDLPFGAYQQSKEQAFAAAAELMA
FT                   AGAHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLTPQSVFAFGGYKVQGRGGKAQALLN
FT                   DAKAHDEAGAAVVLMECVPAELAKKVTETVSCPTIGIGAGADCDGQVLVMHDMLGIFPG
FT                   KTAKFVKNFMRGQSSIQAAVRAYVAEVKAKTFPAAEHIFAD"
FT   gene            430572..431408
FT                   /locus_tag="NGO_0437"
FT   CDS_pept        430572..431408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0437"
FT                   /product="pantothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89179"
FT                   /db_xref="GOA:Q5F9F8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9F8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003694953.1"
FT                   /protein_id="AAW89179.1"
FT                   /translation="MQIIHTIRELRTWRENIGKVAFVPTMGNLHEGHLALVREARKRAD
FT                   NVVVSIFVNRLQFGQGEDFDKYPRTLQQDADKLAAEGVAVVFAPDEKELYPNVEQRYNV
FT                   EPPHLQNELCGKFRPGHFRGVATVVSKLFNIVLPDVACFGKKDYQQLAVIKGLTEDLNF
FT                   DIEIVPVDTGRAADGLALSSRNRYLSVGERAEAPRLYRELQAVAESLKQAGLDYAGLER
FT                   QAADHLTAAGWLVDYVEIRRADTLEMARAGDKKLVVLAAARLGTTRLIDNVEVGLP"
FT   gene            431729..433572
FT                   /pseudo
FT                   /locus_tag="NGO_02330"
FT                   /note="hypothetical protein; disrupted"
FT   gene            433712..434293
FT                   /locus_tag="NGO_0439"
FT   CDS_pept        433712..434293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0439"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89180"
FT                   /db_xref="GOA:Q5F9F7"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9F7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002220661.1"
FT                   /protein_id="AAW89180.1"
FT                   /translation="MKHTVSASVILLLTACAQLPQNNENLWQPSEHISSFAAEGRLAVK
FT                   AEGKGSYANFDWTYQPPVETININTPLGSTLGQLCQDRDGALAVDGKGNVYQAEGTEDL
FT                   SRQLVGFKLPIQYLHIWAEGRRVAGAPYRIRSDGILEQYGWTIGRTADSGGQVRTLQLN
FT                   NGNLNIRLVFTEIGMPSETETPERCAARTR"
FT   gene            434303..435148
FT                   /gene="ipk"
FT                   /locus_tag="NGO_0440"
FT   CDS_pept        434303..435148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipk"
FT                   /locus_tag="NGO_0440"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="An essential enzyme in the nonmevalonate pathway of
FT                   isopentenyl diphosphate and dimethylallyl diphosphate
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89181"
FT                   /db_xref="GOA:Q5F9F6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9F6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002235677.1"
FT                   /protein_id="AAW89181.1"
FT                   /translation="MNIADGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDT
FT                   VYLKPRDDGKIILHNPVGGIPQEADLSYRAASLLQKYARNLAGVEIWLDKKIPTGAGLG
FT                   GGSSDAATVLLVLNRWWQCGLTQWQLIDLGAALGADVPFFIFGKNAFASGIGKKLIGMD
FT                   IPKQWYVIVKPPVHVSTAKIFTYEGLTRDSASSIMPTFQNLQPFRNDMQAVVFKEYPEV
FT                   WKAYSELSKYGSAMMTGSGACIFAAFQARNSAYNIYRQVSGLYEAYLAEGLSKHPLLSV
FT                   "
FT   gene            435156..435231
FT                   /locus_tag="NGO_18831"
FT   tRNA            435156..435231
FT                   /locus_tag="NGO_18831"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:435189..435191,aa:Gln,seq:ttg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            435244..435319
FT                   /locus_tag="NGO_18836"
FT   tRNA            435244..435319
FT                   /locus_tag="NGO_18836"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:435277..435279,aa:Gln,seq:ttg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            435487..436470
FT                   /locus_tag="NGO_0441"
FT   CDS_pept        435487..436470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0441"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="catalyzes the formation of 5-phospho-alpha-D-ribose
FT                   1-phosphate from D-ribose 5-phosphate and ATP"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89182"
FT                   /db_xref="GOA:Q5F9F5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9F5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P65235.1"
FT                   /protein_id="AAW89182.1"
FT                   /translation="MAAYDSLMVFTGNANPELAQRVVRHLDISLGNASVSKFSDGEVAV
FT                   ELLENVRGRDVFILQPTCAPTNDNLMEILTMADALKRASAGRITTAIPYFGYARQDRRP
FT                   RSVRVPISAKLVANMLYSAGIDRVLTVDLHADQIQGFFDIPVDNIYATPILLNDIKQQR
FT                   IENLTVVSPDIGGVVRARAVAKSLNADLAIIDKRRPKANVAEVMNIIGDIQGKTCLIVD
FT                   DMIDTANTLCKAAVALKERGAERVLAYASHAVFSGEAVSRIASSEIDQVVVTDTIPLSE
FT                   AAKNCDRIRQVTIAGLLAETVRRISNEESVSYLFNEEVMTGSMLLP"
FT   gene            436537..437109
FT                   /locus_tag="NGO_0442"
FT   CDS_pept        436537..437109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0442"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89183"
FT                   /db_xref="GOA:Q5F9F4"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9F4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003755233.1"
FT                   /protein_id="AAW89183.1"
FT                   /translation="MTYEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVDH
FT                   KTVFYALEKESFHTALIKLSLNGETKDVIVRDFQMHPFRREVQHIDFQAVKADQLVRIR
FT                   VPLHIVNAENSQAVKLQGGRVSLLNTAVEVLALPANIPAFLDLDCAEVVAGDILHLSDI
FT                   KLPEGVESVSLKRNENLAVATVTGKKR"
FT   gene            complement(437235..438404)
FT                   /locus_tag="NGO_0443"
FT   CDS_pept        complement(437235..438404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0443"
FT                   /product="cytochrome C550"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89184"
FT                   /db_xref="GOA:Q5F9F3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9F3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003750172.1"
FT                   /protein_id="AAW89184.1"
FT                   /translation="MTAHKILPVLLPIILGVSHATAASPAPNRPTVHAAPTLQTPETLT
FT                   AAHIVIDLQSRQTLSAKNTNTPVEPAALTQLMTAYLVFKNMKSGNIQSEENLKIPESAW
FT                   ASEGSRMFVRPGDTVSTDKLLKGMIALCANDAALTLADRLGNGSIENFVQQMNKEARRL
FT                   GMKNTVFKNPTGLGREGQVSTAKDLSLLSEALMRDFPEYYPLFSIKSFKFENIEQNNRN
FT                   ILLYRDNNVNGLKAGHTESGGYNLAVSYSGNGRHILVITLGSESAETRASDNSKLLNRA
FT                   LQAFDTPKIYPKGKTVAQIQISGGSKKTVRAGFLKEAYITLPHKEAKMAEQILETIQPI
FT                   PAPVKKGQILGKIKIRQNGHTIAEKEIVALENVEKRSRWQRLWTRLTGQ"
FT   gene            438553..440079
FT                   /locus_tag="NGO_0444"
FT   CDS_pept        438553..440079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0444"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="threonine deaminase; threonine dehydratase; in
FT                   Escherichia coli, IlvA is part of the isoleucine
FT                   biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89185"
FT                   /db_xref="GOA:Q5F9F2"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9F2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002252306.1"
FT                   /protein_id="AAW89185.1"
FT                   /translation="MNTPLPYSDYLIRILTASVYDVAVETPLEPARSLSVRLKNNILLK
FT                   REDLQPVFSFKIRGAYNKMSKLPKDALACGVIAASAGNHAQGVALSAQRLGCRAVIVMP
FT                   ETTPKIKVDAVKSRGGEVVLRGVSYNDAYDYAMELAEQEGLTYIAPFDDPDVIAGQGTV
FT                   GMEIVSQHPDPIRAVFVPIGGGGLAAGVAAFIKQVRPEIKVIGVQTNDSCCMKQSVEAG
FT                   EIVHLKDVGLFSDGTAVKVVGNGTFRLCKELLDEIITVDTDAVCGAVKDIFDDTRSITE
FT                   PAGALALAGLKAYIAREGAENQTLIAVTSGANMNFHRLRHVSERSELGEGNEGIFAVTI
FT                   PEERGSFLKFVNILGNRNITEFNYRYGGDEKAHIFVGLQAAGPQDLAVIGSRLDEAGLP
FT                   NVDLTNNEIAKIHIRYMVGGRTDKVGHERLVSFEFPERPGALARFLNHMQGGWNITLFH
FT                   YRNHGADYGRILVGIDVPPHDAAAFDGFLESLGYSYHEETQNAAYKLFLA"
FT   gene            complement(440135..441211)
FT                   /locus_tag="NGO_0445"
FT   CDS_pept        complement(440135..441211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0445"
FT                   /product="sulfate ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89186"
FT                   /db_xref="GOA:Q5F9F1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9F1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692814.1"
FT                   /protein_id="AAW89186.1"
FT                   /translation="MSITIQNLNKKRFGNFHALKNINLNVPAGKLVSLLGPSGGGKTTL
FT                   LRIIAGLENADGGQILFDGQDVTAKHVRERKVGFVFQHYALFRHMNVFDNVAFGLTVLP
FT                   KPERPSKGQIRAKVEELLKLVQLSHLAKSYPHQLSGGQRQRIALARALAVEPKLLLLDE
FT                   PFGALDAKVRKELRTWLRDIHHNLGVTSILVTHDQEEALEVSDEIVVMNHGKIEQTGSA
FT                   EAIYRKPENAFVTEFLGEADAFEGRIEKGIWHYNGFAWKLDAQYKWQEQTATGYIRPHE
FT                   WQIAAEHETPMIRAEIEKIHAVGALTHVLVKHGKQDVHITLAGSDAARYPIAEGKKLNL
FT                   IPKQVYVFSQNELIEYSI"
FT   gene            complement(441352..442173)
FT                   /locus_tag="NGO_0446"
FT   CDS_pept        complement(441352..442173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0446"
FT                   /product="sulfate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89187"
FT                   /db_xref="GOA:Q5F9F0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9F0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002227436.1"
FT                   /protein_id="AAW89187.1"
FT                   /translation="MKPYSANPNLTEPRRLRMLLIAAALGFLLLMLVVPLVAVFYEALK
FT                   GGWDLYLKSLSDPEAWSAVKLTLITALIVVPVNAVLGVAMAWLLTRFDFLGKQLLTTLL
FT                   DLPFSVSPVVAGLMFVLLFGAHTALGSRLEAQGIQIIFAIPGIVLTALFVTFPFAAREI
FT                   IPLMQTQGDSEEQAALVLGASGWQMFWRVTLPNIKWTLLYGIILTNARAMGEFGAVSVV
FT                   SGHIRGETNTIPLLVEIFYNEYNFTGAFSLSGVLALLALATLAVQNIITKL"
FT   gene            complement(442362..443191)
FT                   /pseudo
FT                   /locus_tag="NGO_02385"
FT                   /note="sulfate/thiosulfate transporter subunit; disrupted"
FT   gene            443377..443709
FT                   /locus_tag="NGO_0448"
FT   CDS_pept        443377..443709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0448"
FT                   /product="general secretion pathway protein GspG"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002250674.1"
FT                   /protein_id="AAW89188.1"
FT                   /translation="MQILSFQADIAERMLEGTEGESVNENAQFVRTDNGYWIAWHEGVA
FT                   ALLAPDTPPGIPCFWVEGAESLEELCAMVERGEFDEVEEFDGDDDAWLEAAKDCGHHGD
FT                   ACACGH"
FT   gene            444039..444548
FT                   /locus_tag="NGO_0449"
FT   CDS_pept        444039..444548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0449"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89189"
FT                   /db_xref="GOA:Q5F9E8"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503475.1"
FT                   /protein_id="AAW89189.1"
FT                   /translation="MTMILSILSLFFIIRLLFLAVSIKHEKALIAKGAKQYGKTNSTVL
FT                   AAVHTLYYLACFVWVWLSDTAFNGISLIGTLTVMASFVILSLIIKQLGEIWTVKIYILP
FT                   NHQINRSWLFKTFRHPNYFLNIIPELIGIALLCQAWYVLLIGLPIYLLVLFKRIRQEEQ
FT                   AMATLF"
FT   gene            complement(444778..445360)
FT                   /pseudo
FT                   /locus_tag="NGO_02400"
FT                   /note="superoxide dismutase; disrupted"
FT   gene            445524..446930
FT                   /locus_tag="NGO_0451"
FT   CDS_pept        445524..446930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0451"
FT                   /product="DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89190"
FT                   /db_xref="GOA:Q5F9E7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357460.1"
FT                   /protein_id="AAW89190.1"
FT                   /translation="MNDYAAMPPEGREVGALSLPPHSMEAEQSVLGGLMLENPAWDRIA
FT                   DVVSGEDFYRHEHRLIFRSIAKLINEGRPADVITVQEDLQRNEELEAAGGFEYLITLAQ
FT                   NTPSAANIRRYAEIVRERSIMRQLAEVGTEIARSAYNPQGRDAGRLLDEAENKVFQIAE
FT                   STAKSKQGFLEMPDLLKEVVQRIDMLYSRDNPDEVTGVPTGFIDLDKKTSGLQPGDLII
FT                   VAGRPSMGKTAFSINIAEYVAIEKHLPVAVFSMEMGGAQLVMRMLGSVGRLDQSVLKTG
FT                   RLEDEHWGRLNEAVVKLSDAPVYIDETPGLTALELRARARRLARQFNNKLGLIVIDYLQ
FT                   LMAASGRSDNRASELGEISRSLKALAKELQVPIIALSQLSRTVEQRTDKRPMMSDLRES
FT                   GAIEQDADLIMFMYRDEYYNQDSPMKGLAECIIGKHRNGPVGKIFLTWTGQFTKFDNAA
FT                   YIPEEAKIED"
FT   gene            447238..447903
FT                   /locus_tag="NGO_0452"
FT   CDS_pept        447238..447903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0452"
FT                   /product="ferrous iron transporter B"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89191"
FT                   /db_xref="GOA:Q5F9E6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003699624.1"
FT                   /protein_id="AAW89191.1"
FT                   /translation="MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHA
FT                   EQVANLLRFSRGEAVRLNLPVYICPVQVKKDGASNNRCDFSKKGWGMLAFGDKNGNKEY
FT                   DGDVADVFLRSVVLNDDINDKRIDYAFNHIAFGSSQPTADRVVWTFNQNGTFGYTTDQH
FT                   LTERSSFFYSDGYIQIVLTDARAVSDADRKFRSAVVLIDSSGRVEVCRKNDTRAVCKH"
FT   gene            447935..448546
FT                   /locus_tag="NGO_0453"
FT   CDS_pept        447935..448546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0453"
FT                   /product="pilus assembly protein PilV"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89192"
FT                   /db_xref="GOA:Q5F9E5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010980865.1"
FT                   /protein_id="AAW89192.1"
FT                   /translation="MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVAS
FT                   VREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKNYSLYMGKQTLSAVDGEFMLDAEKS
FT                   KAQLAEEQLKRFSHELKNALPDAVAIHYAVCKDSSGDAPTLSDSGAFSSNCDNKANGDT
FT                   LIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGRE"
FT   gene            448543..449523
FT                   /locus_tag="NGO_0454"
FT   CDS_pept        448543..449523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0454"
FT                   /product="pilus assembly protein PilW"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89193"
FT                   /db_xref="GOA:Q5F9E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951046.1"
FT                   /protein_id="AAW89193.1"
FT                   /translation="MKRKMLNVPKGGYDGMKGFTIVEFLVAGLLSIIVLIAVVSSYFTS
FT                   RKLNDVANERLAIQQDLRNAATLIVRDARMAGSFGCFNMSEHTKDDIVDSSNQTQSNLA
FT                   KPGAKQENPLFSLKRSGMDKQLIPVAESIDIKYPGFIQRLNALVFQYGIDDLDASAETV
FT                   VVSSCSKIAKPGKKISTLQEAKSALQITNDDKQNGNITRQKHVVNAYAVGRFGNNEESL
FT                   FRFQLDDKGKWGNPQLLVKKVKRMDVRYIYVSGCPEDEDAGKEEKFRYTNKFDKSKNAV
FT                   TPAGVEVLLDSGLNAKIAASSDNSIYAYRINATIRGGNVCANRTL"
FT   gene            449502..450113
FT                   /locus_tag="NGO_0455"
FT   CDS_pept        449502..450113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0455"
FT                   /product="pilus assembly protein PilX"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89194"
FT                   /db_xref="GOA:Q5F9E3"
FT                   /db_xref="InterPro:IPR025205"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359922.1"
FT                   /protein_id="AAW89194.1"
FT                   /translation="MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTE
FT                   QRISANESDRKLALSLAEAALREGEFQVLDLEYAADSKVTFSENCEKGLCTAVNVRTNN
FT                   NGSEEAFGNIVVQGKPAVEAVKRSCPAKSGKNSTDLCIDNKGMEYNKGAAGVSKMPRYI
FT                   IEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ"
FT   gene            450100..450588
FT                   /locus_tag="NGO_0456"
FT   CDS_pept        450100..450588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0456"
FT                   /product="type IV pilin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89195"
FT                   /db_xref="GOA:Q5F9E2"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR025922"
FT                   /db_xref="InterPro:IPR038415"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010359924.1"
FT                   /protein_id="AAW89195.1"
FT                   /translation="MMSNKMEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQ
FT                   LYTEMVGINNVLKQFILKNPQDDNDTLKSKLKIFVSGYKMNPKIAKKYSVSVRFVDAEK
FT                   PRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQAYSDTLSADSGCEAFSNRKK"
FT   gene            complement(450658..450966)
FT                   /locus_tag="NGO_0457"
FT   CDS_pept        complement(450658..450966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0457"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89196"
FT                   /db_xref="GOA:Q5F9E1"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9E1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706588.1"
FT                   /protein_id="AAW89196.1"
FT                   /translation="MKDLLSSPSFLLFSCMLAVTCPTRLIGFFALRNRTLSRRAQTVME
FT                   AAPGCVLISVIAPYFVSDKPHELIAIALTAFAACRFSMLFTVLIGVGSSGISGWLMA"
FT   gene            complement(450963..451674)
FT                   /pseudo
FT                   /locus_tag="NGO_02440"
FT                   /note="branched-chain amino acid ABC transporter permease;
FT                   disrupted"
FT   gene            451840..452292
FT                   /locus_tag="NGO_0459"
FT   CDS_pept        451840..452292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0459"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="catalyzes the formation of dUMP from dUTP"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89197"
FT                   /db_xref="GOA:Q5F9E0"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9E0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9JZU7.1"
FT                   /protein_id="AAW89197.1"
FT                   /translation="MNIEVEMKVLDERMADFIPAYATEGSAGLDLRACLDEEVVLQPGE
FT                   TFLVPTGLAIYLANPAYAAVLLPRSGLGHKHGIVLGNLVGLIDSDYQGELKVSLWNRGS
FT                   EPFAVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEGGFGSTGSH"
FT   gene            452364..453551
FT                   /locus_tag="NGO_0460"
FT   CDS_pept        452364..453551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0460"
FT                   /product="succinyldiaminopimelate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89198"
FT                   /db_xref="GOA:Q5F9D9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9D9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687924.1"
FT                   /protein_id="AAW89198.1"
FT                   /translation="MNTLLKQLKPYPFARLREAMQGISAPEGMEAVPLHIGEPKHPTPK
FT                   VITDALTASLRELEKYPLTAGLPELRQACANWLKRRYDGLTVNPDNEILPVLGSREALF
FT                   SFVQTVLNPVSDGLKPVIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEE
FT                   VWERTKLVFVCSPNNPSGSVPDLDGWREVFDLQDKYGFIIASDECYSEIYFDGNKPLGC
FT                   LQAAAQSGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPV
FT                   QRASIAAWNDEQHVIDNRRMYQEKFERVIPILQQVFDVKLPDASFYIWLKVPNGDDLAF
FT                   ARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADVATCVKAAETIVSLYR"
FT   gene            453863..454642
FT                   /locus_tag="NGO_0461"
FT   CDS_pept        453863..454642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89199"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F9D8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019272575.1"
FT                   /protein_id="AAW89199.1"
FT                   /translation="MFFVLSPAKNLNEKDPCPVSEFTQPDLLAESEILMRQLRELAPQQ
FT                   IAELMHVSDKIALLNAERNAAWHTPFTPENAKQAVFMFNGDVYEGMDANTLNTNQIQYL
FT                   QGHVRLLSGLYGLLRPLDLIQPYRLEMGTSFANLRGKNLYEFWGGIITNLLNDTLAQAG
FT                   SNTLVNLASQEYFKSVNTKKLRARLITPIFKDEKNGKYKIISFYAKRARGLMVRYAAEH
FT                   NITDPEMLKNFNYEGYAFNDAASNESEWVFMRSEQIK"
FT   gene            454725..454815
FT                   /locus_tag="NGO_18841"
FT   tRNA            454725..454815
FT                   /locus_tag="NGO_18841"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:454759..454761,aa:Ser,seq:tga)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            454893..454982
FT                   /locus_tag="NGO_18846"
FT   tRNA            454893..454982
FT                   /locus_tag="NGO_18846"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:454927..454929,aa:Ser,seq:cga)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            455173..456369
FT                   /locus_tag="NGO_0462"
FT   CDS_pept        455173..456369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0462"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89200"
FT                   /db_xref="GOA:Q5F9D7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9D7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147117.1"
FT                   /protein_id="AAW89200.1"
FT                   /translation="MAKIITPLSANQVKNAKPGDKLYKLSDGGGLALWVYPTGRRSWKL
FT                   SFMQDGRQQTISLGRYPDFSLAEAREWREEVRRKRAHGENVVNKKVRADFAFEKVARDW
FT                   FVRWSKGRSEKYAGQVMRNFERWVFPAIGNLDIRQVRTADVVGCLRVMEARGIVDTLRK
FT                   TKNSLKMVFAFAVGSGMMEINPVAQIGSGVFERVKTKNMTALSPSELPRLIDFLEQRNE
FT                   FAVYAGRVHIHPVTRFCIYWLLLTMTRIREAALMEWSELDGEVWRIPAERKKERRGHDV
FT                   PLSRAMRWVLDQARGLNVNGRFVFESVNFQGHINKESPHVAMRRSGLDTTAHGLRSLAR
FT                   TYLREVLKVYNDVAEKLLAHSLGTRTQTAYNRSELWEERKDAPERWGNDVLRLADNGK"
FT   gene            complement(456456..456663)
FT                   /pseudo
FT                   /locus_tag="NGO_02475"
FT                   /note="lactate dehydrogenase; disrupted"
FT   gene            complement(456725..456994)
FT                   /locus_tag="NGO_0463"
FT   CDS_pept        complement(456725..456994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89201"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9D6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687928.1"
FT                   /protein_id="AAW89201.1"
FT                   /translation="MESSDVQGRMETLAFATAPKKGGIRKSGFGRVILIKSGHIVIHNA
FT                   DGDSFATGYGVIAADIVSPDLKTDFDIFFPPESLLRYKKIGKKK"
FT   gene            complement(457189..457872)
FT                   /locus_tag="NGO_0464"
FT   CDS_pept        complement(457189..457872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89202"
FT                   /db_xref="InterPro:IPR016868"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9D5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706579.1"
FT                   /protein_id="AAW89202.1"
FT                   /translation="MDKEKVLDKIKKCLALGRSVNEHEAAQALRQAQALMEKYKVNAED
FT                   IALSKVSEQKADRKMAFKLAGWQWGVANMIADIFGCKSYQRGKTMMFYGIGNRAETSAY
FT                   AFDVVYRQISADRRKFLKTCRAGKPSHRTYLADRFCGGWIASAWETVKKFEMSDEEKAI
FT                   MDGYKKKEYPDMAEARTRDAKSSILQGSKMEYEALTRGMESGKQVKLHYAVNGTGFVKQ
FT                   IGGQT"
FT   gene            complement(457883..458419)
FT                   /locus_tag="NGO_0465"
FT   CDS_pept        complement(457883..458419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89203"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9D4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951051.1"
FT                   /protein_id="AAW89203.1"
FT                   /translation="MQTVATKPTAKQMLAAKRAAKESTRQERAVKRAGTVRNVDRNRLS
FT                   ARSKAQKENIARMLSGAKVSEDEALTCGIMMRLVAAKVRRYCGEHPGVFDGAAGSRQLE
FT                   RYIKPSEFHAVEIQPEACKALLQNYPAAAGNLGRRKQKKPRVRKRISPSRMARPNRKQS
FT                   ERRMGKGAKLKYRTN"
FT   gene            complement(458530..458745)
FT                   /locus_tag="NGO_0466"
FT   CDS_pept        complement(458530..458745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89204"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7P1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691538.1"
FT                   /protein_id="AAW89204.1"
FT                   /translation="MSYLEDVKNALRVIDNLCKEALKEPESLEGYIDEIRDKADEADTS
FT                   LEFLKDVINYGISDLKNVIEVFEDCV"
FT   gene            complement(458797..459288)
FT                   /locus_tag="NGO_0467"
FT   CDS_pept        complement(458797..459288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89205"
FT                   /db_xref="InterPro:IPR008840"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9D2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147284.1"
FT                   /protein_id="AAW89205.1"
FT                   /translation="MTALALYRCAADVQAALDYYFDSETEREDTLEAVIGQFEVKAQSV
FT                   IAYIKNQEITEKMLEGHIRRMTGKLKAVKAQNQSLKDYLARNMQAAGITEIKADDGTFK
FT                   ASFRKSEAVVILDEAQIPAEFMREAVKTEPDKTAIRKAIESGRQVAGAKIEGRKNLQIR
FT                   "
FT   gene            complement(459285..459467)
FT                   /locus_tag="NGO_0468"
FT   CDS_pept        complement(459285..459467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89206"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7P3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691535.1"
FT                   /protein_id="AAW89206.1"
FT                   /translation="MANIDLTQWDGKTIGAAANPEQGYINITIGSDDLFINIEQAYAIH
FT                   AALGEAVAEYEGGAQ"
FT   gene            complement(459607..460293)
FT                   /locus_tag="NGO_0469"
FT   CDS_pept        complement(459607..460293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7P4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357532.1"
FT                   /protein_id="AAW89207.1"
FT                   /translation="MSLILSVKDESNFKPCPAGSHHATCIRIIDLGTQLVEYQNEQKRQ
FT                   HKILVQWEIDPEGDPEMLMPDGRPYLISRRYTASLHSKSQLATDLKSWRGRDFTPEERD
FT                   NFDLRNILGKPCLLSIAHQESSDGKTTYANISAISNKMKSYTPKHPDNAVFAFDLSDPD
FT                   WANYGLLNEKLREQIAKSPEYAEAVNGRQPPAPPQKQAQAAEGRPEHPQGNAAPAEDIE
FT                   DDIPFN"
FT   gene            complement(460362..460523)
FT                   /locus_tag="NGO_0470"
FT   CDS_pept        complement(460362..460523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89208"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7P5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702497.1"
FT                   /protein_id="AAW89208.1"
FT                   /translation="MSFHPETAYNGGGETEPYGPSPEEIKYRQSPETAETRRMTEKQAE
FT                   GHIKSIIR"
FT   gene            complement(460520..460796)
FT                   /pseudo
FT                   /locus_tag="NGO_02520"
FT                   /note="phage associated protein; disrupted"
FT   gene            complement(460949..461281)
FT                   /locus_tag="NGO_0472"
FT   CDS_pept        complement(460949..461281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0472"
FT                   /product="phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89210"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9C7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702498.1"
FT                   /protein_id="AAW89210.2"
FT                   /translation="MKYYGTAAYGSPDWGMERYYAREDMRQALDGWEAENRILHESALI
FT                   GIAKKSAREFVRDADGEPYSQEDWETYLTEDASRVGKDTEAAMNYAIDEREWFALAENI
FT                   GRLANS"
FT   gene            complement(461422..461697)
FT                   /locus_tag="NGO_0473"
FT   CDS_pept        complement(461422..461697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89211"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7P8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003694994.1"
FT                   /protein_id="AAW89211.1"
FT                   /translation="MSYLDQPLKHGYGNGNGSGNGSGYGNGYGNGYGNGYGGVGGGGSG
FT                   SGYGNGNGYSNGSGNGDGDGNGNGSGNGSGYGNGYGNGYSNGSGNG"
FT   gene            complement(461694..462170)
FT                   /locus_tag="NGO_0474"
FT   CDS_pept        complement(461694..462170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89212"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7P9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002255718.1"
FT                   /protein_id="AAW89212.1"
FT                   /translation="MEANKFEVKSLSDLIKVFAGIAADFEAAMGVKRADISTEFDEPQH
FT                   EPQPPVTVAEQKGINDFAIGKEVIIRTYSAGVWFGVLKQKAGNEVILTKARRMYSWWAK
FT                   ESISLSGVARHGIRQDGSQICGELDSVWLEAIEIIPVTGGAAESIRTALEVAQS"
FT   gene            complement(462203..462403)
FT                   /locus_tag="NGO_0475"
FT   CDS_pept        complement(462203..462403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89213"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9C4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706008.1"
FT                   /protein_id="AAW89213.1"
FT                   /translation="MNELISRINRFGARAKDEQSLLLKVGEICRDAAATWTTRKSESLN
FT                   HTAFTFTVKKDGLKEKVMIVL"
FT   gene            complement(462601..463014)
FT                   /locus_tag="NGO_0476"
FT   CDS_pept        complement(462601..463014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89214"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9C3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687963.1"
FT                   /protein_id="AAW89214.1"
FT                   /translation="MIHLNVHYCDEIIRHAENDKYSLIGIFPDICHIPTPQAILGRLCL
FT                   SVSFSAEGMDIQTMKTGQIFLEIVRNDDVISALEIPSYDGSDTEENVSFMLHQTISGLP
FT                   VSDNDRIYVRMTTHNHILSESRPLSFSWLPYHS"
FT   gene            complement(463011..463472)
FT                   /locus_tag="NGO_0477"
FT   CDS_pept        complement(463011..463472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89215"
FT                   /db_xref="GOA:Q5F9C2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="PDB:3KXA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9C2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003690917.1"
FT                   /protein_id="AAW89215.2"
FT                   /translation="MGATLTVAVAACTVSTPTSAIPVTHIKCLRINGQIKCVKPISPNT
FT                   TPAAEHIEHVRKNPRRKAAMDRAAARIADKIALKAGGETFVSLRMKKGFTQSELATAAG
FT                   LPQPYLSRIENSKQSLQDKTVQKLANALGVSPLEVRAAFERRYEYMEQA"
FT   gene            complement(463489..463926)
FT                   /locus_tag="NGO_0478"
FT   CDS_pept        complement(463489..463926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89216"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9C1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009174531.1"
FT                   /protein_id="AAW89216.1"
FT                   /translation="MELTVHFNAEQDLDRLFEKDEEAVGYLENVIAMIQADSAIFDGLY
FT                   KNRYFREYGEPIGPIDLEVKPILSLWGKDIKVLRVRFDSEEAAGYRIIYAPCHEKQPNG
FT                   TYIRRIDILAVVNKKTDEFDYQAEHPITKRIIKDYEELYSN"
FT   gene            complement(464039..464755)
FT                   /locus_tag="NGO_0479"
FT   CDS_pept        complement(464039..464755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0479"
FT                   /product="Cro/Cl family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89217"
FT                   /db_xref="GOA:Q5F9C0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9C0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003687969.1"
FT                   /protein_id="AAW89217.1"
FT                   /translation="MPFIIDYQCLCAINSEIKMFSGEQLGQAISEAIKRKNVSQKEVAD
FT                   HFGVKQPSVSGWIKNGRIDKKHLDKLIDYFSDVVTPSHFGIETFRVLKSNEQSSIRFPR
FT                   LNAEATCGAGTINDHYIEVVDYVTVAAAWAREKLGGNLNKIQVITARGDSMEPTIENGD
FT                   VMFVDTAVEAFDGDGLYLLWYIDGLKAKRLQSTVGGGLMIISDNSSYRTETVRGEDLNA
FT                   VRIIGRIRGAWRLSQF"
FT   gene            465140..465295
FT                   /locus_tag="NGO_0480"
FT   CDS_pept        465140..465295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89218"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7Q6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003703527.1"
FT                   /protein_id="AAW89218.1"
FT                   /translation="MKKQDRNRLSKKDRRLIKKAMLKAAAKGCDEVYKIAPGLKDGFEL
FT                   LGKQPD"
FT   gene            complement(465272..465460)
FT                   /locus_tag="NGO_0481"
FT   CDS_pept        complement(465272..465460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7Q7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691445.1"
FT                   /protein_id="AAW89219.1"
FT                   /translation="MPSDLSFILAKELIRSGSIRLSGSTAKGQAGELAVFIRTLRQKPE
FT                   ESEPNTDDEYLIGLLSK"
FT   gene            465633..465860
FT                   /locus_tag="NGO_0483"
FT   CDS_pept        465633..465860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89221"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7Q8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003693879.1"
FT                   /protein_id="AAW89221.1"
FT                   /translation="MNQKQTQCKQIVDYIRNKGCITSLEAYQNLKVTQLAARITDLEGR
FT                   GFVFAKPKYKVGNCKNPVAHYSIAKSGIEP"
FT   gene            465981..467042
FT                   /locus_tag="NGO_0484"
FT   CDS_pept        465981..467042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89222"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9B5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003695493.1"
FT                   /protein_id="AAW89222.2"
FT                   /translation="MKPSESLRAAGRPIAYYPKLAKPLGGVNAAILFGHFFYWNDKTQY
FT                   ESGIYRTAEEIEIETGLSVQEQRTARAKLRERGVLIETEKRIEHRIYYKLNLDAFDDLM
FT                   LQHSGGGESTAPKCNINSPELQNQHSGGGESTAPKCNINSPELQNQHSGSEESTAVIRT
FT                   EDLTEDLAVYTPLPPNAGNGKGGLNADAFVSADAETCGRETGEPTSPKAESDSNGNGGL
FT                   SGKPKNANVPRRRKTHGVPLQEIADLYNEVLGGRLPSVQVLNDTRKRAIANRWCEMLGT
FT                   AAPNGKVRFGDKETGLAWFAGFFRKVAMNPFWMGENQTGFAVGFDWIFKAGNFVKILEW
FT                   HPPKTNQAARGRA"
FT   gene            467039..468400
FT                   /locus_tag="NGO_0485"
FT   CDS_pept        467039..468400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0485"
FT                   /product="DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89223"
FT                   /db_xref="GOA:Q5F9B4"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019889"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9B4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951190.1"
FT                   /protein_id="AAW89223.1"
FT                   /translation="MNRIEETEAVQSLASVGAEQNILGGILIEPTAIARCAILTPEKFY
FT                   QAQHRIIFRALLDMAAANEPIDIITLNDKLEARGEAENAGGLAYLIDLNQNTPSAKNIS
FT                   RYVGIVNDRFVERGLLKASAAIEKIAVSKDGGTVAEKLSKAADELAAAGKDAVKRETKT
FT                   FGQTVEDLIGGLDKRLDGVRFGLPTGLMKLDGMTGGLPDGNLIVIAARPSMGKTVLAEN
FT                   IARFALKQGKAVHFQSYEMSAVELARRGMAAECNIPMQNLKTGNLTQSDYANMPIYVSQ
FT                   AKEWKFDVNCDLLNVDELCFLAKEKKLTTGLDLLVVDHLHIMPRAGRDEVAELGNISRR
FT                   LKNLAAELNIPVVLVAQLNRGNTKQADKRPNMADIRGSGAIEQDANIIIMPHRESYYDG
FT                   NENPSIAELIIAKNRDGETGTVVCGWKGQFMKFEEEPDLAWQAPKHDEYDPYSV"
FT   gene            468417..468701
FT                   /locus_tag="NGO_0486"
FT   CDS_pept        468417..468701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89224"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7R1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951058.1"
FT                   /protein_id="AAW89224.1"
FT                   /translation="MRETCFYCNHADFKTNTGTPVRGFAKCAKARNAEEKATYYPRTNP
FT                   CAAGAFQTASGAAVAKRTAVLGEYPPRNAPNLSGKAGKTLWEYPSLPEI"
FT   gene            468740..469234
FT                   /locus_tag="NGO_0487"
FT   CDS_pept        468740..469234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89225"
FT                   /db_xref="InterPro:IPR021739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F7R2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691434.1"
FT                   /protein_id="AAW89225.1"
FT                   /translation="MTVRNTQTETVRTEAAPQQGGNTNPGYYKNRAFECVGFAQYLNFN
FT                   LGNAFKYIWRHKEKGGREDLEKALRYLERQRAGAPKFKKLKHRRYEKMYAGLKDCGFDG
FT                   GTEAALLAVISAAYYIRDGEDNFAWAAACVEDLLEKMPPEAGRAPHPESPMPPETAGGG
FT                   I"
FT   gene            469411..469560
FT                   /locus_tag="NGO_0488"
FT   CDS_pept        469411..469560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0488"
FT                   /product="phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89226"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9B1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503493.1"
FT                   /protein_id="AAW89226.1"
FT                   /translation="MDTLLSIITALSFAGAATLAVWLLVEAADAVLRRKREGKGEDDFD
FT                   GFGY"
FT   gene            469589..469870
FT                   /locus_tag="NGO_02605"
FT   CDS_pept        469589..469870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02605"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63622"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5E3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702882.1"
FT                   /protein_id="AKO63622.1"
FT                   /translation="MAEEMRTCKACGGTKPLEKGFNAVPRKEGGVYYYKSCKTCRNKAV
FT                   RQKRAEKRAAAGAGAMTAARLHGYIRAAHAACPILGAGLWTQPAGECA"
FT   gene            469861..470241
FT                   /locus_tag="NGO_02610"
FT   CDS_pept        469861..470241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02610"
FT                   /product="crossover junction endodeoxyribonuclease RusA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02610"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63623"
FT                   /db_xref="GOA:A0A0H4IW16"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IW16"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503911.1"
FT                   /protein_id="AKO63623.1"
FT                   /translation="MRVIRLILPYPVSANRYWRIWRNRAVRSAEAAAYKETVRRIAQGA
FT                   GAMPSEGFVAVRLRLIPKANKDGGANKTVIDLDNALKVALDALQGVAYHNDRQVRRIAA
FT                   EYGGEPVAGGGLAVEVGELDEK"
FT   gene            470231..470464
FT                   /locus_tag="NGO_0490"
FT   CDS_pept        470231..470464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89228"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003695488.1"
FT                   /protein_id="AAW89228.1"
FT                   /translation="MKSKTEAEKSHLQKVADIGCIVCRNCGRFGVPAEVRHIRNGAGAG
FT                   CGRIWNHLGVLMYRTAWRIVRKGKFRRPSRKV"
FT   gene            470508..470915
FT                   /locus_tag="NGO_0491"
FT   CDS_pept        470508..470915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0491"
FT                   /product="phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89229"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689098.1"
FT                   /protein_id="AAW89229.1"
FT                   /translation="MNQQEFEFMNDLARAFERRYRDTRSLNRCFSIEGRYMGEEACPHK
FT                   PEIGLRYGEDAMFLTLQAWAKVDAPQQEAVRISFGIGAKSQAAYEERLQAEIRRRGEGP
FT                   LHLQTDLGLAAWYRAIRQAAGNDFDLLFEKV"
FT   gene            471138..471644
FT                   /locus_tag="NGO_0492"
FT   CDS_pept        471138..471644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89230"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706020.1"
FT                   /protein_id="AAW89230.1"
FT                   /translation="MSKAINKLNEKEKEKIRLLFAQREKFYRILENPEQGFTPPTALLK
FT                   SGETCFLIDYVNMGEVVTERVRTYTGTRLKLGSTPVYLGGGKSVANEKQKNVAYGELVL
FT                   TNFRLIFVGNMRSIDLPLDKINSVECFQSSIRISQSGKNKPIFFNTVFNPQLWKEAILV
FT                   LSDKK"
FT   gene            471965..472186
FT                   /locus_tag="NGO_0493"
FT   CDS_pept        471965..472186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89231"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689095.1"
FT                   /protein_id="AAW89231.1"
FT                   /translation="MNNSVQISNISIHQTEIGLFSLNDLHRASGGEDRHARLKAAANAL
FT                   EALSAHADAEHAEKIRPILPEIRNLSAV"
FT   gene            472479..472928
FT                   /locus_tag="NGO_0494"
FT   CDS_pept        472479..472928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89232"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689093.1"
FT                   /protein_id="AAW89232.1"
FT                   /translation="MSGTKRKLGRPTDYTKDMADKICEKIANGRSLRSICAEDGVPPMK
FT                   TIYRWLEANEEFRHQYARAREKQADYFAEEIIEIADSAQAESAAVSKAKLQIDARKWAA
FT                   SKIAPKKYGDKSELDVKSGDGSMRAAVRLDAEEYRKIAEDVLRRV"
FT   gene            472990..474411
FT                   /locus_tag="NGO_0495"
FT   CDS_pept        472990..474411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0495"
FT                   /product="phage terminase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89233"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003697216.1"
FT                   /protein_id="AAW89233.1"
FT                   /translation="MALGQFDDVETSVIRSLSSASLYMFTRRMFYQRRGYVWQRANHHA
FT                   PICNALERVFNGETKRLIINIPPRYSKTEIAVVNFIAWAMGRVPDCEFIHASYSAALAV
FT                   NNSVQIRNLVQHEEYRAIFPDLALAGESGHHWKTTAGGVMYATGAGGTITGFGAGRHRE
FT                   GFGGCIIIDDPHKADEARSEVRRQNVIDWFQNTVESRKNSPDTPIILIMQRLHEKDLAG
FT                   WLLDGGNGEEWEHLCLPAIQEDGTALWPEKHDIETLRRMEQAAPYVFAGQYLQKPAPPD
FT                   GGTFKPDNLQFVKALPAGNIRWVRAWDLASTANGGDYTAGGRLGVTEDGRYIIANVVRG
FT                   RYGADERDRILRNTAQKDGVKTKISIPQDPGQAGKSQTLYLTRQLAGFSVSAGPESGDK
FT                   VTRAGPFAAQVNIGNVMVLDDGTWDTDALIAEMRMFPNGRHDDQIDCLGRAFGELLDTR
FT                   TGMIDFLRSQVEAVK"
FT   gene            474408..476555
FT                   /locus_tag="NGO_0496"
FT   CDS_pept        474408..476555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0496"
FT                   /product="phage head morphogenesis, SPP1 gp7 family domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89234"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002255692.1"
FT                   /protein_id="AAW89234.1"
FT                   /translation="MSKKTPLSQGFIARVAAGVRYAFTGNADGWFDAGEPPAPAAQQAE
FT                   GRRFDYEPFYNVGHSKPREREAVGFAQLRALADNYDVLRLVIEARKDQMECLKWTIQKR
FT                   DVESTEDDESQRKDRKVDEAVAFFRSPDKEHTWADWLRILLEDLFVIDAPCIYPRKTLG
FT                   GGLYALEVMDGATIKRVLDNTGRMPLPPDTAYQQILHGMAAVDYTADELIYRSRNNRSY
FT                   KVYGYSPVEQIIMTVNIALKRQVHALEYYTAGSVPDALVGVPETWSADDIRRFQEYWDL
FT                   LLSGETAQRRKMRFVPGELSRNFRETKQPPLKDVYDEWLARVVCFAFSVEPTPFVAQVN
FT                   RSVAETSREQSLSDGMGSLKNWVKALIDDVLARYMDMAAYEFVWKGEESLNPKEQAEIY
FT                   AIYKNAGILTADEIRAELGKEPLPGQGQPEPDKQDGRKPEEPPNQGAEKLGKSESPMSE
FT                   DESAALIEAYLLTRIDGLAEQIAALIEGAAVDWQAGDLAAELSRAAGVVANGLDFGDWS
FT                   GLSDVVEPIIRRVAEDGAVAALLRVMPEPAAGMVTNIRSRAVKWAHERAAEMVGMKRAG
FT                   GGLVRNPAAEWQITEGTREMIRAQVAEAMRNGDSVQELAGRLKESHAFGNARARTIART
FT                   ETAMADGMGNLIGWEGTGLVAGKQWITAKDDKVSDVCNANGGMGVIGLHEPFSHGALTI
FT                   PGHPNCRCAVVPVLAGDMPES"
FT   gene            476623..477780
FT                   /locus_tag="NGO_0497"
FT   CDS_pept        476623..477780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0497"
FT                   /product="caudovirus prohead protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89235"
FT                   /db_xref="GOA:Q5F9A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951062.1"
FT                   /protein_id="AAW89235.1"
FT                   /translation="MTKLYAQIAKTEAQDDGTVKVWGYASSEAVDSDGEVVAAEAMKAA
FT                   IPDYMKFGAVREMHGSNAAGTAIEINVEDDGRTFFGAHIVDPVAVTKVKTGVYKGFSIG
FT                   GSVTARNDLNKSQITGLKLTEISLVDRPANPDAVFTCFKADKPKDEAGAADKDGKPSDK
FT                   PTEEEDENPKDGDKGPKTEDKGDKDAGKKDEAGKSASVNLSESEIAALKAVLAKADKPK
FT                   GGPAAKSMYQVKSPADVLMSLKWLVEDASYDNIDEAVTAQIKESAAGLAESLKALAASE
FT                   ADKPADGLAAKAGKSGDLAKAESADELAKAQDALKKSNDALAKAQAEIESLKKQAVPPK
FT                   GSTKAISKAEDNGEDPLKGFQPIVKNDGTLDDVATLIKAKQTGRL"
FT   gene            477821..479320
FT                   /locus_tag="NGO_0498"
FT   CDS_pept        477821..479320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016686387.1"
FT                   /protein_id="AAW89236.1"
FT                   /translation="MNVNQLTQETIELMKSAQAGGGPPDKGFTQPASFTAGLQTYDLSA
FT                   PSQKLYPVLTPLRNRIPRVGGGRTIGSNWKAVTNINVGNQRAGIGEGRRGGVINHETVE
FT                   RNAQFRAIGLENQVTFEADYAARGFEDVKALAVAQTLQATMVAEEMILLGGNTSLKAGV
FT                   TPTPTAVVSADAAGKISVSTLSVICVALGLQAYWDVAGANNGATGQSPNIKTAQVPAKI
FT                   TRRNADGTTDTFGGGSARKSAAASVSGIEAGKKVTAVIPAVRGAVAYAWYWGAAGSEKL
FT                   GAVTTAAKVEISADAEGTQTAASLPSEDNSTSILEFDGLLTQIALPDSGAFWSDNKGGG
FT                   LTSDNAGGVYEFEEAFAHFFTRYRLSPDTVYVNARDLAALTKLIIGNSGAPLIKLNVDV
FT                   NNTANIRAGVVVGSYMNKITGDDLNIVVHPNLPAGTYLFYSSRLPAYVQGVGNLLQVRT
FT                   RQEYYQIEWPLRTRMYEYGVYADEVLQGMFMPAFGMITNVG"
FT   gene            479327..479689
FT                   /locus_tag="NGO_0499"
FT   CDS_pept        479327..479689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F9A0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689082.1"
FT                   /protein_id="AAW89237.1"
FT                   /translation="MPSENQTAFSFGDFEMTVKLKAPEGFTDVSFGSQSYAADENGIVE
FT                   VPSEAAEFLYQFGFGNVASEPAEGPEKAKRGRKPKTGQPAGQSEPAEAAEPAEAEAEAA
FT                   EPAEAEAEPAEAEKAE"
FT   gene            479692..480222
FT                   /locus_tag="NGO_0500"
FT   CDS_pept        479692..480222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0500"
FT                   /product="phage gp6-like head-tail connector family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89238"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F999"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689080.1"
FT                   /protein_id="AAW89238.1"
FT                   /translation="MAAPVSLEEFKQRIGVEHDRRDDFFLSVIDGVSAAAEAYIGRSLL
FT                   AADYVGRYDGNGKDRIVLDNYPVLSVSSVKINGADAGGWEFDNWLLMRPEGFARGLKNV
FT                   EVSYRAGYERMPADIREAVMIIAVQRVNEIEGKGVRSKTLAGETVAFSTFGNSGGMPPS
FT                   AFAILNEYKRKGV"
FT   gene            480222..480702
FT                   /pseudo
FT                   /locus_tag="NGO_02670"
FT                   /note="hypothetical protein; disrupted"
FT   gene            480699..481127
FT                   /locus_tag="NGO_0502"
FT   CDS_pept        480699..481127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0502"
FT                   /product="phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89240"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F997"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002238694.1"
FT                   /protein_id="AAW89240.1"
FT                   /translation="MNREAVYSALWAKLDALDGFVTKSRKLVHWNDVKRYDQPALFMAQ
FT                   GDMQALTLTGRETKWILRADVYLYVQTAGQPPAPVMNPLIDAVCNAVNAVHPVTGKTDL
FT                   TADGADIEYCRVEGTVETDEGTLGEQAVCIIPIVICAA"
FT   gene            481153..481926
FT                   /locus_tag="NGO_0503"
FT   CDS_pept        481153..481926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89241"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F996"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692869.1"
FT                   /protein_id="AAW89241.1"
FT                   /translation="MQLTFGSGEVFAQMITDAYGNRVQNATPVRIMGLQEMSVDLSAEL
FT                   KEFYGQNRYPLAVAQGKVKVSGKMKGALINGLTLNTLFFGTEYATGTMKALWAETTGKV
FT                   LDGDNYSYLQAAAPGGGKFAEDAGVMGQDGTAYIKVASSPKQGQYTVSESGVYAFNSSD
FT                   KGKTVYPSFTYTQTMPPAKKIELTNMATGNTPTFKMRYLTQFKGKKALLELESVTSGKL
FT                   GLFSTKNDDFSVPEIDFTASTDEAGFKIGTLWIQE"
FT   gene            481987..482316
FT                   /locus_tag="NGO_0504"
FT   CDS_pept        481987..482316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89242"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F995"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002238691.1"
FT                   /protein_id="AAW89242.1"
FT                   /translation="MTVRIKGVTVELNGADYVIPPIALGALEQLQERIGSFDGNAADAG
FT                   QISTVIDCAHAALKRNYPDLTREEAADLIDIGNMNEVFAAVMDVSGLKRKEQEAAQAGE
FT                   ARAAD"
FT   gene            482328..482594
FT                   /locus_tag="NGO_0505"
FT   CDS_pept        482328..482594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89243"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F994"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002212373.1"
FT                   /protein_id="AAW89243.1"
FT                   /translation="MIAHVCASTGWTWDYVADNLDLPRIKHLNEYWREHPPVHILAASY
FT                   MGVKPSSGSVQSEADEAEAVGMLGGGELSEDEFDALLKAKGII"
FT   gene            482594..483193
FT                   /locus_tag="NGO_0506"
FT   CDS_pept        482594..483193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89244"
FT                   /db_xref="InterPro:IPR011740"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F993"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692874.1"
FT                   /protein_id="AAW89244.1"
FT                   /translation="MGNAVFPEFPGLKWGRKKTAVWSTGTQKSASGREFRTAYYTYPQW
FT                   RFSLSFEVLRTKASVNELEKLAGFFNARKGSFESFLYEDPADNAVTDQPVGNTVQGVAR
FT                   YQLVRSMGGFIEPVSAVKERPAVKVGGTALAYGRDYTVTDKGVLVFNTPQPPGRPITWT
FT                   GGFYFRVRFTSDTVDFENVLGSLWAAKKIEFTSVKL"
FT   gene            483190..484044
FT                   /locus_tag="NGO_0507"
FT   CDS_pept        483190..484044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89245"
FT                   /db_xref="InterPro:IPR011928"
FT                   /db_xref="InterPro:IPR018964"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F992"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357642.1"
FT                   /protein_id="AAW89245.1"
FT                   /translation="MKAATKELIGLLHGGDEFQMADLYTITLSGGRVLRHTGADMPVVW
FT                   DGQAYGAHELVIKRGATRTAVGLEVDSNTLQISAAPDYRLEGLQWAEAALGGVLDGARV
FT                   KIDRVFFDAGLRPVGAVNIFSGRVSDVSGGRSSVKVDVKSDIELLNVSSPRNIYQAGCM
FT                   RTLYDDGCKVNREKFTVNGRVTENSRTGTVLKHNLTQPDGWFSQGVIKFAGGRNAGLSR
FT                   TVKAHGGNTFELALRLPYPPQAGDAFKVYPGCDKRRDTCKDKFDNIVHFRGFPFIPSAD
FT                   TVV"
FT   gene            484046..484477
FT                   /locus_tag="NGO_0508"
FT   CDS_pept        484046..484477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89246"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F991"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002255685.1"
FT                   /protein_id="AAW89246.1"
FT                   /translation="MPSETDLRARIVEEARSWLGTPYHHHAMVKGAGVDCAMLLVAVYG
FT                   AVGLLPEGFDPRPYPQDWHLHRDCERYLGFVTQFCRETESPQAGDIAVWRFGRSFSHGG
FT                   ILAGGGKVIHSYIGRGVVSDDIGQAELIGRGVRFFTFSF"
FT   gene            complement(484505..484786)
FT                   /locus_tag="NGO_0509"
FT   CDS_pept        complement(484505..484786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89247"
FT                   /db_xref="GOA:Q5F990"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F990"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951066.1"
FT                   /protein_id="AAW89247.1"
FT                   /translation="MESRTLILRHLDALCDTPAQAANMRLRAGLMMHIADTVRENGWTQ
FT                   KQAAEHCGLTRPRINDLLNGKIDKFSLDALVNINAGLGQCISLSFAPA"
FT   gene            485026..489171
FT                   /locus_tag="NGO_0510"
FT   CDS_pept        485026..489171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89248"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F989"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147109.1"
FT                   /protein_id="AAW89248.1"
FT                   /translation="MGGKSSTVTSAEERILSLQVQRSSQGLTLPVIYGRTRVAGNLIWY
FT                   GDFVTIEHKAVTRQGGKGGGGVKQVGISYTYEAAVMLALCEGEIQGVGRVWRDKEKFDS
FT                   PAQLRLTLMRGGDEQPLWTHLQQAKHQGQALNYSGTAYLCSPNYELTKSAQIYQHNFEV
FT                   IGKSGYSGNIPDANPREIVLDLLTNQRYGCGFPSQNIGDTDRYSNYCRAVGIFLSPAYT
FT                   EQGEAQRNISELLEQTNSAAVFSQGRLKIIPYGDGSHSGNGAVYVADNKAAYDLTDDDF
FT                   IVSGAQDPVKAGRKTNADAFNQIQVEYLDRDNDYNVAIAEAKDQANIEQYGLRPKDAVR
FT                   MHGICDAKVAQKVAQQLLQRALYVRNEYEFKLGWKYCLLEPMDIVTLTDAGLGLNKTPV
FT                   RITEIEEDGEGVLSVKAEDCPAGVYTVSEYPTQPSSGYSADYNVSPGNAHVPVIFEAPL
FT                   QLTGGEPQIWLATAGGGMWGGAEVWVSADGDSYTRVGAVNRKARFGALTADLPDGAVFD
FT                   RTNTLGVEISAGQLTGGTEQDSRDLLTLCYVDGEFLAYADAELKGVGRYTLGNLTRGAY
FT                   GSAVNAHAAGSRFARIDEALFKYAVPRNWIGRTVWVKLVSYNVFGGGIQDLAEVPAYSY
FT                   TIEGAPLGQIQNLRLTSSWAYGKEAVIAWDKLDGADTYDVEIYAGGSRRRLRAVDGIVD
FT                   NSYTYTQADMKADGGQVRGIVFKVRGRAVTGKTGNWAQIAAQNPQLQALQGISIDSGLR
FT                   QAFFTCQKPDEEDFAGIIVWVCENAACPAADANKAYDGAETFITIAKCGGKPLEKGKTY
FT                   YLRAAGYDSFGKDNLKISGSISFTVYDVSATDLSESSLNKALRDKINLIDGNGAGSVNE
FT                   RVEAVRSTADGNAAAVQTHARSINGLEAQYTVKVDANGKVAGFGLATTPKNGTPESKFI
FT                   VNADRFGIGAAGKADVFPFVVDTQKNRVGINGELVVNGKAVVDKLNAGDIHGGKIAADT
FT                   LDANRLKAGSVTAREIGAAAVTADKIGANAVTADKIQVADLSAVSSNLGSITGGSLNIG
FT                   GGNFTVSSDGILTADNAVIRGRIEADSGYFNGTVRASSVEGDVLRAHRLRWTEGNVWVL
FT                   DLDKDPLPRVLIPNFYVVSETFGNNRVQAKLLLNGGVLAPREVRETENYTNYIWRGRTF
FT                   GRYEDLPPRARGGGDYTEQSGSRYRTRLEYQIQVIPAGKPVSLKLSLASHESVFSPFVS
FT                   VSYLAQSDYEYKQLLGRMVWRTFAESFRYDSKKQIYLGGDRRVHDYQNQMYKHWNAYGG
FT                   LLQLPDDIYGISFEYRPFTNADWSTMLAFDRSDKFVVVKKYRGHAPQQYSLFQEEFNTA
FT                   VPKSNLLFFVEHWWQYIELRNIRVLIPESRENEVWPSV"
FT   gene            489283..489588
FT                   /locus_tag="NGO_0511"
FT   CDS_pept        489283..489588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0511"
FT                   /product="phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F988"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689058.1"
FT                   /protein_id="AAW89249.1"
FT                   /translation="MIEDKKIVALNFAVEDGMTGASAAYHVVEHIGADYRNGYVTATLN
FT                   GYVSENAFKSGKRYLLARTLDFQETDITAPDPGWVYRKALEGAAGIPKDAQPVYAE"
FT   gene            489659..490129
FT                   /locus_tag="NGO_0513"
FT   CDS_pept        489659..490129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0513"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89251"
FT                   /db_xref="GOA:Q5F986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F986"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692881.1"
FT                   /protein_id="AAW89251.1"
FT                   /translation="MLRFLTERRFLPAGFQAWLFGTATRVLEAVIGLGLSGYAAVFALA
FT                   PDEIYAWRIYYKFQDIPEAWTVGVLAAAGLLQTALLFARGVRACVASAYLLLFSGFVWF
FT                   LVSVAFWGAYPPLNTGMVVPPLLAFFCALAGNNALRFLFSAQKSRGLADEGS"
FT   gene            490130..490462
FT                   /locus_tag="NGO_0514"
FT   CDS_pept        490130..490462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89252"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F985"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691408.1"
FT                   /protein_id="AAW89252.1"
FT                   /translation="MGFLQFGLLFAAAGGVLGAVWASLQERGRPVQAVLEAFISAIAAA
FT                   AAAERFVPLDQAWTCAAAGVFAGMMTGHALDTVRALAPKVLRGYLGGLAEKLTGVKDGG
FT                   SSDGKD"
FT   gene            complement(490591..490824)
FT                   /locus_tag="NGO_0515"
FT   CDS_pept        complement(490591..490824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89253"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F984"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692884.1"
FT                   /protein_id="AAW89253.1"
FT                   /translation="MRSLSAGGSIRFHTRPYFKAFKISAGFQINAVKGAAHKTARKNRR
FT                   TDRYFSNKSNILRNSLKILVYSAYSYSFLNKD"
FT   gene            complement(490832..491179)
FT                   /locus_tag="NGO_0516"
FT   CDS_pept        complement(490832..491179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0516"
FT                   /product="growth inhibitor PemK"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89254"
FT                   /db_xref="GOA:Q5F983"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F983"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689051.1"
FT                   /protein_id="AAW89254.1"
FT                   /translation="MYIPERGDIFHLAFDPAAGTEMKGGHYAIALSPRAYNRATGLVYA
FT                   CPISQGRAAAARSGGMISTLLGTGTATQGNVHCHRMKALDWKIRRAAFRETVPDYVIED
FT                   VLARIGAVLFD"
FT   gene            complement(491179..491415)
FT                   /locus_tag="NGO_0517"
FT   CDS_pept        complement(491179..491415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0517"
FT                   /product="multidrug transporter MatE"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89255"
FT                   /db_xref="GOA:Q5F982"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F982"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689049.1"
FT                   /protein_id="AAW89255.1"
FT                   /translation="MLRLQKWGNSAAVRLPARLLTALNAKIGDALETEIRNGELLIRPV
FT                   KRYRLSDLLAETEAAPPRAEGWEEMPDVGQEGV"
FT   gene            491622..492161
FT                   /locus_tag="NGO_0518"
FT   CDS_pept        491622..492161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89256"
FT                   /db_xref="InterPro:IPR013423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F981"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003703868.1"
FT                   /protein_id="AAW89256.1"
FT                   /translation="MKELKWIEEARKYLGAHEKVNGKSNPVLLAMLQEMGNFNQEQKAW
FT                   WKETDTPWCGLFVGYCLGKSGRAVIRDWYRAKAWSMSGLTKLEAPAYGCIAVKPRRGGG
FT                   HVFFVVGKDAEGRILGLGGNQGNMVSIIPFDPADIDGYFWPSKLIGGKAVPSSPAEGRY
FT                   RLSDVAATAKQGAGEA"
FT   gene            492162..492506
FT                   /locus_tag="NGO_0519"
FT   CDS_pept        492162..492506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0519"
FT                   /product="phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F6B0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003695464.1"
FT                   /protein_id="AAW89257.1"
FT                   /translation="MIGALLKNWKPLLILSAIAFFAVSWQLDRAAQYRRGYGAAVSEVS
FT                   ERLKAAAVEHAEHARKSSAAYQAQKAAREEKERVRYVQTLKIIEKPVYRNACFDADGVR
FT                   ELNAAVDDGG"
FT   gene            493004..493153
FT                   /locus_tag="NGO_0521"
FT   CDS_pept        493004..493153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F978"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691402.1"
FT                   /protein_id="AAW89259.1"
FT                   /translation="MNAEGFCEKQTACRPDGRRNAGDRADLKAFEFAEQELANYREMLK
FT                   RYAV"
FT   gene            493183..496230
FT                   /locus_tag="NGO_0522"
FT   CDS_pept        493183..496230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0522"
FT                   /product="tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89260"
FT                   /db_xref="GOA:Q5F977"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F977"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692891.1"
FT                   /protein_id="AAW89260.1"
FT                   /translation="MSDLEAKVRITVENHTKQGFDSAAADADKAAEKMRSSGDNAAKGF
FT                   KAAIDSMHETMRNLHADVKAGFEAAGNQAQQASEKVRAEVGKIGSGLSGLTKLLAGLAT
FT                   ADFAKSVLDTADAMQSINSQVRQVTSSETEYLAVQQQLLDTANRTRASLESTANLYVST
FT                   SRALKDYGYTQQEILKFTEAANNAMTIGGVGAQQQAAALMQLSQALGSGVLQGDEFKSI
FT                   SEAAPILLDTIAEYMGKSRDEIKKLGSEGKLTADVIFKAISGASEKFGEQAAKMPVTMG
FT                   QALTVFSNNWQSMVSKLLNDSGTMSGIAAVIKLIADNLNLVVPIVAGFAVAVAAAVAPT
FT                   LALNLALLANPFGIIAVAIGTVVGLIAKFGDEIDVFGGGWSNLSDVIRAVWQIITETVG
FT                   EAVGTVKSWFDGLTGRLNEGAGGWPSLFGRVMSVISSAIGAYVNVYINIFATGWMLIKE
FT                   AANDMPQFFANLGKAIGNVFISAIERMINKAVGMINSMIDFANKAASMAGISGIGKLNK
FT                   VRMGRMDDGGLGERIHDSLTKDRAGAMANAVRERAADIHEADALKGRGGGGHAKTARKK
FT                   PGANQGGGKGGKSRSGGPGAAKDPMQAWEGEIKARKLAHREMQRETLAHQEWDLAREAE
FT                   YWRAKLATVDANGKTGVKIREKILMLEDQLSKQSTEAKMNQAAEWEKLDKHKLEMEKDA
FT                   ADQALADGRISQLERLDLEIEFENRRYRIAYDALQERIALAEQDPAYSQAAIGKLKAQM
FT                   GELGRGHERTQAKNEGKRENQRRKDAPNVMEMLQDGGRNVWQEAQQQMGQAFTAMLARA
FT                   QNFRQAMNGFFKSMGQTFIQEMVTKPLTGLMRRMVQESAIYKMIFGTKETLETAAAAKT
FT                   AATKATETTAVVSSNAVQAASGAAASQAHIPYVGPILAVAAMAAMMSAVMGLMGGGGGS
FT                   QTTTTTTRIPSAAGGWDIPAGINPLTQLHENEMVLPAEHAQTIREMADQQGGGSTVIIN
FT                   STGGDFIHKNDLAKLLKQMKRDFKFV"
FT   gene            complement(496290..496769)
FT                   /locus_tag="NGO_0523"
FT   CDS_pept        complement(496290..496769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0523"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89261"
FT                   /db_xref="GOA:Q5F976"
FT                   /db_xref="InterPro:IPR031876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F976"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002248020.1"
FT                   /protein_id="AAW89261.1"
FT                   /translation="MTDNLIQIATPILTVIGVFVAAYGIMRNTENAKKRATIDMIMAER
FT                   NNAALQEAITIVNGLAKTDGCILATYTSDTPDKKKDREAILTVLNQREFVCAGVLGGAL
FT                   HEKMYKDFEYSMLLRDWDNLSSFIFEIRRIRSAPTAFQEFEAVARKWKKKPLKTK"
FT   gene            complement(497111..498100)
FT                   /locus_tag="NGO_0524"
FT   CDS_pept        complement(497111..498100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0524"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89262"
FT                   /db_xref="GOA:Q5F975"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F975"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689040.1"
FT                   /protein_id="AAW89262.1"
FT                   /translation="MATITQRNGKWRVQIRMKGVSRSATFERASDAKAWAARIESQIMD
FT                   GIQGNAPRNTIFADLIRRYLSEVTPSKRGAREESYRIGRALKTPLAKVRLADLRPQDFA
FT                   DWRDQRLQEVSPTSVGRELTTLSAVCEHAMKEWGLLRENPVRKISKPKKSRARTRRPTE
FT                   QEIADICAALLYRPNEKPKMAVQRVAVAVLFAIETAMRAGEICGLKWADVNMRRRIAHL
FT                   PITKNGDSRDVPLSLRAAELIEQLRGIDDTWVFSLDAKSLDVLFRRARDNCGIQGLHFH
FT                   DTRREALTRLSKKVPVEVLAKISGHRDLRILLNVYYRPDMADIAKMLD"
FT   gene            complement(498360..498548)
FT                   /locus_tag="NGO_0525"
FT   CDS_pept        complement(498360..498548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89263"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F974"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014575381.1"
FT                   /protein_id="AAW89263.1"
FT                   /translation="MADGRKGFFDAIIKINIFFFPVKTPTLGAANPIAGGSTRFRFGAE
FT                   QMAVLYVPFCVLKHIGR"
FT   gene            498789..499823
FT                   /locus_tag="NGO_0526"
FT   CDS_pept        498789..499823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0526"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /note="catalyzes the formation of
FT                   1-(5-phosphoribosyl)-5-aminoimidazole from
FT                   2-(formamido)-N1-(5-phosphoribosyl)acetamidine and ATP in
FT                   purine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89264"
FT                   /db_xref="GOA:Q5F973"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="PDB:5VK4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F973"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003710017.1"
FT                   /protein_id="AAW89264.1"
FT                   /translation="MSTSLSYRDAGVGIDAGDQLVEKIKPFAKRTMRPEVLGDLGGFGA
FT                   LVEIGKKYQNPVLVSGTDGVGTKLKLAFDWDKHDTVGIDLVAMSVNDILVQGAEPLFFL
FT                   DYFACGKLDVPRATDVIKGIAQGCEESGCALIGGETAEMPGMYPVGEYDLAGFAVGVVE
FT                   KENVITGLSIGAGDVVLGLASNGAHSNGYSLIRKIIERDNPDLDAEFDNGKTLREAVIA
FT                   PTRLYVKPILAALEKFTIKGMAHITGGGITENVPRVLPKNTVAQIDAESWELPKLFQWL
FT                   QKAGNVETQEMYRTFNCGIGMVVIVAAEDADAVRSFLSGQGETVYRLGCIRERQGNEHQ
FT                   TQVA"
FT   gene            500821..501474
FT                   /locus_tag="NGO_0528"
FT   CDS_pept        500821..501474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0528"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89266"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F971"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951225.1"
FT                   /protein_id="AAW89266.1"
FT                   /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFYR
FT                   KIRTVTNHRLALAADEVFECPAGPGASCFGVRRKGRRGRGAAGKAVVFGIPKRNGRAYT
FT                   VAEDDAEPETLPPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRRNHI
FT                   NGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRFNFGTPSRQLKILRDRCGI"
FT   gene            501608..503635
FT                   /locus_tag="NGO_0529"
FT   CDS_pept        501608..503635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0529"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89267"
FT                   /db_xref="GOA:Q5F970"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F970"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003697203.1"
FT                   /protein_id="AAW89267.2"
FT                   /translation="MSLSEFIERRTSFNPMVILTTLFFVCVLVVLVLTVPDQVQMWLDR
FT                   AKEVIFTEFSWFYVLTFSIFLGFLLILSVSGLGNIRLGRDEDVPEFGFLSWLAMLFAAG
FT                   MGVGLMFFGVAEPLMHYFSDITVGAPEHRQQQALLHTVFHWGVHAWSVYGTIALALAYF
FT                   GFRYKLPLALRSCFYPLLKEKISGRFGDAIDIMALLATFFGIITTLGFGASQLGAGLQE
FT                   MGWIAENSFGVQVLIIAAVMSLAVVSAISGVGKGVKVLSELNLGLAFLLLFFVLAADPT
FT                   VYLLSAFGDNIGNYLGNLVRLSLKTYAYEREHKPWFESWTVLYWAWWCSWAPFVGLFIA
FT                   RISKGRTIREFVFGVLLIPGLFGVLWFTVFGNTAIWLNDGVAGGMLEKMTSSPETLLFK
FT                   FFNYLPLPELTSIVSLLVISLFFVTSADSGIYVLNNITSRDKGLSAPRWQAVMWGVLMS
FT                   AVAVLLMRSGGLGNLQSMTLIVSLPFALLMLIMCFSLWKGLSADKKYFETRVNPTSVFW
FT                   TGGKWKERLVRIMSQTQEQDILKFLKHTASPAMHELQRELSEEYGLSVRVDKMFHQDEP
FT                   AIEFVIRKETMRDFMYGIKSVGQDVSDQLINDGKLPHIRHQTTYKPYAYFFDGRVGYDV
FT                   QYMNKDELIADILKNYERYLMLLDDVGQELMAHEQVELAE"
FT   gene            complement(503725..505278)
FT                   /locus_tag="NGO_0530"
FT   CDS_pept        complement(503725..505278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0530"
FT                   /product="long-chain fatty acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89268"
FT                   /db_xref="GOA:Q5F969"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F969"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702845.1"
FT                   /protein_id="AAW89268.1"
FT                   /translation="MNRTYANFYEMLAAACRKNGNGTAVFDGKEKTAYRALKQEAEAVA
FT                   AYLQNIGVKFGDTVALAVSNSTEFITAYFAVSAIGAVAVPMNTFLKNSEYAYILNDCKA
FT                   RFLFASAGLSKELAGLKAQTPVEKIIWTDKSRPAGETAEGDAFFENVRRFPEKPDLGRQ
FT                   PRINDLAHIIYTSGTTGHPKGALISYANLFANLNGIERIFKISKRDRFIVFLPMFHSFT
FT                   LTAMVLLPIYMACSIILVKSVFPFSNVLKQALLKRATVFLGVPAIYTAMSKAKIPWYFR
FT                   WFNRIRLFISGGAPLAEQTILDFKAKFPRAKLLEGYGLSEASPVVAVNTPERQKARSVG
FT                   IPLPGLEAKAVDEELVEVPRGEVGELIVRGGSVMRGYLNMPAATDETIVNGWLKTGDFV
FT                   TIDEDGFIFIVDRKKDLIISKGQNVYPREIEEEIHKLDAVEAAAVIGVKDRYADEEIVA
FT                   FVQLKEGMDLGEDEIRRHLRTVLANFKIPKQIHFKDGLPRNATGKVLKRVLKEQFEGNK
FT                   "
FT   gene            505291..505446
FT                   /locus_tag="NGO_0531"
FT   CDS_pept        505291..505446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89269"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F968"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003689035.1"
FT                   /protein_id="AAW89269.1"
FT                   /translation="MVADGERPHLKTICRLKTEGGSLSSLPSDGISNAAFAPHAGGSPP
FT                   SFLCLT"
FT   gene            complement(505529..506722)
FT                   /locus_tag="NGO_0532"
FT   CDS_pept        complement(505529..506722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0532"
FT                   /product="GDSL-like lipase/acylhydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89270"
FT                   /db_xref="GOA:Q5F967"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F967"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002233944.1"
FT                   /protein_id="AAW89270.1"
FT                   /translation="MNPKHFIAFSALFAATQAEALPVASVSPDTVTVSPSAPYTDTNGL
FT                   LTDYGNAAASPWMKKLRSVAQGSGEAFRILQIGDSHTAGDFFTDALRKRLQKTWGDGGI
FT                   GWVYPANVKGQRMAAVRHSGNWQSFTSRNNTGDFPLGGILAQTGSGGGMTLTASDGKTG
FT                   KQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLAIQTEMPWDIGFINIEN
FT                   PAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTE
FT                   QKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVLLTEVQQMQRRVARQGQTM
FT                   FWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAQGYRRAAEMLADSLEELVRAAAIRQ"
FT   gene            complement(506719..507702)
FT                   /locus_tag="NGO_0533"
FT   CDS_pept        complement(506719..507702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0533"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89271"
FT                   /db_xref="InterPro:IPR007407"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F966"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702842.1"
FT                   /protein_id="AAW89271.1"
FT                   /translation="MKNFLSLFASILMSALIAVWFSQNPINAYWQQTYHRNSPLEPLAA
FT                   YGWWRSGAALQENAYALSDGIKTFLSGETPPTAQDGGSADMPPEAAASEAAPPAGGTEW
FT                   KQGTEAAAVRSGDKVFFAGDSLMQGVAPFVQKSLKQQYGIESANLSKQSTGLSYPSFFD
FT                   WPKTIEETLKKHPEISVLAVFLGPNDPWDFPVGKRYLKFASDEWAQEYLKRVDRILEAA
FT                   HTHRVQVVWLGIPYMKKVKLDGQMRYLDKLLSEHLKGKIILIPTAQTLSGGKGRYTDSV
FT                   NVNGKPVRYRSKDGIHFTAEGQKLLAEKIMEKIVFEPSTQPSSTQP"
FT   gene            complement(507713..509149)
FT                   /locus_tag="NGO_0534"
FT   CDS_pept        complement(507713..509149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0534"
FT                   /product="alginate O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89272"
FT                   /db_xref="GOA:Q5F965"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F965"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014575397.1"
FT                   /protein_id="AAW89272.1"
FT                   /translation="MPLLSVEFALFFIVFLPIYWGFAKYPSVQNLLLLAAGMGWLYHIS
FT                   PVFAAIIVLYSSCVYLLGELLRSDRESTRRFWLGCGIAASITVLGFFKYFDFFRPLIAQ
FT                   YAGKGGAIDILMPLGLSYYTFQSVAYLVYCFRAPHAARFGWHELLLHLSFFPTVTSGPI
FT                   IRAAAFKSTDGEQAGALAQIRTRRPRSPVRPALAVSLILLGIAKKWWLAGILAENWVSP
FT                   VFENPTQFDGWGVLAGVYGYTFQLFLDFSGYSDLVIGMAMLLGFRLPKNFSAPLRAANI
FT                   RAFWDKWHISLSTWIRDYIYIPLGGSKKGFLRTQLNLMAAMVLSGIWHGYGWNFLIWGA
FT                   LHGTALALLNTGDRYFGRDALCRLKYLAPLSWFVTFHFVCLSFVVFNTANPDDAGAVFS
FT                   ALFANAGGWNAPQRADMLLLASFASLMLLYPYLQRAFDGAVKGLEKIPMWLWFIQISII
FT                   LLLIIVLAPSGIPGFIYANF"
FT   gene            complement(509384..510124)
FT                   /locus_tag="NGO_02825"
FT   CDS_pept        complement(509384..510124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02825"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02825"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63624"
FT                   /db_xref="GOA:A0A0H4ISM8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISM8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503728.1"
FT                   /protein_id="AKO63624.1"
FT                   /translation="MGIVLTHAVFWSITASLAVRIAPVGKGNQALGLLSTGTVMAMVAG
FT                   IPLGRMVGQYLGWQASFLLIGLCSAAVMAVLAKSLPRLPSVNTGSLSSLPLLLKRKKLM
FT                   LLYAVTVPVITAHFTAYSYIEPFVIQIGGFSARQVTVVPGLYGLAGFAASYLFGKWFAK
FT                   HPRAFLAGAVSLIALSSGLLLPLAHFPAAIYALVFVWGTAIVVVSLGMVAKVLDFASDA
FT                   ADLANSIYSELYNVGIGGGALLGH"
FT   gene            complement(510109..510444)
FT                   /locus_tag="NGO_02830"
FT   CDS_pept        complement(510109..510444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02830"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02830"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63625"
FT                   /db_xref="GOA:A0A0H4IV10"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IV10"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010360084.1"
FT                   /protein_id="AKO63625.1"
FT                   /translation="MNASHKPWLSIVALAIGAFIFNTAEYIPIALLSDIGRSFGMAATE
FT                   TGVMITVYAWIVALTSLALPLMLLTRNYGTARPAAGPVCAVLLSATSCRLPRGVLKSYS
FT                   QAAWGLC"
FT   gene            510723..511097
FT                   /locus_tag="NGO_0537"
FT   CDS_pept        510723..511097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0537"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: emb|CAB84710.1| (AL162756) putative
FT                   mercuric ion binding protein [Neisseria meningitidis];
FT                   COG2217 Cation transport ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89273"
FT                   /db_xref="GOA:Q5F964"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F964"
FT                   /protein_id="AAW89273.1"
FT                   /translation="MKIVPYVETLPPPDWARLPLCRKHPCRTVSAFAQVHAPTYNNARQ
FT                   IAVPTKGKIVETLLLDIGGMSCGGCVKSVTRILESVKGVASVEVSLENKSATVGYDPAQ
FT                   TAAEALIEAVEDGGYDAALK"
FT   gene            complement(511076..511285)
FT                   /locus_tag="NGO_02840"
FT   CDS_pept        complement(511076..511285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02840"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRP5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147103.1"
FT                   /protein_id="AKO63626.1"
FT                   /translation="MQRAKAAFFFLFGIFCLSEGTIARKFNQFILPVQLNQMPSEGAER
FT                   ASDGIGETQRLQTAFLPLYFNAAS"
FT   gene            511297..512823
FT                   /locus_tag="NGO_02845"
FT   CDS_pept        511297..512823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02845"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02845"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63627"
FT                   /db_xref="GOA:A0A0H4J5E9"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5E9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357698.1"
FT                   /protein_id="AKO63627.1"
FT                   /translation="MPGVSDIKNSYDDLMYESKAFSQTAINALEACARMMGLKPTAAAK
FT                   AKVLELGCSMGRNIITQALYYPDAEFVGIDLSGRQVAQGNAIIEKMGLENVRLEEKDIL
FT                   TVDESFGKFDYIIVHGIWSRVPDAVKDKIFSICRNNLTEYGIAYISYNVYPGWKRQEQL
FT                   RDIMQFAGRDALGEPLEARTRKGLDAIKALAEILENDKGLGGGKLPAIQKILNHNTYYV
FT                   AHEYMEIFNDPIYVNGFIEWANRHRLAYIGDTDLHVSFVSWMAEHTRERILALAGGDYI
FT                   AKEFYSDILSDRQFHRSLLCREEVGDTVRRDESVAVEVIESLNFRPARGETINFDENDT
FT                   LLSGIRDVMKTGEAFKTEDVAENLARRFPGLEFDRMKINSQLLLQTILGRFSVSSDNAG
FT                   KPFFEDHKTYVPARFTNYAAAFVEHGAGAFVRPANRYNESTPSFGYGHLYIMRQLSRPT
FT                   SKQALIETVAENLNIVSATPDGLTFHPPAEVYVEEILADLADRHFLVSAD"
FT   gene            512905..514002
FT                   /locus_tag="NGO_0539"
FT   CDS_pept        512905..514002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0539"
FT                   /product="conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89274"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F963"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002220905.1"
FT                   /protein_id="AAW89274.1"
FT                   /translation="MNQTFTLPDTRPYPQNPIKNHLLLNAYQLAHNSSQASRKLSSGQL
FT                   QTEIRGMLEQNHYINLSLALTMSPDAGTYAALLSSVNAVLDCEKEGEVQWFALPVVLVS
FT                   GCKKERAIEMKLPTEALFACLQNYPHLRALTQETQWLPYLVHSSDLSAVAPDEWWRAKQ
FT                   NTEAAAQHLRRFAPRPLLLPEGQSVHVVYVLGFGSGKVQAALGQNLLQAGLPLMQVWQE
FT                   NLASEGITLFANPLSPDTPARALSDGSHTRQRMAMDVFAANAIRAVRMQGPRVGVVAAA
FT                   KAGGQILFGFNATDGAFEVVPQVFCWQLSFTDNIAVIQQNFLDLMAECRVEHVYLLHNP
FT                   LGEQENIPSYAEALKREGRNPFFSA"
FT   gene            514116..515231
FT                   /pseudo
FT                   /locus_tag="NGO_02855"
FT                   /note="glycerate kinase; disrupted"
FT   gene            515299..515811
FT                   /locus_tag="NGO_0541"
FT   CDS_pept        515299..515811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0541"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89275"
FT                   /db_xref="GOA:Q5F962"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F962"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017146763.1"
FT                   /protein_id="AAW89275.2"
FT                   /translation="MPSERVSASGGIALEQGWDMKKPKILFVCLGNICRSPMAEYILRR
FT                   RAAEAGIPLETDSAGTSGWHDGEDMHRETAKILKKYGIDASGFTSRKIRQSDATAFDYI
FT                   IAMDGKNLSELEKTFGRRPEKIFKLTDLIPESGYDHVPDPWYMGDFEETYRLADAGCRA
FT                   LLEKISK"
FT   gene            515888..516364
FT                   /locus_tag="NGO_0542"
FT   CDS_pept        515888..516364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0542"
FT                   /product="cation uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89276"
FT                   /db_xref="GOA:Q5F961"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F961"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217097.1"
FT                   /protein_id="AAW89276.1"
FT                   /translation="MKTNFKQKIIEQARREDLQVTALREQVLDIVLQQSGVIKAYNVLS
FT                   QMQQQSEGVLAPPTAYRALDFWADQGVLHKVAAVNGYILCSHAQHECNDHCHDHEEAEA
FT                   HHSAFILVCTECGAADEQTLSHEWAALRAGVAESGFALKEEHVVLTGICKKCQK"
FT   gene            516352..517278
FT                   /locus_tag="NGO_0543"
FT   CDS_pept        516352..517278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0543"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89277"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F960"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014582041.1"
FT                   /protein_id="AAW89277.1"
FT                   /translation="MSEVKKTKVHLISGFLGTGKTTALKSLMAQKDPNEKWVIIVNEFG
FT                   EIGIDGAVLSDNGIPVAEIAGGCLCCTAGPQMGVTVQKMLRDAKPDRLMIEASGLAHAA
FT                   SVIDELKAKPLDSLLEIGAVFTVVDPRQFINPDYAQQALYKDQIGICDVLAASKTDLCT
FT                   PEQLAEFHDKAAKLFPPKAKVVEVQNAQLDIQWLDIPVVEKSRYRLKALPDNTMGFQSQ
FT                   GFTFPAGRDFNGEKLTNFFNDLPKMTEGLVRAKGVFQVLGTWVWLNWVDGQWGANQVSW
FT                   RRDSRFELIAKSFDADLIEQKLKDALE"
FT   gene            517343..517900
FT                   /locus_tag="NGO_0544"
FT   CDS_pept        517343..517900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0544"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89278"
FT                   /db_xref="GOA:Q5F959"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F959"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002251360.1"
FT                   /protein_id="AAW89278.1"
FT                   /translation="MKPKFKTVLTALLLAVSLPSMAATRVLMETDMGNIRLVLDESKAS
FT                   KTVANFVRYARKGFYDNTIFHRVIGGFVIQGDGLTEDLVQKATDKAVANESGNGLKNTV
FT                   GTIAMARTAAPDSAAAQFFINLADNGSLDYKNGQYGYTVFGRVESGMDTVSKIARVKTA
FT                   TRGFYQNVPVQPVKIRRVVVGQ"
FT   gene            518016..520079
FT                   /locus_tag="NGO_0545"
FT   CDS_pept        518016..520079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0545"
FT                   /product="type III restriction endonuclease subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89279"
FT                   /db_xref="GOA:Q5F958"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041405"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F958"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951079.1"
FT                   /protein_id="AAW89279.1"
FT                   /translation="MLPTQPNPTQPNPTQPNPTQPNPSPDLSDTAGANTEAIYTSDGIT
FT                   ANSTQLEQLKKLFPACFDADGNFLIDRLQAEIAPQTDIGREFYEMNWLGKSYARLLRNL
FT                   PPETLISEDKTHNAKPENAGSQNLLIRGDNLEVLKHLKNAYANSVKMIYIDPPYNTGSD
FT                   GFVYQDDRKFTPAELALLANIDEDEAARILDFTDKGSNSHSAWLTFMYPRLYIARELLK
FT                   DDGVIFISIDDNEAAQLKLLCDEVFGEGNFVAQLPWRKRTAKSDVPFGISQDYEWIFVF
FT                   AKSCQFIAATKGKERRYYETDDFPDRPWRTHDLTKQTTAAERPNSFFTMVDPKTGKKYP
FT                   ANPNATWRVTKDTFQDYYNKGKIVFPDDYDFLNISNPVMRYFKDDDMKKAGEDFGKVAV
FT                   SSRLPENVGTLADAVAEYLAIFSRTLPENIGMTKEGTKEITDLFGSKIFTFPKPSQLIK
FT                   FLVSISSKSNDLILDFFAGSGTTAHAVMQLNAEGQNGNRRYICVQLPEKTAEKSEARKA
FT                   GYPTIFDITKARIEKAAAKIRVEHPDYTGDSGFKIFQTADNFRQHPDKDFSPEQPDLPL
FT                   NDELSEEQLQTLLTTWTLYDGAALTTPVEPVRLGSYTAYLCEKRLYLLNKGFTSADLLA
FT                   FIKKLDDDADFNPNRVIVFGSNMASAMQHELDQAVRGYTNKKEIELNVIIRV"
FT   gene            520169..523108
FT                   /locus_tag="NGO_0546"
FT   CDS_pept        520169..523108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0546"
FT                   /product="restriction endonuclease EcoPI subunit R"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89280"
FT                   /db_xref="GOA:Q5F957"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F957"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503724.1"
FT                   /protein_id="AAW89280.1"
FT                   /translation="MSGFNYEKNQPHQMRAVSAVLGVFDGATPKYRTADENPELLFAAK
FT                   QYANNILKVQSQNGIDGRFPDRSDDQNILDISMETGTGKTYTYTQTMFELHRWLGVFKF
FT                   IVVVPTLSIKAGTQQFLQSKALAEHFEQDFGGDYEGVRLKTYVVESAKKNKGKKSNAPI
FT                   TIEQFVKAENKKEIHVLLINAGMVNSSSMNDTGDKALKDLFDNPVDALAAVRPFMIVDE
FT                   PHKFPTRDSAKTWGNIKRLKPQYILRYGATFNDEYYNLLYRLTAVDAFNDGLVKGVRVF
FT                   QEEMQGGMDAAVKLVSSDGKEAKFELNEKDKKQTFKLAKGEDLAQIHPAISDLKIDKMN
FT                   KTVVVLSNGLELKTGAVINPYSYSQTVQDAMMQRAVAEHFKLERALLAERAPQPKIKPL
FT                   TLFFIDDIAGYRSGNELSGSLKDKFESWIRAEAARRLKTESDPFYRDYLQKTLDDVSAC
FT                   HGGYFSKDNTDSDDRIEQEINEILHDKEKLLSLDNPRRFIFSKWTLREGWDNPNVFQIC
FT                   KLRSSGSTTSKLQEVGRGLRLPVNELMARVRDVPYKLNYFVDSSEKDFVKQLVGEINDN
FT                   SFQEEISKKFTEELKQKILQKYPDIKPLVLVNQLFSDGIIDDNENFAEDGYDKLKAAYP
FT                   EAFPKGLDKGKVSNAKDEGKDTIIMREGKYEELKALWELIHHKAVLQYKIKDEAEFVDL
FT                   FTAYLRENAAKFPQAGICTAVNEAYINNGLMLSRRIDSIEDEDFIRFNTMTYREFLEKL
FT                   AQTAKIQMQTLHQAFYRVRDELNIGDFLNMQTIAQIKNGFNRFLLHHSFHKFELDYRLV
FT                   GSKIHPTKFTNKDGKPRAVKKADLGRFEDTEHRPAAGYLFGEIFYDSDIEHENVANNQI
FT                   EGVIVFTKIPRNSIKIPVAGGGTYSPDFAYIVKTKSGEILNFVIEAKGTDGAEDLRKSE
FT                   ERKIKHAEKLFAEISKEIKVVFKTQFDGERIAELIGQNMPAGGHSENGH"
FT   gene            complement(523202..524161)
FT                   /locus_tag="NGO_0547"
FT   CDS_pept        complement(523202..524161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0547"
FT                   /product="tRNA 2-thiocytidine biosynthesis protein TtcA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89281"
FT                   /db_xref="GOA:Q5F956"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F956"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702835.1"
FT                   /protein_id="AAW89281.1"
FT                   /translation="MSKKTKQELENNKLSKRLRHAVGDTINDFNMIEPGDKIMVCLSGG
FT                   KDSYALLDILRRLQASAPIDFELVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEEDTY
FT                   STVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATMFLNMFYGGK
FT                   LKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQPNLQRQVIGD
FT                   MLRDWDKRFPGRIESMFSALQNVVPSHLADTELFDFAGLERGQNLKHGGDLAFDSEKMP
FT                   ERFSDGSEEDESEIKIEPQKAERKVINILANKPKTCGP"
FT   gene            complement(524253..525116)
FT                   /locus_tag="NGO_0548"
FT   CDS_pept        complement(524253..525116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0548"
FT                   /product="tRNA-modifying protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89282"
FT                   /db_xref="GOA:Q5F955"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F955"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706098.1"
FT                   /protein_id="AAW89282.2"
FT                   /translation="MKTLLPFFGVARVSGEDRQTFLHGQLSNDINNLQTGQACYATYNT
FT                   PKGRVIANMIVVNRGDDLLLIMAQDLLEATVKRLQMFVLRAKAVFEILEDYAVGAELAA
FT                   SAEPLAAQEPSLAFTSECVSDGICSVILHHRGILHIAPETALPPYDAAAENAWRLHEIR
FT                   SGYPWICAATKETAVAQMLNQHIIGGVHFKKGCYPGQEIIARAQYRGQVKRGLAVLSGN
FT                   SAAEAGILLTADGEEAGIVLDSVQDSENFTALAVIKFSAAQKELTVPNGGIFKAVHLFF
FT                   KTKNAE"
FT   gene            complement(525151..525513)
FT                   /locus_tag="NGO_0549"
FT   CDS_pept        complement(525151..525513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0549"
FT                   /product="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89283"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F954"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002220919.1"
FT                   /protein_id="AAW89283.1"
FT                   /translation="MDIRYFGTTPRYSEAVCAGGLIFLSGMVPENGETAAEQTADVLAQ
FT                   TDRWLAECGSDKAHVLDAVIYLRDMGDYAEMNGVWDAWVAAGRTPARACVEARLARPEW
FT                   RVEIKITAVKRDAATA"
FT   gene            525588..526067
FT                   /locus_tag="NGO_0550"
FT   CDS_pept        525588..526067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0550"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89284"
FT                   /db_xref="GOA:Q5F953"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F953"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002244591.1"
FT                   /protein_id="AAW89284.1"
FT                   /translation="MSKHTYPITPAVRVLRENGIEFEPFTYAYEEHGGTAQFARLFGKD
FT                   EHLVIKTIVLQDENGKGPIVLMHGDKQISTRNLARHLGAKHIEPAAPAQANKWTGYLVG
FT                   GTTPFGIRTKLDIYVEQSVMDLETIYINGGKRGFIIGIRPDDLNILNPKTIQAAV"
FT   gene            526089..526781
FT                   /locus_tag="NGO_0551"
FT   CDS_pept        526089..526781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0551"
FT                   /product="molecular chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89285"
FT                   /db_xref="GOA:Q5F952"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F952"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002241619.1"
FT                   /protein_id="AAW89285.1"
FT                   /translation="MDKDLYAVLGVSPQAGADEIKRAYRKLAMKYHPDRNPGNLQAEEK
FT                   FKEIQRAYDTLSDLSKRTQYDASFRRHEERGRQEEAFRREQARREQFYGEQMRREQAFR
FT                   REFERQASRSRHAYEPSGSGSGRNYILAAYILFGLGAIIQFMPIVGVILAYMKRNSLDS
FT                   IVYAAHTEYLIKTFWRTFWLYLLGALTARFGIGVLVIIATTVWYFYRIIAGFIRFNDGR
FT                   AVAPEKWI"
FT   gene            526785..527660
FT                   /locus_tag="NGO_0552"
FT   CDS_pept        526785..527660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0552"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89286"
FT                   /db_xref="GOA:Q5F951"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F951"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002213426.1"
FT                   /protein_id="AAW89286.1"
FT                   /translation="MAYLLISIVFSVSVSILLKMARKKKIDIAQAVAVNYVVAVILTLS
FT                   VLKPDVGNIGAFLPTWPLFAALGVLLPSVFVIMGKSVESAGIVKSDAAQRLSLFLPIVA
FT                   ALTLFGEKLSEGKLIGLCLAFAALFCLLWKSDSGKKSGSAWRQALLLLGVWAGYGIIDI
FT                   LFKQIAKSGTAFAGNLLVAFALAGVLMFACLFAKSVRWRVESVVGGILLGGLNFMNIVT
FT                   YITAHQMMKDSPTLVFAGMNIGVIVLGTLSGALFFKEKINTINTAGIVLSLCSIACLFY
FT                   WTEVKALFGI"
FT   gene            527868..531488
FT                   /locus_tag="NGO_0553"
FT   CDS_pept        527868..531488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0553"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89287"
FT                   /db_xref="GOA:Q5F950"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F950"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706103.1"
FT                   /protein_id="AAW89287.1"
FT                   /translation="MMSGFSPKPKTIILSLAGAFGALAFADTPNNTEQQKELNTIVVHG
FT                   KRSADQKGADDVYYKNVSNAYVGKEYLERYRVQSAGDVLKGLNGVYNMNTRTAGGAITP
FT                   NIRGITGKGRIPVTIDGTEQTIDVWMNNYGVGDRNYLDPALFRSIAVEKSPALTRGVKS
FT                   GVGGAMSIRTIEPSDIIPEGRNWGIEVKTEFSGNTVAQKNDLRQFLGRDYRTLSPIGAT
FT                   ADGVSGMPDVLTGYTGKPSPTALLLDEGIADTKFSGGKSHTNFKDDRQLMLSAAFKTDI
FT                   TDGLAAYSHRQKGNYYAGKRGYQSYLNNPIYGADACYDQYPDKSWREKDILCKSSASLV
FT                   PNMAVLFRPGEEIMNSHTDTKILLLKNNWYLPDNQKISLQYMDNKIGFGEINPLITAWI
FT                   LGFAEQSLNEPVQQAPGIGTKIDSKTYKIGYEWKPQNNKWIDLQADMWRVKTDSNRHQS
FT                   GGPVVGVITSDFDYDLWYWCNIRKKPSPNLRGESCESAMTWNAYGSARTHEEVLRMIED
FT                   TPDKIARKLAEYDENNRAITDRWMGHTGGYYTITPADKNVLTDQTNQIGKMMNLAELKQ
FT                   KLNQERYYIEHPDRIIVPGARQRTDVVRNGFNLSNRLRLSDKLSLTLAADYQRETLEER
FT                   TDTADSNDLMNTFGVLTRMAALGGPQSAKKREWGANLVFDWKPTSRLNIQAGVRYQNYK
FT                   GNNIELARQRAARNPWYQYGLGSDSYVTGLMMPYYELADEEDIANQKRMLQLYDPDRAD
FT                   GQVAEYQDLNRRFKEKNGYDFDPHDTLVGQDTRFYAKSDGNFVQYADGNKNTDVLYVLR
FT                   RKQIIPMNAGKFDPGKVQITPEMYRERVNNPQGKSGSYRRYIPGSHIYITPGSVREEME
FT                   RMANENQIPSKEDNNQALEFNSDLNRTAWIRHQFGEADRWRMPQEQRAHSWSPMLAVSY
FT                   DLADNHRLFARYARMSRFPSLYELTAATGSGGLYGSETVAEYSLKPEKSTNWEVGYNFN
FT                   FAPHFAKLRQGDLRLTYYSNKIKNQIDTSNEDGGMIQYDKAVSKGVELQSRLDSGRFFA
FT                   SFGGTYRLKHMVCDKGIAFKFDYYLQRVPECLEGGFGLSRFFQSLQPKYSLTLDVGTRF
FT                   FNEKLELGMRAIHHSKAERRNYDKLIADGAGQVYARNGKPYGWHAATLLDAYARYRIGK
FT                   HIDLNFSVTNLANRYYLDPMSSTPVPGPGRTITFGIKGRF"
FT   gene            531770..532720
FT                   /locus_tag="NGO_0554"
FT   CDS_pept        531770..532720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89288"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F949"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003706105.1"
FT                   /protein_id="AAW89288.1"
FT                   /translation="MKASQLTLAVLLAAAFGSAYAVEVKGGDSSKGQLIQAAESDFLPF
FT                   GSGAADIKVSTGNGLSKSINLEAGPAQRIRNKYGNAPINGGNQNTNVNGAANSRYLQPG
FT                   DINPIAGWFSKTRLAQVWYEKRANNTEVFSVRQMADPLLPIAPKFGGMTFAKVPTAATN
FT                   VFFGEWAPRKGNSNQITNSTDLNMNDGNRTVWFVGENPTKNTRNLTAVTYNVVGINKHT
FT                   PGKNDFYTGEITATFGTGDKGFMSGELEHTDDGELSFNGVEITNADGSFNSIPGRNNEG
FT                   IKGQFYGNGAAAMAGYATRGTDNKGDDVAFGGAKK"
FT   gene            532940..534433
FT                   /locus_tag="NGO_0555"
FT   CDS_pept        532940..534433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89289"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F948"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951081.1"
FT                   /protein_id="AAW89289.1"
FT                   /translation="MTHRLCLLFLPLCTVCLAAPSNDAADERRRLLDEGSRQTQQYRES
FT                   GWLDTEQARGEVEENDGYISIGGEIYQVGDTAEELESAIYHALNARQWHKVRQFAARYA
FT                   KLPRHKPALIHLADALQKRDEGDFRAAGNSFQTALEAEPDNPRLLLEAGRFYAEDNQNK
FT                   ESAAAFEKVLKTDIPAETRPIVENYLSELGKRRRWHGQISLGYGYNSNVNQGNGINQCV
FT                   WEIAGMCLMERTLPAPTDSTFSSYSATAEKTVPLKGNHGVQVRGVLYGNRYTEKDKDSA
FT                   AMPDYGYRNGSLYAGYAYADARSSFSLLPYFEYDFRNRHTHYRAWGADADWSRTLSPHW
FT                   RINSHAGAKKTGYGGQSKTYFADFKQYELGAGAEFSITLKSGLLVNFDAARKAYPEKSS
FT                   SSKEYTARLGAYRLFSGGTYLNAVLLYRRSLYDAASFVSDNKRRRDKQYIMMAAAGFPQ
FT                   WNIKGVYPELRFRRTIAHSNAVYYRYRQNEWLLGFKYRF"
FT   gene            complement(534501..535898)
FT                   /gene="aspA"
FT                   /locus_tag="NGO_0556"
FT   CDS_pept        complement(534501..535898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="NGO_0556"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="catalyzes the formation of fumarate from aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89290"
FT                   /db_xref="GOA:Q5F947"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F947"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009311384.1"
FT                   /protein_id="AAW89290.1"
FT                   /translation="MTVRIEHDLLGDREIPAEVYWGIHTLRAIENFKISTQKISDVPQF
FT                   VRSIVMVKKATAQANGELGAVKPEIAAAIEKACDEVLLNNRCLDQFPSDVYQGGAGTSV
FT                   NMNTNEVIANLALEALGYEKGRYDIVNPMDHVNASQSTNDAYPTGFRLAVYYSIGELLD
FT                   KLTVLKNAFAAKAEAFKDVLKMGRTQLQDAVPMTAGQEFQSFQVLLEEEILNLDRTRQL
FT                   LLEVNLGATAIGTGVNTPKGYAELVVKKLSEVSGLPCKLTENLIEATSDCGAYVMVHGA
FT                   LKRTAVKLSKICNDLRLLSSGPRAGLKEINLPELQAGSSIMPAKVNPVIPEVVNQVCFK
FT                   VIGNDTTITFAAESGQLQLNVMEPVIAQCMFETISLLGNAAVNLSDKCVKGITVNREIC
FT                   ERYVFNSIGLVTYLNPYIGHRNGDLVGKICAQTGKGVREVVLERGLLSEEEINRILSPE
FT                   NLMNPHL"
FT   gene            complement(535924..536112)
FT                   /locus_tag="NGO_0557"
FT   CDS_pept        complement(535924..536112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F946"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691361.1"
FT                   /protein_id="AAW89291.1"
FT                   /translation="MAEHNPPKDILAAGGACRKVRKVTTENNVSRFQTAYDMDNFIRAG
FT                   IVFVLLRHLSDGAFFQY"
FT   gene            complement(536176..536736)
FT                   /locus_tag="NGO_0558"
FT   CDS_pept        complement(536176..536736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89292"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F945"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019273356.1"
FT                   /protein_id="AAW89292.1"
FT                   /translation="MKKIIFAALAAAAVGTASATYKVDEYHANVRFAIDHFNTSTNVGG
FT                   FYGLTGSVEFDQAKRDGKIDITIPVANLQSGSQPFTGHLKSADIFDAAQYPDIRFVSTK
FT                   FNFNGKKLVSVDGNLTMRGKTAPVKLKAEKFNCYQSPMAETEVCGGDFSTTIDRTKWGV
FT                   DYLVNAGMTKNVRIDIQIEAAKQ"
FT   gene            536937..537590
FT                   /locus_tag="NGO_0559"
FT   CDS_pept        536937..537590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0559"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89293"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8T7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951225.1"
FT                   /protein_id="AAW89293.1"
FT                   /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFYR
FT                   KIRTVANHRLALAADEVFEGPAGPGGSCFGGRRKGRRGRGAAGKAVVFGIPKRNGRAYT
FT                   VAADDAEPETLLPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRRNHI
FT                   NGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRLNFGTPSRQLKILRDRCGI"
FT   gene            537765..538076
FT                   /locus_tag="NGO_02955"
FT   CDS_pept        537765..538076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02955"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IW20"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="AKO63628.1"
FT                   /translation="MNKKLALMPLLILSAFSSAADNTPQHGELGQVHVRADAKRVKAAH
FT                   SYSIASDGDLRDRVNLGVLGKANAFTAPITVVNYDEQAFNNTEARTLVDAVAKKDASV"
FT   gene            538330..538713
FT                   /locus_tag="NGO_02960"
FT   CDS_pept        538330..538713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02960"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02960"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63629"
FT                   /db_xref="GOA:A0A0H4ISN3"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISN3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017146768.1"
FT                   /protein_id="AKO63629.1"
FT                   /translation="MARFGNNRAQGTFDLGQRFGENKAFGVRANGKLRHGDTPRHGYRE
FT                   DNKEFALNADYRGEKLRVTFDSIYAKRKINGGRARMQDIQNAGGRLFDAPDGKINLLPS
FT                   WNWQNTVGETNMLTFEWDAFDNT"
FT   gene            538816..540009
FT                   /locus_tag="NGO_02965"
FT   CDS_pept        538816..540009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_02965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_02965"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63630"
FT                   /db_xref="GOA:A0A0H4IV14"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IV14"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002234970.1"
FT                   /protein_id="AKO63630.1"
FT                   /translation="MAANQYHTGTARLTDQYFRTLSMNLTARGEFETGPVTHNWSTAFD
FT                   RVIRQRKTINGSGNGNSKIEVKANENIANQLASFKADYPNSWANSANLDANIKVNSLAL
FT                   SDTLGFVDNKYPLTLGGRFQAVEYTDKKKSQSGDAKRFSPMLMAAWVPQPDLVVCGNYM
FT                   EDLERADIKTDDSGETTMAKPRVSRQFEIGVRKNWGDFVTTLNAFQIKRPGYWRGNTKK
FT                   GTDFAAYKAAGGAAGDEQGMERNRGIEFNAYANLLNKTLRPTFGVMYLQSSVKNYPNAR
FT                   DMLVNGVQVANPRVIVKTGVERDTPFAKGLSLNGNVSYFGKSYQDTQKQYAFPSYTLVD
FT                   VGARYKTKLGKNTLTVSSSVENLFNKNYWQVQRGQFDRSFAVVGLPRTYWLKAELDF"
FT   gene            540134..541684
FT                   /locus_tag="NGO_0561"
FT   CDS_pept        540134..541684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89294"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F943"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691356.1"
FT                   /protein_id="AAW89294.1"
FT                   /translation="MKKPLISVAAVLLGVALGTPYYLGVKAEESLTQQQKILQKTGFLT
FT                   VESHQYDRGWFTSTETTVIRLKPELLHNAQKYLPDNLKIVLEQPVTLVNHITHGPFAGG
FT                   FGTQAHIETEFKYAPETEKVLERFFGKQVPVSLANTVYFNGSGKMEVSVPAFDYEELSG
FT                   IRLHWEGLTGETVYQKGFKSYRNSYDAPLFKIKLADKGDAAFEKAHFDSETSDGINPLA
FT                   LGSSNLTLEKFSLEWKEGVDYNVKLNELVNLVTDLQIGAFINPNGSIAPSKIEVGKLAF
FT                   STKTGESGAFIDSEGRFRFDTLVYGDEKYGPLDIHIAAEHLDASALTVLKRKFAQISAK
FT                   KMTEEQIRNDLIAAVKGDASGLFTHDPVLNIKIFRFTLPQGKIDVGGKIMFKGMKKEDL
FT                   NQLGLMLKKTEANIRMSIPQKMLEDLAVSQAGNIFSVNAEDEAEARASIADINETLRLM
FT                   VDSTVQSMAREKYLTLDGNQIDTVISLKNNALKLNGKTLQNEPDPDFDEGDMVSGQPH"
FT   gene            complement(541869..542067)
FT                   /pseudo
FT                   /locus_tag="NGO_02975"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(542108..543892)
FT                   /locus_tag="NGO_0562"
FT   CDS_pept        complement(542108..543892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0562"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89295"
FT                   /db_xref="GOA:Q5F942"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F942"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691354.1"
FT                   /protein_id="AAW89295.1"
FT                   /translation="MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKAT
FT                   MDVPAEVAGVIKEVKVKVGDKISEGGLIVVVEAEGAAAAPKAEAAAAPAQEAPKAAAPA
FT                   PQAAQFGGAADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIP
FT                   SKALLHNAAVIDEVRHLAANGIKYPKPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVD
FT                   VIQGDGQFLDPHHLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDP
FT                   RIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQGADRDLV
FT                   KVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNG
FT                   KLISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCA
FT                   GHKAYFDARVIPGVAYTSPEVAWVGETELSAKASGRKITKANFPWAASGRAIANGCDNG
FT                   FTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADIGKTIHPHPTLGESIGM
FT                   AAEVALGVCTDLPPQKKK"
FT   gene            complement(543910..544200)
FT                   /locus_tag="NGO_0563"
FT   CDS_pept        complement(543910..544200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0563"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: pir||G81094 hypothetical protein
FT                   NMB1343 [imported] - Neisseria meningitidis (group B strain
FT                   MD58) >gi|7226587|gb|AAF41718.1| (AE002482) hypothetical
FT                   protein [Neisseria meningitidis MC58]"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F941"
FT                   /protein_id="AAW89296.1"
FT                   /translation="MKNAVYAHQIETDLYDGCYISTTTDKEIAKKFATSSGIENGYIYV
FT                   LNRDLFGQYSIFEYEVEHPENPDEKEVTIRAEDCGCIPEEVIIAKELIEIN"
FT   gene            complement(544445..546034)
FT                   /locus_tag="NGO_0564"
FT   CDS_pept        complement(544445..546034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0564"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89297"
FT                   /db_xref="GOA:Q5F940"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F940"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003703895.1"
FT                   /protein_id="AAW89297.1"
FT                   /translation="MSIVEIKVPDIGGHENVDIIAVEVKAGDTIAVDDTLITLETDKAT
FT                   MDVPADAAGVVKEVKVKVGDKISEGGVILTVETGAAAAEAAPAAAAEAQPAPAAAGGAT
FT                   VQVAVPDIGGHTDVDVIAVEIKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAVFLK
FT                   VGDKVSEGSAIIEVETAGSAAAAPAPAAQAAAPAAVPTSAAPAAVPTSASPAAAKIDEA
FT                   AFAKAHAGPSARKLARELGVDLGQVKGSGLKGRIMGDDIKAFVKSVMQGGAAKPAAAGA
FT                   SLGGGLDLLPWPKVDFSKFGNVEVKELSRIKKISGQNLSRNWVVIPHVTVHEEADMTEL
FT                   EEFRKQLNKEWEREGVKLSPLAFIIKASVSALKAFPEFNASLDGDNLVLKNYFNIGFAA
FT                   DTPNGLVVPVIKDVDQKGLKQISQELTELSKKAREGKLKPQEMQGACFTISSLGGIGGT
FT                   GFTPIVNAPEVAILGVCKSQIKPVWNGKEFAPRLMCPLSLSFDHRVIDGAAGMRFTVFL
FT                   ANLLKDFRRITL"
FT   gene            complement(546184..548847)
FT                   /gene="aceE"
FT                   /locus_tag="NGO_0565"
FT   CDS_pept        complement(546184..548847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="NGO_0565"
FT                   /product="pyruvate dehydrogenase"
FT                   /note="E1 component; part of pyruvate dehydrogenase; forms
FT                   a complex with DlaT and LpdC"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89298"
FT                   /db_xref="GOA:Q5F939"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F939"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009173178.1"
FT                   /protein_id="AAW89298.1"
FT                   /translation="MSTQLHDVDPIETQEWLDALSSVLEYEGGERAQYLLENLLKYCRD
FT                   KGVRMPHGTTTPYLNTVSVENEKGIPGDQNIEHRIRAFVRWNAAAIVLRAGKKDLELGG
FT                   HIASFQSAATMYEVGFNHFWKAKGEGEEGDLVFFQGHVAPGIYARAFVEGRLTEDQLNN
FT                   FRQEVDGHGLPSYPHPHLLPDFWQFPTVSMGLGPIMAIYQARFLKYLESRGLAKTKGRK
FT                   VWCFCGDGEMDEPESQGAIALAAREGLDNLIFVINCNLQRLDGPVRGNGKIIQELEGNF
FT                   AGAGWNVVKVIWGRRWDRLLAKDKDGILRQRMEECLDGDYQTYKSKDGAYVREHFFNTP
FT                   ELKALVADMTDEQLWALNRGGHDPQKVYNAYDRAANHADGKPTVILAKTIKGYGMGASG
FT                   EGQNVAHQAKKMDKASLKQFRDRFDIPVTDEQIESGDLPYLTFAPDTEEYKYLHARRDA
FT                   LGGYLPQRKPTQEVLEVPELSAFDAQLKSSGEREFSTTMAFVRILSTLLKDKKIGKRVV
FT                   PIVPDESRTFGMEGMFRQYGIWNPKGQQYTPQDKDQLMFYKESVDGQILQEGINEPGAM
FT                   ADWIAAATSYANSDFAMIPFYIYYSMFGFQRIGDLAWAAGDMHARGFLLGGTAGRTTLN
FT                   GEGLQHEDGHSHIQADLIPNCVSYDPTFQYEVAVIVQDGLRRMYANNEDVFYYITLMNE
FT                   NYTHPDMPEGAEQDILKGMYLLKAGGKGDKKVQLMGSGTILQEVIAGAELLKADFGVEA
FT                   DIWSCPSFNLLHRDAIETERFNRLHPLEAEKVPFVTSQLQGHDGPVIAATDYIRSYADR
FT                   IRAYIPNDYHVLGTDGFGRSDSRANLRRFFEVDRYNVAVAALAALAEQGKVSKETVQQA
FT                   IEKYGIKADSAPSWKR"
FT   gene            549544..551256
FT                   /locus_tag="NGO_0566"
FT   CDS_pept        549544..551256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0566"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /note="catalyzes the formation of prolyl-tRNA(Pro) from
FT                   proline and tRNA(Pro)"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89299"
FT                   /db_xref="GOA:Q5F938"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F938"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002233981.1"
FT                   /protein_id="AAW89299.1"
FT                   /translation="MKASQFFISTLKEAPAEAAFASHKLMIRAGLIKANASGLYTWMPM
FT                   GLRVLRKVENVVREEMARAGSVELLMPVVQPAELWQESGRWEFYGKELLRLKDRHERDF
FT                   CMGPTCEEVIADIVRKEINSYKQLPKNFYHIQTKFRDEVRPRFGVMRAREFVMKDAYSF
FT                   HADYASLQATYDAMYDAHCRIFTRLGLAFRPVAADTGSIGGTGSHEFQVLAESGEDVIA
FT                   YSDTSDYAANIELAPTLPLKGERAAAQAVLTKVHTPNVKTIESLVEFLNIPVEQTLKSI
FT                   VVEGENEGELVLLLLRGDHEFNDIKAEKLAGVKSPLTMASPAAIVEQFGANGGSLGPVG
FT                   FTGKVYADFATEKGADWVIGANEDDYHYTGFNFGRDAAEPEFVDLRNVVEGDESPDGQG
FT                   RLKLARGIEVGHVFQLRGKYTQAMNVSFLDNNGKSQIMEMGCYGIGITRVVAAAIEQNN
FT                   DEKGIIWTKAMAPFEVVIVPMNYKKSDTVREAADRIYAELLAAGADVLLDDRDERAGVL
FT                   LNDSELLGIPHRIVIGDRALKEGNVEYAERRGNEAQAVAIGEIVARVTASLNA"
FT   gene            551319..551975
FT                   /locus_tag="NGO_0567"
FT   CDS_pept        551319..551975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89300"
FT                   /db_xref="GOA:Q5F937"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F937"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003688991.1"
FT                   /protein_id="AAW89300.1"
FT                   /translation="MASVFLEGEAVEVGNIFCIGRNYAAHVEELKNEIPSEPVVFMKPS
FT                   GSILNSGGTILLPEFSRDVQFECELVLLIGRDSDGTGEGEDILGCVAGYGVGLDLTARD
FT                   IQCRLKAQGLPWLKAKGFRHSACVSDFAAADRIGNQDKVLFSLKQNGVLKQRGETGLMI
FT                   YPIREILHKLAADYGLGKGDLVFTGTPSGVGAIGAGDNLALELDGLVCASFTIGC"
FT   gene            complement(551985..552440)
FT                   /locus_tag="NGO_0568"
FT   CDS_pept        complement(551985..552440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0568"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89301"
FT                   /db_xref="GOA:Q5F936"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F936"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002243591.1"
FT                   /protein_id="AAW89301.1"
FT                   /translation="MHKIPKGTALAFDFGEARIGVAQGDAELGLSHPLATVTGGSNDEK
FT                   FAAIAKLVQEWQPRYFVVGLPVHADGTEHEMTHLSRKFGRRLNGRFNLPVYWVDERLSS
FT                   VCAESLLSEAQVLGKKRKSVLDQVAAQAILHGFLEGGPAECFNGREG"
FT   gene            complement(552433..552981)
FT                   /locus_tag="NGO_0569"
FT   CDS_pept        complement(552433..552981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89302"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F935"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003674649.1"
FT                   /protein_id="AAW89302.1"
FT                   /translation="MNLSNHFLVAMPDMEDAFFSQSVVYICKHDEDGALGIAINKPSPI
FT                   TMDMIFSATGKNIPMRMQHDSVMMGGPVQVERGYVVHTPIGNWQSSIGVSDGIALTSSR
FT                   DVLENISREGAVDKALISIGYSSWSKGQLERELADNAWLTVPADEHILFDIPYEHRYAA
FT                   AFAKLGIDPLALFSGAGHA"
FT   gene            complement(552983..553543)
FT                   /locus_tag="NGO_0570"
FT   CDS_pept        complement(552983..553543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0570"
FT                   /product="creA protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89303"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F934"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692938.1"
FT                   /protein_id="AAW89303.1"
FT                   /translation="MNRLLLLSAAVLPTACGSGETDKIGRASTVFNMLGKNDRIEVEGF
FT                   DDPDVQGVACYISYAKKGGLKEMVNLEEDASDASVSCVQTASSISFDETAVRKPKEVFK
FT                   RGTGFAFKSRQIVRYYDPKRKAFAYLVYSDKIVQGSPKNSLSAVSCFGSGIPQTDGVQA
FT                   DTSGKLLAGACIISNPIKNPDKR"
FT   gene            553869..555665
FT                   /locus_tag="NGO_0571"
FT   CDS_pept        553869..555665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89304"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F933"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951085.1"
FT                   /protein_id="AAW89304.1"
FT                   /translation="MRYKPLLLALMLVFSTPAVAAHDAAHNRSAEVKKQAKNKKEQPEA
FT                   AEGKKEKGKNAAVKDKKTGGKEAAKEFKKTAKNRKEAEKEATSRQSARKGREGDKESKA
FT                   EHKKAHGKPVSGSKEKNAKTQPENKQGKKGAKGQGNPRKGGKAEKDTVSANKKARSDKN
FT                   GKAVKQDKKHTEEKNAKTDSDELKAAVAAATNDVENKKALLKQSEGMLLHVSNSLKQLQ
FT                   EERIRQERIRQERIRQARGNLASVNRKQREAWDKFQKLNTELNRLKTEVAATKAQISRF
FT                   VSGNYKNSRPNAVALFLKNAEPGQKNRFLRYTRYVNASNREVVKDLEKQQKALAVQEQK
FT                   INNELARLKKIQANVQSLLKKQGVTDAAEQTESRRQNAKISKDARKLLEQKGNEQQLNK
FT                   LLSNLEKKKAEHRIQDAEAKRKLAEAKLAAAEKARKEAAQQKAEARRAEMSNLTAEDRN
FT                   IQAPSVMGIGSADGFSRMQGRLKKPVDGVPTGLFGQNRSGGDVWKGVFYSTAPATVESI
FT                   APGTVSYADELDGYGKVVVIDHGENYISIYAGLSEISAGKGYTVAAGSKIGTSGSLPDG
FT                   EEGLYLQIRYRGQVLNPSGWIR"
FT   gene            555792..557267
FT                   /locus_tag="NGO_0572"
FT   CDS_pept        555792..557267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0572"
FT                   /product="peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89305"
FT                   /db_xref="GOA:Q5F932"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F932"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691337.1"
FT                   /protein_id="AAW89305.1"
FT                   /translation="MSKPVFKKIALYTLGAISGVAVSLAVQGFAAEKDGRDNEVLPVQS
FT                   IRTMAEVYGQIKANYYHDKPDADLFEGAMKGMVAGLDPHSEYMDKKGYAEIKESTSGEF
FT                   GGLGMEIGQEDGFVKVVSPIEDTPAERAEVKSGDFIVKIDNVSTRGMTVSEAVKKMRGK
FT                   PGTKITLTLSRKNADKPIVVNLTRAIIKVKSVRHHLIEPDYGYIRVSQFQERTVESVNT
FT                   AAKELVKENKGKPLKGLVLDLRDDPGGLLTGAVGVSAAFLPSEAVVVSTKGRDGKDGMV
FT                   LKAVPEDYVYGMGGDPLAGIPAELKTIPMTVLVNSGSASASEIVAGALQDHKRAVIVGT
FT                   QSFGKGSVQTLIPLSNGSAVKLTTALYYTPNDRSIQAQGIVPDVEVKDKERTFESREAD
FT                   LVGHIGNPLGGEDVNSETLAVPLEKDADKPAAKEKGKKKKDEDLSSRRIPNPAKDDQLR
FT                   KALDLVKSPEQWQKSLGLAAKKPVSNKDKKDKK"
FT   gene            557597..559624
FT                   /locus_tag="NGO_0573"
FT   CDS_pept        557597..559624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0573"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89306"
FT                   /db_xref="GOA:Q5F931"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F931"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P56996.1"
FT                   /protein_id="AAW89306.1"
FT                   /translation="MEVIRYPNSPFKLHQPFPPAGDQPTAIAGLIEGLSDGLAYQTLLG
FT                   VTGSGKTYTMANVIAQSGRPAIIMAHNKTLAAQLYAEMREFFPENAVEYFVSYYDYYQP
FT                   EAYVPSRDLFIEKDSAINEHIEQMRLSATKNLMTRDDVIIVATVSAIYGIGDPTEYQQM
FT                   VLSVKEGDTIEQRDIIATLVSMQYERGDLDFKRGSFRVRGDVIDVYPAESSENALRISL
FT                   FDDEIDRLDMFDPLSGSLHQRVGRYTVFPSSHYVTPRDTVLRACESIKEELRERIEFFA
FT                   REQRPVEQQRIEQRTRFDLEMLYEMGFCKGIENYSRHFSGKKEGEPPPTLMDYLPDNAI
FT                   MFIDESHVTVTQIGGMYKGDASRKQNLVDYGFRLPSARDNRPLKFHEFEKVMPQTVFVS
FT                   ATPAKYEEEHAGQVVEQVVRPTGLVDPQTIIRPVATQVDDLMSEINDRIQKGERVLVTT
FT                   LTKRMAEQLTDYYSELGIKVRYLHSDIDTVERVEIIRDLRLGLFDVLVGINLLREGLDI
FT                   PEVSLVAILDADKEGFLRSHRSLIQTIGRAARNVNGVAILYADKITDSMKAAVDETERR
FT                   REKQIKFNEEHGIVPQQIKKQVKDIIDGVYHEEDSGKGRRQGKNKVKVGEIHNEEDAIK
FT                   EIAKLEKAMQQAARDLQFEEAAVLRDRISNIKENLLFGAE"
FT   gene            complement(559802..560560)
FT                   /locus_tag="NGO_0574"
FT   CDS_pept        complement(559802..560560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0574"
FT                   /product="carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89307"
FT                   /db_xref="GOA:Q5F930"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F930"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q50940.2"
FT                   /protein_id="AAW89307.1"
FT                   /translation="MPRFPRTLPRLTAVLLLACTAFSAAAHGNHTHWGYTGHDSPESWG
FT                   NLSEEFRLCSTGKNQSPVNITETVSGKLPAIKVNYKPSMVDVENNGHTIQVNYPEGGNT
FT                   LTVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQPLVLAVLYEAGKTNGRL
FT                   SSIWNVMPMTAGKVKLNQPFDASTLLPKRLKYYRFAGSLTTPPCTEGVSWLVLKTYDHI
FT                   DQAQAEKFTRAVGSENNRPVQPLNARVVIE"
FT   gene            complement(561640..562356)
FT                   /locus_tag="NGO_0575"
FT   CDS_pept        complement(561640..562356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0575"
FT                   /product="tRNA (guanine-N7)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89308"
FT                   /db_xref="GOA:Q5F929"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F929"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002235871.1"
FT                   /protein_id="AAW89308.1"
FT                   /translation="MTDTPENQTPNDLPAGHSRSIRSFVLRQSHMTAAQQRAIDTLWDS
FT                   FGIDYQATPADLDARFGSSRPKILEIGFGMGMASAEIARRLPETDFLAIDVHGPGVGNL
FT                   LKLINENHLENIRVMRHDAVEVVENMLQDGSLDGIHIFFPDPWHKKRHHKRRLIQAPFI
FT                   AKLLPKLKTGGYIHLATDWEEYAQQMLEVLSSFDNLQNTAADYAPTPDYRPETKFEARG
FT                   KRLGHGVWDLVFKRIG"
FT   gene            complement(562498..563496)
FT                   /locus_tag="NGO_03050"
FT   CDS_pept        complement(562498..563496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_03050"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63631"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IRQ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014580238.1"
FT                   /protein_id="AKO63631.1"
FT                   /translation="MGKTSAKNNNPHGQYLLAQYCRHGTPPDFETAHLLYRKAAAQGLP
FT                   EAHWQLGLQYRFGQGTKADTAQAVNHLRAAAQQGYIPAYTPLAELILPTAPDEAVYRFQ
FT                   QAAQENDPDAHAALADIYLQGKYLERNHKLALHHAEAAAAERHPEGLRIPGDICRYGLG
FT                   IALDTEKARHYYRQAAEAGSLTAYQKLISDSALNHPEQYDGIKDSAIRRQQAEQLYQKP
FT                   KPCITDYNAHPNTQPRSNCTQKPQNSDTAKPKPIWAVCITSDRAQPPTTTKPANGLNKP
FT                   PRKKTVWRSTTSPASITADTVSNRIKEKACHCLQEAINNGYGQKNVLQELL"
FT   gene            complement(564000..565886)
FT                   /gene="uvrC"
FT                   /locus_tag="NGO_0578"
FT   CDS_pept        complement(564000..565886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="NGO_0578"
FT                   /product="excinuclease ABC subunit C"
FT                   /note="The UvrABC repair system catalyzes the recognition
FT                   and processing of DNA lesions. UvrC both incises the 5' and
FT                   3' sides of the lesion. The N-terminal half is responsible
FT                   for the 3' incision and the C-terminal half is responsible
FT                   for the 5' incision"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89309"
FT                   /db_xref="GOA:Q5F928"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F928"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F928.2"
FT                   /protein_id="AAW89309.1"
FT                   /translation="MPSEAVFQMIDMNTENRSPEQFDIPLFLKNLPKLPGVYRFFDEGG
FT                   NVLYVGKAVNLKRRVSGYFQKNDHSPRIALMVKQVRHIETTITRSEAEALILENNFIKA
FT                   LSPKYNILFRDDKSYPYLMLSGHQYPQMAYYRGTLKNPNQYFGPYPNSNAVRDSIQVLQ
FT                   KVFMLRTCEDSVFEHRDRPCLLYQIKRCTAPCVGHISEEDYCDSVRQAATFLNGKTDEL
FT                   TRTLQHKMQTAAANLQFEEAARYRDQIQALGIIQSNQFIDSKNPNNPNDIDLLALAVSD
FT                   GLVCVHWVSIRGGRHVGDKSFFPDTKNDPEPNGQDYAEAFVAQHYLGKSKPDIIISNFP
FT                   VPDALKEALEGEHGKQMQFVTKTIGERKVWLKMAEQNAQMAITQRHLQQSNQQHRIDEL
FT                   AKILGMNSDGINRLECFDISHTQGEATIASCVVYDEQNIQPSQYRRYNITTAKPGDDYA
FT                   AMREVLTRRYGKIQEAEANGESVKWPDVVLIDGGKGQIGVAVSVWEELGLHIPLVGIAK
FT                   GPERKAGMEELILPFTGELFRLPPNSPALHLLQTVRDESHRFAITGHRKKRDKARVTSS
FT                   LGDIPGVGSKRRQALLTRFGGLRGVIAASREDLEKVEGISKALAETIYNHLH"
FT   gene            complement(565941..568118)
FT                   /locus_tag="NGO_0579"
FT   CDS_pept        complement(565941..568118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0579"
FT                   /product="metal ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89310"
FT                   /db_xref="GOA:Q5F927"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F927"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003688969.1"
FT                   /protein_id="AAW89310.1"
FT                   /translation="MQQKIRFQIEGMTCQACASRIEKVLNKKDFVESAGVNFASEEAQV
FT                   TFDGSKTSVADIAKIIEKTGYGAKEKTEDTLPQPEAEHHIGWRLWLLLTINIPFLIGMV
FT                   GMMLKGLNWTRHDWMIPPVWQFVLASIVQLWLAIPFYKSAWASIKGGLANMDVLVTIGT
FT                   VSIYLYSVYMLFFSSHAAHGMAHVYFEAGVMVIGFVSLGKFLEHRTKKSSLNSLGLLLK
FT                   LTPTQVNVQRNGEWKQLPIDQVQIGDLIRTNHGERIAADGIIESGSGWADESHLTGESN
FT                   PEEKKAGGKVLAGALMTEGSVVYRAAQLGSQTLLGDMMNALSEAQGSKAPIARVADKAA
FT                   AVFVPTVVGIALLTFIVAWLIKGDWTVALMHAVAVLVIACPCALGLATPAAIMVGMGKA
FT                   VKHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGRPQVAAVYYVPDSGFDEDALYRIAAA
FT                   VEQNAAHPLARAIVSAAQARGLEIPAAQNAQTVVGAGITAEVEGVGLVKSGKAEFAELT
FT                   LPKFSDGVWEIASAVTVSVNGKPIGAFALSDALKADTAEAIGRLKKHNIDVYIMSGDNQ
FT                   STVEYVAKQLGIAHAFGNMSPCDKAAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFA
FT                   MKGGADVAEHTASATLMQHSVNQLADALLISQATLENIKQNLFFAFFYNILGIPLAALG
FT                   FLNPVIAGAAMAASSVSVLGNALRLKWVKID"
FT   gene            568257..569207
FT                   /locus_tag="NGO_0580"
FT   CDS_pept        568257..569207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0580"
FT                   /product="thioredoxin reductase"
FT                   /note="catalyzes the transfer of electrons from NADPH to
FT                   thioredoxin; FAD/NAD(P) binding"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89311"
FT                   /db_xref="GOA:Q5F926"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F926"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003688968.1"
FT                   /protein_id="AAW89311.1"
FT                   /translation="MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMTT
FT                   TEVDNWPADADGVQGPELMARFLAHAERFGTEIIFDQINAVDLQKRPFALKGDMGEYTC
FT                   DALIVATGASAKYLGLPSEEAFAGKGVSACATCDGFFYKNQDVAVVGGGNTAVEEALYL
FT                   ANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNGALLK
FT                   NNDGSDQQIAVSGIFIAIGHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWA
FT                   AGDVKDHTYRQAITSAASGCQAALDAERWLGSQNI"
FT   gene            569363..569731
FT                   /gene="rpsF"
FT                   /locus_tag="NGO_0581"
FT   CDS_pept        569363..569731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="NGO_0581"
FT                   /product="30S ribosomal protein S6"
FT                   /note="binds cooperatively with S18 to the S15-16S complex,
FT                   allowing platform assembly to continue with S11 and S21"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89312"
FT                   /db_xref="GOA:Q5F925"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F925"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019271790.1"
FT                   /protein_id="AAW89312.1"
FT                   /translation="MRHYEIVFIVHPDQSEQVPAMVERYKTMITEANGKIHRLEDWGRR
FT                   QLAYPINKIHKAHYVLMNIETTPEVVGELETAFRFNDAVLRHLTIKTKHAVTEASPMLG
FT                   GEKAKNLLVGAAEEAAAQ"
FT   gene            569732..570034
FT                   /locus_tag="NGO_0582"
FT   CDS_pept        569732..570034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0582"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89313"
FT                   /db_xref="GOA:Q5F924"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="PDB:3K8A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F924"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003678153.1"
FT                   /protein_id="AAW89313.1"
FT                   /translation="MGFTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQQ
FT                   CLVQLEIPARILGRQAEEWQYRQGDCATVEGFLAQKSRRSLMPMLRIQNIKEYKG"
FT   gene            570041..570271
FT                   /locus_tag="NGO_0583"
FT   CDS_pept        570041..570271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0583"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89314"
FT                   /db_xref="GOA:Q5F923"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F923"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009120066.1"
FT                   /protein_id="AAW89314.1"
FT                   /translation="MARQSFKRRKFCRFTAEKIQEVDYKQVDLLKDFISENGKIIPARI
FT                   TGTKAFYQRQLAVAVKRARFLALLPYTDQHK"
FT   gene            570288..570740
FT                   /locus_tag="NGO_0584"
FT   CDS_pept        570288..570740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0584"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89315"
FT                   /db_xref="GOA:Q5F922"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F922"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A9LZQ0.1"
FT                   /protein_id="AAW89315.1"
FT                   /translation="MQIILLEKIGGLGNLGDIVTVKNGYARNFLIPAGKAKRATEANMK
FT                   EFEARRAELEAKQAEILADARARQEKLDGQTVTVAQKAGVDGRLFGSVTNADIAAAIVA
FT                   AGIEAVKANVRLPNGPLKAVGEYEVEVALHTDAVAKITVAVIAAAE"
FT   gene            570754..570885
FT                   /locus_tag="NGO_03090"
FT   CDS_pept        570754..570885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_03090"
FT                   /product="universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_03090"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63632"
FT                   /db_xref="GOA:A0A0H4J5F4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4J5F4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003703904.1"
FT                   /protein_id="AKO63632.1"
FT                   /translation="MPSETLPIIRMWFQTAFVLFSVYSAKIGTVVFYLPEVFAEMVC"
FT   gene            complement(571363..572169)
FT                   /locus_tag="NGO_0585"
FT   CDS_pept        complement(571363..572169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0585"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89316"
FT                   /db_xref="GOA:Q5F921"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F921"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691331.1"
FT                   /protein_id="AAW89316.1"
FT                   /translation="MWHWDIILILLAVGSAAGFIAGLFGVGGGTLIVPVVLWVLDLQGL
FT                   AQHPYAQHLAVGTSFAVMVFTAFSSMLGQHKKQAVDWKTIFAMMPGMIFGVFAGALSAK
FT                   YIPAFGLQIFFILFLTAVAFKTLHTGRQTASRPLPGLPGLTAVSTLFGAMSSWVGIGGG
FT                   SLSVPFLIHCGFPAHKAIGTSSGLAWPIALSGAISYLVNGLNIAGLPEGSLGFLYLPAV
FT                   AVLSAATIAFAPLGVKTAHKLSSAKLKESFGIMLLLIAGKMLYNLL"
FT   gene            complement(572170..572916)
FT                   /locus_tag="NGO_0586"
FT   CDS_pept        complement(572170..572916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0586"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89317"
FT                   /db_xref="GOA:Q5F920"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F920"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002251375.1"
FT                   /protein_id="AAW89317.1"
FT                   /translation="METPTNTPQRSLRQNSIYLLPNSFTIAALFSAFYAITQSMHGRYE
FT                   TAAIAVFISMLLDGMDGRVARLTNSQSAFGEQLDSLADMVSFGVAPALIAYKWQLWQFG
FT                   KIGYSVAFIYCACAALRLALFNTLIGKVDKRWFIGVPSPTAAALIVGLIWVNHSVEKFP
FT                   AVHWWALGITLFAGLSMIVQIPFWSFKEINIRRQVPFVGMLLAVLLLLLVTWEPSLVLF
FT                   LFFLGYSLSGYIMAARRFWKKYRKAD"
FT   gene            complement(572971..573243)
FT                   /locus_tag="NGO_0587"
FT   CDS_pept        complement(572971..573243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0587"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: gb|AAF41692.1| (AE002480)
FT                   hypothetical protein [Neisseria meningitidis MC58]"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F919"
FT                   /protein_id="AAW89318.1"
FT                   /translation="MQKISFNLLKPTNSLKIGKYRPGLNGAPHIPMPSLRYLPASAEMP
FT                   GNNIHPAKSETTHPVAGRVKPPRKASAIRKTNRLRGLHPKGRIVR"
FT   gene            573500..573982
FT                   /locus_tag="NGO_0588"
FT   CDS_pept        573500..573982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89319"
FT                   /db_xref="InterPro:IPR025240"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F918"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503709.1"
FT                   /protein_id="AAW89319.1"
FT                   /translation="MMKKILAVSALCLMTAAAQAADTYGYLAVWQNPQDANDVLQVKTT
FT                   KEDSAKSEAFAELEAFCKGQDTLAGIAEDEPTGCRSVVSLNNTCVSLAYPKALGAMRVE
FT                   NAVVITSPRFTSVHQVALNQCIKKYGAQGQCGLETVYCTSSSYYGGAVRSLIQHLK"
FT   gene            complement(574029..575240)
FT                   /locus_tag="NGO_0589"
FT   CDS_pept        complement(574029..575240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0589"
FT                   /product="uracil transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89320"
FT                   /db_xref="GOA:Q5F917"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F917"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217051.1"
FT                   /protein_id="AAW89320.1"
FT                   /translation="MNQLKLAVSGAQILFVAFGAMVLVPLLTGLNPALALLGAGLGTLL
FT                   FQITTKRKVPIFLGSSFAFIAPIIYSVGEWGLPSTMFGLFAAGFMYFVFAALIRWRGLA
FT                   AVHKLLPPVVTGPVIMVIGLSVAVAASSMAMGQADGKQVIDYTDSLILSGFTFAVTAIV
FT                   SVFGSRMMKLIPILIGVASGYVLALLMGLVDTTSIAHAPWFAVPHFETPQVNWQAALFM
FT                   LPVAVAPAIEHIGGIMAIGNVTGKDYTKDPGLDKTLAGDGLGVCVAGLIGGPPVTTYGE
FT                   VTGAVMITKNSNPVIMTWAAVFAVCMAFFGKFNAFLASIPMPVMGGIMLLLFGTIASLG
FT                   IKTLIDAKVDLMLPKNLVIVSSVLTTGIGGMTLKLGSFSFVGVGLCAVLAIVLNSLLPD
FT                   PKES"
FT   gene            575462..577900
FT                   /locus_tag="NGO_0590"
FT   CDS_pept        575462..577900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0590"
FT                   /product="cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89321"
FT                   /db_xref="GOA:Q5F916"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F916"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002227264.1"
FT                   /protein_id="AAW89321.2"
FT                   /translation="MTEKSHKKTAKGRAGSPSPTSARNKKADNGARGNKVSERLKAVKE
FT                   LQKTEAKKARPEHVVNLIADALWLMGLAATLYLAISLISFDMGDPSWSHSSPVVEDAAN
FT                   WGGLFGAYVADVGYYLFGWSFWWWIAAACVVLYKNFRLHAKQTENEAYNHKIAAAALFV
FT                   LTVFSPVLEYFVLGGKYADSLPVGAGGMVGIRVGAVFAWLLGKSGSLLIILVVLLLSLS
FT                   LLVQISWLEFLNGAGRAVQNRLSALSGKVMALRKRRPNTKTDGVDTQNTRRMVKEAKNI
FT                   TAKPVALPEGSSSNRKSVAVSVAPPPKIQPSLFEDNEVQQNGEYHKPTLNLLRIPDSEP
FT                   VSINPAELERTAELIESKLAEFGIGVQVVSATSGPVITRYEIEPAQGVKGSQIVALSKD
FT                   LARSMSLQSVRIVETIAGKNTMGIELPNDKRQDVMLSEILSSPVFAEAKSKLTVALGKD
FT                   IAGTPVVGDLAKMPHLLVAGMTGSGKSVGVNGMIMSMLFKATPEEVRFIMIDPKMLELS
FT                   IYDGIPHLLCPVVTDMREAGQALNWCVAEMEKRYRLLSHAGVRNLEGFNQKVEQAKAAG
FT                   KPLLNPFSLNLDEPEPLEKLPMIVVVIDELADLMMTERKAVEQQIARLAQKARAAGIHM
FT                   IVATQRPSVDVVTGLIKANIPTRMAFTVQSKIDSRTILDQMGADELLKYGDSLFLQPGS
FT                   AEPTRLQGTFVSDGEVHQVVNYVKSQAPADYIEGLLSGEAALETANIVNPNADSDELFD
FT                   QAVAYVLESKKTSISSLQRQLRIGYNRAANLMEALENAGIVSPSDLNGSRKILAHKDHL
FT                   "
FT   gene            complement(578101..578550)
FT                   /locus_tag="NGO_03125"
FT   CDS_pept        complement(578101..578550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_03125"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_03125"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63633"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IW24"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017147004.1"
FT                   /protein_id="AKO63633.1"
FT                   /translation="MSTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTRY
FT                   LRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDGPGIPGCSTL
FT                   CRYRKFRYARAAYFGLLKVGVQSHLKAMCLNLLKAANRLSAPAAA"
FT   gene            578775..580085
FT                   /locus_tag="NGO_0592"
FT   CDS_pept        578775..580085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0592"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89322"
FT                   /db_xref="GOA:Q5F915"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F915"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002241657.1"
FT                   /protein_id="AAW89322.2"
FT                   /translation="MSVTVEILENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGFR
FT                   PGKAPLKMIAQMYGASAQNDVINELVQRRFYDVAVAQELKVAGYPRFEGVEEQDDKESF
FT                   KVAAIFEVFPEVVIGDLSAQEVEKVTASVGDAEVDQTVEILRKQRTRFNHVDREARNGD
FT                   RVIIDFEGKIDGEPFAGGTSKNYAFVLGAGQMLPEFEAGVVGMKAGESKDVTVNFPEEY
FT                   HGKDVAGKTAVFTITLNNVSEPTLPEVDADFAKALGIADGDVAKMREEVKKNVSREVER
FT                   RVNEQTKESVMNALIKAVELKVPVALVNEEAARLANEMKQNFVNQGMTDAANLDLPLDM
FT                   FKEQAERRVSLGLILAKLVDENKLEPTEGQIKAVVANFAESYEDPQEVIDWYYADTSRL
FT                   QAPTSLAVESNVVDFVLGKAKVNKKALSFDEVMGAQA"
FT   gene            580181..580795
FT                   /locus_tag="NGO_0593"
FT   CDS_pept        580181..580795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0593"
FT                   /product="Clp protease ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89323"
FT                   /db_xref="GOA:Q5F914"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F914"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9JU33.1"
FT                   /protein_id="AAW89323.1"
FT                   /translation="MSFDNHLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESA
FT                   NLVVAQLLFLESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMG
FT                   AFLLSAGEKGKRFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKH
FT                   CGRDLADLERDTDRDNFMSAEEAKEYGLIDQVLENRASLRL"
FT   gene            complement(580849..582114)
FT                   /gene="ispG"
FT                   /gene_synonym="gcpE"
FT                   /locus_tag="NGO_0594"
FT   CDS_pept        complement(580849..582114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /gene_synonym="gcpE"
FT                   /locus_tag="NGO_0594"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="catalyzes the conversion of 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate into 4-hydroxy-3-methyl-2-en-1-yl
FT                   diphosphate; involved in isoprenoid synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89324"
FT                   /db_xref="GOA:Q5F913"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F913"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014575413.1"
FT                   /protein_id="AAW89324.1"
FT                   /translation="MNTLQRRKTHQVLIDHITVGSEAPVVIQSMTNTDTADAKATALQI
FT                   KELSDAGSEMVRITVNSPEAASKVAEIRRRLDDMGYATPLIGDFHFNGERLLAEFPECG
FT                   KALSKYRINPGNVGKGVKGDEKFAFMIRTAAENDKAVRIGVNWGSLDQSLAKRMMDANL
FT                   VSSAPKPPEEVMKEALIVSALESAEKAVLLGLPEDKIILSCKVSAVHDLIQVYRELGSR
FT                   CVYPLHLGLTEAGMGSKGIVASTAALSVLLQEGIGDTIRISLTPEPGSPRTQEVVVGQE
FT                   ILQTMGLRSFTPMVTACPGCGRTTSTVFQELAQDVQNYLRQKMSIWRTLYPGVESLNVA
FT                   VMGCVVNGPGESKLADIGISLPGTGETPVAPVYVDGERKVTLKGNNIASEFLAIVEEYV
FT                   KTNYGKNSSKRNKGKVIPIQSL"
FT   gene            complement(582130..582891)
FT                   /locus_tag="NGO_0595"
FT   CDS_pept        complement(582130..582891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0595"
FT                   /product="pilus assembly protein PilW"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89325"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013360"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F912"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002240575.1"
FT                   /protein_id="AAW89325.1"
FT                   /translation="MPFKPSKRISLLLVLALGACSTSYRPSRAEKANQVSNIKTQLAME
FT                   YMRGQDYRQATASIEDALKSNPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSA
FT                   EINNNYGWFLCGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLAEAY
FT                   LKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKKYQSRVEVLQADDLLLGWKIAKA
FT                   LGNVQAAYEYEAQLQANFPYSEELQTVLTGQ"
FT   gene            complement(582894..583988)
FT                   /locus_tag="NGO_0596"
FT   CDS_pept        complement(582894..583988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0596"
FT                   /product="50S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89326"
FT                   /db_xref="GOA:Q5F911"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F911"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F911.1"
FT                   /protein_id="AAW89326.1"
FT                   /translation="MKTNLLNYDLQGLTRHFADMGEKPFRAKQVMRWMHQSGAQNFDEM
FT                   TDLAKSLRHKLNEQASIEIPKLMMSQESSDGTRKWLLDVGTGNGVETVFIPESDRGTLC
FT                   ISSQVGCALECTFCSTGRQGFNRNLTAAEIIGQLWWANKAMGVTPKNERVISNVVMMGM
FT                   GEPMANFDNVVTALSIMLDDHGYGLSRRRVTVSTSGMVPQMDRLRDVMPVALAVSLHAS
FT                   NDEVRNQIVPLNKKYPLKELMAACQRYLVKAPRDFITFEYVMLDGVNDKAQHAYELIEL
FT                   VKDVPCKFNLIPFNPFPNSGYERSSNENIRIFRDILQQAEFVVTVRKTRGDDIDAACGQ
FT                   LAGQVQDKTRRQQKWQQILIGQQG"
FT   gene            complement(584132..584443)
FT                   /locus_tag="NGO_0597"
FT   CDS_pept        complement(584132..584443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0597"
FT                   /product="putative nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="Best Blastp Hit: pir||A81098 nucleoside diphosphate
FT                   kinase (EC 2.7.4.6) NMA1521 [imported] - Neisseria
FT                   meningitidis (group B strain MD58, group A strain Z2491)
FT                   >gi|7226548|gb|AAF41682.1| (AE002479) nucleoside
FT                   diphosphate kinase [Neisseria meningitidis MC58]
FT                   >gi|7380163|emb|CAB84749.1| (AL162756) nucleoside
FT                   diphosphate kinase [Neisseria meningitidis]; COG0105
FT                   Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89327"
FT                   /db_xref="GOA:Q5F910"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F910"
FT                   /protein_id="AAW89327.1"
FT                   /translation="MKQLTLKEAQEFYAVHKDRPFYAGLVEFMTGGPVMIQVLEGENAV
FT                   LKNRELMGATNPTEAAEGTIRADFATSVSINAVHGSDSVENAALEIAYFFSQTEICPR"
FT   gene            complement(584616..585767)
FT                   /locus_tag="NGO_0598"
FT   CDS_pept        complement(584616..585767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0598"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89328"
FT                   /db_xref="GOA:Q5F909"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F909"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003688944.1"
FT                   /protein_id="AAW89328.1"
FT                   /translation="MNNRDQLFKAPPFENHSPLTWYQAASQLPNFIRDDAQAAAIEHLD
FT                   RLWTELMMFKRKRNRFLGRSLRSPQVPKGLYFYGGVGRGKSFLMDAFFGCLPYRRKRRV
FT                   HFHAFMAEIHRRLKALKSESNPLKSVAAEITKETRVLCFDEFHVSDIADAMILGRLLEN
FT                   LLNEGVVLVATSNYAPSELYPQGQNRSGFLPTIALIESSLTVLNVDGGEDYRLRTLRPA
FT                   EIFFTPANEENEAKLAKLFKEMTGITDLNPGISTIHGREIPHKAESGRTIWFDFRALCF
FT                   SPRSQSDYLYLAEHYEMVFISGLEQLSPQEKAEARRLTWLIDVLYDFRVKLCATGAVDV
FT                   NHIYTEGDFAEEFTRTASRMVEMQSEVYLEQPHLTLSPKASGG"
FT   gene            complement(586297..587124)
FT                   /locus_tag="NGO_0600"
FT   CDS_pept        complement(586297..587124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0600"
FT                   /product="S-formylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89329"
FT                   /db_xref="GOA:Q5F908"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F908"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_011961786.1"
FT                   /protein_id="AAW89329.2"
FT                   /translation="MKLIEQHQIFGGSQQVWAHHAQTLQCEMKFAVYLPDNPENQPLGV
FT                   IYWLSGLTCTEQNFITKSSFRRYAAEHQVVVVAPDTGPRGEQVPNGAAYDLGQGAGFYL
FT                   NATEQPWAANYQMYDYILNELPRLIEEHFPTNGKRSIMGHSMDGHGALVLALRNREHYQ
FT                   SVSAFSPILSPSLVPWGEKAFTAYLGKDREKWQQYDANSLIQQGYKVQGMRIDQGLEDE
FT                   FLPTQLRTKDFIETCRAANQPIDVRFHKGYDHSYYFIASFIGEHIAYHAAFLK"
FT   gene            complement(587133..588270)
FT                   /pseudo
FT                   /locus_tag="NGO_03170"
FT                   /note="S-(hydroxymethyl)glutathione dehydrogenase;
FT                   disrupted"
FT   gene            588393..588800
FT                   /locus_tag="NGO_0602"
FT   CDS_pept        588393..588800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0602"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89330"
FT                   /db_xref="GOA:Q5F907"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F907"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217064.1"
FT                   /protein_id="AAW89330.1"
FT                   /translation="MTYTTAKAAEKIGISAHTLRFYDKEGLLPNIGRDEYGNRCFTDND
FT                   LQWLYLLQCLKNTGMSLKDIKRFAECTVIGDDTIEERLSLFENQIENVKCQIAELKRYL
FT                   DLLEYKLAFYQKAKALGSVKAVNLPQIPETA"
FT   gene            complement(588996..589310)
FT                   /locus_tag="NGO_0603"
FT   CDS_pept        complement(588996..589310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0603"
FT                   /product="integration host factor subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89331"
FT                   /db_xref="GOA:Q5F906"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F906"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009173290.1"
FT                   /protein_id="AAW89331.2"
FT                   /translation="MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARG
FT                   QRIEIRGFGSFDLNHRPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN
FT                   "
FT   gene            complement(589321..591006)
FT                   /gene="rpsA"
FT                   /locus_tag="NGO_0604"
FT   CDS_pept        complement(589321..591006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="NGO_0604"
FT                   /product="30S ribosomal protein S1"
FT                   /note="in Escherichia coli this protein is involved in
FT                   binding to the leader sequence of mRNAs and is itself bound
FT                   to the 30S subunit; autoregulates expression via a
FT                   C-terminal domain; in most gram negative organisms this
FT                   protein is composed of 6 repeats of the S1 domain while in
FT                   gram positive there are 4 repeats; the S1 nucleic
FT                   acid-binding domain is found associated with other
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89332"
FT                   /db_xref="GOA:Q5F905"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F905"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010361606.1"
FT                   /protein_id="AAW89332.1"
FT                   /translation="MSMENFAQLLEESFTLQEMNPGEVITAEVVAIDQNFVTVNAGLKS
FT                   ESLIDVAEFKNAQGEIEVKVGDFVTVTIESVENGFGETKLSREKAKRAADWIALEEAME
FT                   NGNILSGIINGKVKGGLTVMISSIRAFLPGSLVDVRPVKDTSHFEGKEIEFKVIKLDKK
FT                   RNNVVVSRRAVLEATLGEERKALLENLQEGSVIKGIVKNITDYGAFVDLGGIDGLLHIT
FT                   DLAWRRVKHPSEVLEVGQEVEAKVLKFDQEKQRVSLGMKQLGEDPWSGLTRRYPQATRL
FT                   FGKVSNLTDYGAFVEIEQGIEGLVHVSEMDWTNKNVHPSKVVQLGDEVEVMILEIDEGR
FT                   RRISLGMKQCQANPWEEFAANHNKGDKISGAVKSITDFGVFVGLPGGIDGLVHLSDLSW
FT                   TESGEEAVRKYKKGEEVEAVVLAIDVEKERISLGIKQLEGDPFGNFISVNDKGSLVKGS
FT                   VKSVDAKGAVIALSDEVEGYLPASEFAADRVEDLTTKLKEGDEVEAVIVTVDRKNRSIK
FT                   LSVKAKDAKESREALNSVNAAANANAGTTSLGDLLKAKLSGEQE"
FT   gene            complement(591159..591815)
FT                   /locus_tag="NGO_0605"
FT   CDS_pept        complement(591159..591815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0605"
FT                   /product="cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89333"
FT                   /db_xref="GOA:Q5F904"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F904"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015815646.1"
FT                   /protein_id="AAW89333.1"
FT                   /translation="MNRQKVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLTALY
FT                   AQKQGVEWHDEENVSALAKKLPAVFSGNRILLDGEDVSDGIRTEAIGMGASAVAQWPKV
FT                   RAALLQRQRDFLTEKGLVADGRDTGSVVFPQAELKIFLTAESKIRAERRAKQIGIPCEG
FT                   FTFERILSDIETRDEADRNRKVAPLKQQPDALLLDTSRLTIEETVKKVLDWYRKV"
FT   gene            complement(592048..593418)
FT                   /locus_tag="NGO_0606"
FT   CDS_pept        complement(592048..593418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0606"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89334"
FT                   /db_xref="GOA:Q5F903"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F903"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003688931.1"
FT                   /protein_id="AAW89334.1"
FT                   /translation="MSSPSNTNRQTWSSRLTYILTVAGATVGFGATWRFPYLVGENGGG
FT                   AYVFLFCIAMLVIGIPMILVENVIGRRKGVNALDAFGGPMNGKPVAKIWKLVGRMGLLG
FT                   AFGIMAYYMVLGGWVISYIVNIIGGNLNISSPVDGVVTKGFFTEHIENSPWEIASYTLL
FT                   FVAVNQWILVKGVIGGIEKTAKYLMPLLFLFLIAMVVRNVTLPGAMEGVAFYLKPDFSK
FT                   ITAELFVFVLGQVFFALSLGFGVMITLSSYLDKNENLVQTAVITAITNTIIAVLAGFMI
FT                   FPSLFSFGVAPNSGPTLVFQSLPIVFSHMWAGPVFAVIFFSLLLIAALTTSLTIYEVLI
FT                   TTIQEKTKIRRTAAITIVLSVIFVFGNIPSILSYGPWKDVSVFGKNIFDAFDYISGNIL
FT                   FMLTALGSALFVGFVMKDEAKEELLYKGNHTTVNIWFAYVKYLVPLVILLIFVSNLF"
FT   gene            complement(593892..594584)
FT                   /locus_tag="NGO_0607"
FT   CDS_pept        complement(593892..594584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0607"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89335"
FT                   /db_xref="GOA:Q5F902"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F902"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002220881.1"
FT                   /protein_id="AAW89335.1"
FT                   /translation="MKLIKYLQYQGIGSRKQCQWLIRGGYVSINGTCMDDTDADIDSSY
FT                   VETLDIDGEAVTVVPEPYFYILLNKPEDYETSHKPKHYRSVFSLFPDNMRNIDMQAVGR
FT                   LDADTTGVLLITNDGKLNHNLTSPSRKIPKLYEVTLKHPTGETLCETLKNGVPLHDENE
FT                   TVCAADAVLENPTTLLLTITEGKYHQVKRMVAAAGNRVQHLHRRRFAHLETENLKPGEW
FT                   KFIECPKF"
FT   gene            complement(594652..596628)
FT                   /locus_tag="NGO_0608"
FT   CDS_pept        complement(594652..596628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0608"
FT                   /product="murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89336"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F901"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002251371.1"
FT                   /protein_id="AAW89336.1"
FT                   /translation="MSKLKTIALTASGLSVCPGFLYAQNTSSHQVGLAIMRLNSSILDL
FT                   PPTKQYFQSGSLWDELRQGFRMGEVNPELVRRHESKFIASRSYFDRVVNRSRPYMYHIA
FT                   NEVKKRNMPAEAALLPFIESAFVTKAKSHVGASGLWQFMPATGRHYGLEKTPVYDGRHD
FT                   VYAATDAALNYLQYLYGLFGDWPLAFAAYNWGEGNVGRAVNRARDQGLEPTYENLRMPN
FT                   ETRNYVPKLLAVRNIIATPQSFGMNISDIDNKPYFQAVEPGRPLDNEAIARLAGITQSE
FT                   LLALNPAFNVPAFIPKNKRKLLLPVASVQTFQSNYLNAAPDSLFSWEVYTPAAKTSLSD
FT                   ISTATGMSIADIKRLNNLNGNLVNAGRSILVAKNGKTLHTASESVVSIDIDNTPDTYRS
FT                   NMPAGTVNVSIARIQPAAAQTADITVAPLPQETVRTEPDPLVRITEPALATAAAQPQTE
FT                   KQTAMPSETQTATLAQVIPPNDMQAADELMQLVARNNLRRQAEETISAVIGTPDTVAEH
FT                   NISSSPQHTVAADGKRRARLETRVAKAADGEAETSPLHASIHRVVEGDTLFNIAKRYNV
FT                   SVADLIVANNIKGNTIQKGQVLRLAQAAPAQTRIEKVSYTARKGDTFKSIAARFNIHID
FT                   DIRRLNPNLNTINPGQRVKLIGS"
FT   gene            596807..597472
FT                   /locus_tag="NGO_0609"
FT   CDS_pept        596807..597472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0609"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89337"
FT                   /db_xref="GOA:Q5F900"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F900"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002237986.1"
FT                   /protein_id="AAW89337.1"
FT                   /translation="MDAWFEDTAMGRYVAKLEQDFFNRYVASYRFSGMCAVQVGGQWLS
FT                   LSEDIVCVPRDMSMSAENMALADVFADMLLLPHTLECGVPSQILSEAHRILKPSGRLML
FT                   TGFNPYSLWGFCRWFDGVRLPEKRFCLPLPELKRQLADAGFDIEFGKFMVYLPPVSSLG
FT                   QIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAWDGYWGGKALAAGAARVAD"
FT   gene            597525..598352
FT                   /locus_tag="NGO_0610"
FT   CDS_pept        597525..598352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0610"
FT                   /product="5-hydroxymethyluracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89338"
FT                   /db_xref="GOA:Q5F8Z9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8Z9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002255798.1"
FT                   /protein_id="AAW89338.1"
FT                   /translation="MPELPEVETTLRGIAPHIEGKTVEAVILRQLKLRWQINPDLGEIL
FT                   SGRQVLSCGRRAKYLIVRFQTGILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSD
FT                   GTVMRYRDPRKFGAILWYEGIEERHPLLEKLGPEPLSEAFCTDYLYAGLKAQKRAVKLA
FT                   LMDNTVVVGVGNIYANESLFRAGISPHRPANRLKKKECAVLVETVKAVLQRAIETGGST
FT                   LRDFVDSDGKSGYFQQEYTVYGRHNQPCLRCGGLVVKETLGQRGTFYCTNCQK"
FT   gene            598440..599207
FT                   /locus_tag="NGO_0611"
FT   CDS_pept        598440..599207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0611"
FT                   /product="acyl-phosphate glycerol 3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89339"
FT                   /db_xref="GOA:Q5F8Z8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Z8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q59601.1"
FT                   /protein_id="AAW89339.1"
FT                   /translation="MSSNKASFFTRLRRLCRLTVWLFKTGKNLRGIDGGCPKSRNRAVI
FT                   ALGKGALAALDIGLEVGRPAPEHPNGVLVAANHVSWLDIFAMSAVYPSSFIAKQEIKSW
FT                   PVLGKMGQNAGTVFINRNSRRDIEPINRAVCETLQRGQNVSFFPEARTSSGLGLLPFKA
FT                   ALFQSAIDAGAKVLAVALRYYDETGKRTARPSYADVGLPTCLWRIVSMKKLTIKVDFVC
FT                   VADAAESEDRYALKDKIEESIRAVVAGDADVAV"
FT   gene            complement(599470..599781)
FT                   /locus_tag="NGO_0613"
FT   CDS_pept        complement(599470..599781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0613"
FT                   /product="stress response protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Z7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002229534.1"
FT                   /protein_id="AAW89340.1"
FT                   /translation="MLAILLSAILGLVSTTAAAGTSEPAHRHTKHISKANKQMLHPECR
FT                   KYLERRAAWYRSQGNVQELRENKKARKAFRTLPYAEQKIQCRAAYEAFDDFDGGRFRR"
FT   gene            600312..602591
FT                   /locus_tag="NGO_0614"
FT   CDS_pept        600312..602591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0614"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /EC_number="1.17.4.1"
FT                   /note="Catalyzes the rate-limiting step in dNTP synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89341"
FT                   /db_xref="GOA:Q5F8Z6"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Z6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503701.1"
FT                   /protein_id="AAW89341.1"
FT                   /translation="MNTPTDLKVTKRDGRLEAIDLDKIHRVVTWAAEGLENVSVSQVEL
FT                   KSHIQFYNGIRTDDIHETIIKAAADLISEDTPDYQYLAARLAIFHLRKIAYGEYEPPHL
FT                   YNHVKKLTDAGKYDRHILEDYSREEFDELNAYIDHERDMSFSYAAVKQLEGKYLVQNRV
FT                   TRQIYETPQFLYVLVAMCLFSKYPKEARLDYVKRFYDAVSTFKVSLPTPIMSGVRTPTR
FT                   QFSSCVLIECDDSLDSINATTSAIVKYVSQRAGIGINAGRIRGLDSEIRGGEARHTGCI
FT                   PFFKMFQAAVKSCSQGGVRGGAATLFYPLWHIEAESLLVLKNNRGVEDNRIRQLDYGVQ
FT                   INRLLYTRLIKGGNITLFSPNEVSGLYEAFFADQDEFERLYTKYEQDPNIRKRIIPAAD
FT                   LFSTLMQERAGTGRIYIQNVDHCNTHSPFDPRVAPVHQSNLCMEIALPTKPLDNINDPD
FT                   GEIALCTLSAFNLGALNSLDELEGLADLTVRALDALLDYQGYPVEAARTSTMDRRSLGI
FT                   GVINYAYYLAKNGVRYSDGSALGLTHRTFEAIQYYLLKASANLAKEYGACTLFNQTVYS
FT                   QGKLPIDTYKKDLDAVCGEPLHYDWESLRADIVKYGLRNSTLTALMPSETSSQIANATN
FT                   GIEPPRGLVTVKASKDGILKQVVPEFETLKNAYETLWQLPGNEGYLKLVGVMQKFVDQA
FT                   ISANTAYDPGKFEGNKVSMKQMLKDLLTAYKYGVKTLYYHNTRDGADDTQTDIQDDGCA
FT                   GGACKI"
FT   gene            602883..604037
FT                   /locus_tag="NGO_0615"
FT   CDS_pept        602883..604037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0615"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /EC_number="1.17.4.1"
FT                   /note="B2 or R2 protein; type 1a enzyme; catalyzes the
FT                   rate-limiting step in dNTP synthesis; converts nucleotides
FT                   to deoxynucleotides; forms a homodimer and then a
FT                   multimeric complex with NrdA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89342"
FT                   /db_xref="GOA:Q5F8Z5"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Z5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017628972.1"
FT                   /protein_id="AAW89342.1"
FT                   /translation="MSCEHLVMSYSTFPKTKNDALKEPMFFGQPVNVARYDQQKYEVFE
FT                   KLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALL
FT                   PLVSIPELETWVETWSFSETIHSRSYTHIIRNIVNDPSVVFDDIVENEYITARAEDIAC
FT                   YYDDLIEYTQYYNLLGEGVHNVGGKPVTVSLRGLKKKLYLCLMCVNVLEAIRFYVSFAC
FT                   SFAFAERELMEGNAKIIKLIARDEALHLTGTQHMLNLMRSGVDDPEMAEIAAELQDECF
FT                   QLFKKAAEQEKEWAAYLFKDGSMIGLNKEILSQYVEYITNLRMQAVGLPAGFEGANQNP
FT                   IPWINAWLSSDNVQVAPQEVEISSYLIGQIDSEVNTDDLGDFEL"
FT   gene            604158..604448
FT                   /locus_tag="NGO_6151"
FT   CDS_pept        604158..604448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_6151"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_6151"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89343"
FT                   /db_xref="GOA:Q5F8Z4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Z4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002260650.1"
FT                   /protein_id="AAW89343.1"
FT                   /translation="MARIGTNKGLFELLEGETLLEGLERTGHMVEYQCRSGYCGSCRVK
FT                   ILEGSVTYREPPLAFLGRDEILPCCCCVEGDVRLDCGLAGEDEGLSDSLLK"
FT   gene            complement(604489..604767)
FT                   /locus_tag="NGO_0616"
FT   CDS_pept        complement(604489..604767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0616"
FT                   /product="cell division protein FtsB"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89344"
FT                   /db_xref="GOA:Q5F8Z3"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8Z3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003752666.1"
FT                   /protein_id="AAW89344.1"
FT                   /translation="MKWVTVVLSFALVCCQYSLWFGKGSIGRNSSLREQIAVQEEKNQT
FT                   LALRNHSLAAEVYDLENGQEAISEIARVELGYIQDGETFYRLIRHNR"
FT   gene            complement(604935..606221)
FT                   /gene="eno"
FT                   /locus_tag="NGO_0617"
FT   CDS_pept        complement(604935..606221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="NGO_0617"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="catalyzes the formation of phosphoenolpyruvate from
FT                   2-phospho-D-glycerate in glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89345"
FT                   /db_xref="GOA:Q5F8Z2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8Z2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019270954.1"
FT                   /protein_id="AAW89345.1"
FT                   /translation="MSAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQ
FT                   KEALELRDGDKSRYSGKGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKG
FT                   NLGANATLAVSMAVARAAAEDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQ
FT                   EFMIMPVGAKSFREALRCGAEIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLM
FT                   VEAAEAAGYKAGEDVLFALDCASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPI
FT                   ISIEDGMDENDWEGWKLLTEKLGKKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQ
FT                   IGTLSETLKAVDLAKCNRYASVMSHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMA
FT                   KYNQLLRIEEELAEAAYYPGKAAFYQLGK"
FT   gene            complement(606268..606708)
FT                   /locus_tag="NGO_0618"
FT   CDS_pept        complement(606268..606708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0618"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89346"
FT                   /db_xref="GOA:Q5F8Z1"
FT                   /db_xref="InterPro:IPR025423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Z1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219190.1"
FT                   /protein_id="AAW89346.1"
FT                   /translation="MMQTFRKISLYAATLWLGMQIMAGYIAAPVLFKMLPKMQAGEIAG
FT                   VLFDILSWSGLAVWGTVLAAAFAALTRRQTALLLFLLSALAANQFLVTPVIEALKYGHE
FT                   NWLLSVAGGSFGMWHGISSMTFMATALLSAVLSWRLSGKEAV"
FT   gene            complement(606723..607565)
FT                   /locus_tag="NGO_0619"
FT   CDS_pept        complement(606723..607565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0619"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="catalyzes the formation of
FT                   2-dehydro-3-deoxy-D-octonate 8-phosphate from
FT                   phosphoenolpyruvate and D-arabinose 5-phosphate in LPS
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89347"
FT                   /db_xref="GOA:Q5F8Z0"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8Z0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003752673.1"
FT                   /protein_id="AAW89347.1"
FT                   /translation="MDIKINDITLGNNSPFVLFGGINVLEDLDSTLQTCAHYVEVTRKL
FT                   GIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAE
FT                   VCDVIQLPAFLARQTDLVAAMAETGNVINIKKPQFLSPSQMKNIVEKFREAGNGKLILC
FT                   ERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRDAGSAASGGRRAQALDLA
FT                   LAGMATRLAGLFLESHPDPKLAKCDGPSALPLHLLENFLIRIKALDDLIKSQPILTIE"
FT   gene            complement(607587..607970)
FT                   /locus_tag="NGO_0620"
FT   CDS_pept        complement(607587..607970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0620"
FT                   /product="aspartate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89348"
FT                   /db_xref="GOA:Q5F8Y9"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8Y9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019273380.1"
FT                   /protein_id="AAW89348.1"
FT                   /translation="MFRTILGGKIHRATVTEADLNYVGSITVDQDLLDAAGICPNEKVA
FT                   IVNNNNGERFETYTIAGKRGSGVICLNGAAARLVQKGDIVIIMSYIQLSEPEIAAHEPK
FT                   VVLVDGNNKIRDIISYEPPHTVL"
FT   gene            complement(608132..608434)
FT                   /locus_tag="NGO_0621"
FT   CDS_pept        complement(608132..608434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89349"
FT                   /db_xref="InterPro:IPR018546"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Y8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951091.1"
FT                   /protein_id="AAW89349.1"
FT                   /translation="MDAFAAFLSELEKADDAARAALTEYLKRDSRYIDFHTEDTQTSRD
FT                   AAKFVRTMQLIYISLWAKNPAFAVMDYMPANIESDEILAVKLHLDGSIFSIDWES"
FT   gene            complement(608468..608587)
FT                   /locus_tag="NGO_0622"
FT   CDS_pept        complement(608468..608587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89350"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Y7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003703921.1"
FT                   /protein_id="AAW89350.1"
FT                   /translation="MSIFHPYFQQLSTEGFDGEEDVLWEDELTVKGNLVEVFL"
FT   gene            complement(608660..612364)
FT                   /locus_tag="NGO_0623"
FT   CDS_pept        complement(608660..612364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0623"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89351"
FT                   /db_xref="GOA:Q5F8Y6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Y6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003692981.1"
FT                   /protein_id="AAW89351.1"
FT                   /translation="MTCPIPKPREKSRWFNLSQGSLPLALARYLPHKRLKAVLTQDAEQ
FT                   ALRLQTAWRFFRPHDTAVFLPDWETLPYERFSPHQDLVSERLSALWQIKSGAADVLFVP
FT                   VATAMQKLPPVPFLAGRTFWLKTGQTLDIGRLKTDLVDAGYNHVSHVVAAGEFAVRGGI
FT                   VDLFPMGSETPYRIDLFDDEIDSIKTFDTDTQRTISPVSEIRLLPAHEFPTDSEAQKIF
FT                   RSRFREEVDGNPNDAAVYKAVSNGHFGAGVEYYLPLFFENELETLFDYIGEDALFVSLG
FT                   DVHAEANRFWNDVKSRYAMAQGDETYPPLLPQHLYLSADVFAGRLKNYGQVLPDVSGKA
FT                   HSLPDLAVNRQSDDPLQALKDFQTAFDGRILLCAESLGRRETMLGFLQQNGLKAKPVSD
FT                   WQGFLSAHEPLMITVAPLAYGFKLGGLQSSSQQQTVPASEGEGKAVTDQTEFSASATNP
FT                   LPSPLPQEREQSAAAVSDGLKAAAVSTESSLYLVASDLHGQTRQQSAPSPVGEGWGEGK
FT                   AVAAQSAIAVITESDLYQYVARSRVHNRRKKHAAVSDGLLRDLAEINIGDPVVHEEHGI
FT                   GRYTGLVTMDLGGETNEMMLLEYAGEAQLYVPVSQLHLISRYSGQAHESVALHKLGSGA
FT                   WNKAKRKAAEKARDTAAELLNLYAQRAAQSGHKFEINESDYQAFADGFGYEETEDQAAA
FT                   IAAVIKDLTQAKPMDRLVCGDVGFGKTEVALRAAFVAVMGGKQVAVLAPTTLLVEQHAQ
FT                   NFADRFADFPVKVASLSRFNNSKATKATLEGMADGTVDIVIGTHKLVQDDIKFKNLGLL
FT                   IIDEEHRFGVRQKEQLKRLRANVDILTMTATPIPRTLSMALEGLRDFSLITTAPSRRLA
FT                   VKTFVKPFSEGSVREAVLRELKRGGQVFFLHNEVDTIENMRERLETLLPEARIGVAHGQ
FT                   LRERELEQVMRDFLQQRFNVLLCSTIIETGIDIPNANTIIINRADKFGLAQLHQLRGRV
FT                   GRSHHQAYAYLLTPEYITKDAEKRLDAIAAADELGAGFTLAMQDLEIRGAGEILGEGQS
FT                   GEMMQVGFTLYTEMLKQAVRDLKKGRQPDLDAPLGITTEIKLHSPALLPEDYCPDIHER
FT                   LVLYKRLAVCETVQKINAIHEELVDRFGLTEQPVKTLIESHHLRLAAKELGIDAIDATS
FT                   EAVTVTFGKHHCIDPTGIILLIQTDKKYRLAGADKLRFAAEMENIEVRINTVKTVLKTL
FT                   QGKRLPKGN"
FT   gene            612585..613976
FT                   /locus_tag="NGO_0624"
FT   CDS_pept        612585..613976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0624"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89352"
FT                   /db_xref="GOA:Q5F8Y5"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Y5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002217082.1"
FT                   /protein_id="AAW89352.2"
FT                   /translation="MDTAAFLKHIESAFRRIFSDGIDLMRYLPEDKWLALKQAGLLLPF
FT                   LDKKHGGRKGSQFEIQEVLRIAGHYGVPVTLRTGIEGALVLQPLQEFGGEAQVAQGLDM
FT                   IFKGEGGGLGVTEPETSGAAIAREMQSCYEYTDEQTIYVNAAKYWQGNSQSDFLLVAAK
FT                   ERKNGKLAKVIDLLLVPKTYIRCETLASEGLRAVRYAVNRIDAEMPATAVMKLSRGDAA
FT                   GLRAFQNIFIRSRLQLIGMTHGIMEYILDNLNRYVRNDIRFVDYERREIQRRHQVSEIL
FT                   YRYVCHSVSPVAPVAHQLMEANIVKTLATEYTYAAAQMLQKLLGAKGFERGHPAGNIAI
FT                   DIRPFTIFEGPNDMLYAEIYDQFVRATAEEKEAGIKLDKNQTLLDRLQTDVRFAAVARD
FT                   YALPEDIRSFLQEHTLTDACALQKVFIGKIIARLFVFVQEEHEDTTAFLLNDIRKDILD
FT                   CRYCG"
FT   gene            613967..614215
FT                   /locus_tag="NGO_0625"
FT   CDS_pept        613967..614215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89353"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Y4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503696.1"
FT                   /protein_id="AAW89353.1"
FT                   /translation="MRIAGKYGGRQISGGAKGNARHSAKPPIAADTAFRASPLCRFPTY
FT                   PICSECVYGKEKNTAAGNLFGGFVCLYGDGGPHTPGK"
FT   gene            614124..615215
FT                   /locus_tag="NGO_0626"
FT   CDS_pept        614124..615215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0626"
FT                   /product="murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89354"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Y3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003688898.1"
FT                   /protein_id="AAW89354.1"
FT                   /translation="MEKRKILPLAICLAALSACTAMEARTPRANEAQAPRADEMKKESR
FT                   PAFDAAAVPVSDSGFAANANVRRFVDDEVGKGDFSQAEWQDFFDKAAYKADIVKIMHRP
FT                   STSRPWYVFRTGNSGRAKFHGARRFYAENRAVIDDVAQKYGVPAELIVAIIGIETNYGK
FT                   NTGSFRVADALATLGFDYPRRAGFFQKELVELLKLAKEEGGDVFAFKGSYAGAMGMPQF
FT                   MPSSYRKWAVDYDGDGHRDIWGNVGDVAASVANYMKQHGWRTGGKMLVSATLAPGADVQ
FT                   AIIGEKTALTRTVADLKAYGIIPGETLADDEKAVLFKLETAPGVFEYYLGLNNFYTVWQ
FT                   YNHSRMYVTAVRDIANSLGGPGL"
FT   gene            complement(615338..617344)
FT                   /locus_tag="NGO_0627"
FT   CDS_pept        complement(615338..617344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0627"
FT                   /product="recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89355"
FT                   /db_xref="GOA:Q5F8Y2"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Y2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017628975.1"
FT                   /protein_id="AAW89355.1"
FT                   /translation="MADMKKITPQNLRPLLSESLGHTDFVNVLNALIKFLRRGGKKCAG
FT                   ERFDLIIDTFKQDRELLSRFSRCFYIWLAQIHIYPALIKLGIFSRHSFAREMGIRIYER
FT                   FNPSYKDFANLGEVFLYLFHSENDDKWLQTLNIRQWLVLYELIRSHAEPSKLQTAGIRL
FT                   ADARLRAIEMLSVWTASEAIEPDLIRIAPRLLEADSSFVALQRETAKLVEHYRNGTAPY
FT                   DTAHLEVMFDQCFSQIDYLRRKGTGAGSGSSVKVAHLLERLRQTVGRLKLLTDIQTGAG
FT                   NSNRLTIALMNSLIYAAVEQYSTRHLRRSSIRMLARSITENKSHHGEHYITRNRKEYFK
FT                   MFYSAAGGGGIIALMALLKIRIGTLDLSPFLASLSAGFNYGIGFMIIHMLHCTVATKQP
FT                   AMTAASFAEQVDLNEGGKAVDNKLSKLLIDVCRSQSVAVFGNVSIAILLACAISFGYAH
FT                   LYRLPILDAHTAAYQFKSIDIINHPTLWYAAIAGLWLFCSGIIAGFFDNRADYLNLRQR
FT                   LPFNPLLRKIMRPGPRRVLAAYIHKHYGSLVGNFIFGMLLGMTGYFGHLLGLPLDIRHV
FT                   AFSSANLGYAAVSGNVGFGTFVLGIFSVLAIGLVNLCVSFSLALFVALRSRGTKIGSIR
FT                   NLIKSFWNQIKSNPCILFLPPAKGQGHPPSDKP"
FT   gene            617567..618220
FT                   /locus_tag="NGO_0628"
FT   CDS_pept        617567..618220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0628"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89356"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F549"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010951225.1"
FT                   /protein_id="AAW89356.1"
FT                   /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFYR
FT                   KIRTVANHRLALAADGVFEGPAGPGGSYFGGRRKGRRGRGAAGKAVVFGIPKRNGRAYT
FT                   VAADNAEPETLPPAVKKKIMPDGIVYADSPGSRGKLDAGGFTRCRINRSKEFADRRNHI
FT                   NGIGDFWNQAKRALRKYNGIDRKPFPPFLRECEFRLNFGTPSRQLKILRDRCGI"
FT   gene            complement(618439..621189)
FT                   /locus_tag="NGO_0629"
FT   CDS_pept        complement(618439..621189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0629"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89357"
FT                   /db_xref="GOA:Q5F8Y0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8Y0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003697169.1"
FT                   /protein_id="AAW89357.1"
FT                   /translation="MTDATIRHDHKFALETLPVSLEDEMRKSYLDYAMSVIVGRALPDV
FT                   RDGLKPVHRRVLYAMHELKNNWNAAYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQNF
FT                   AMRYVLIDGQGNFGSVDGLAAAAMRYTEIRMAKISHEMLADIEEETVNFGPNYDGSEHE
FT                   PLVLPTRFPTLLVNGSSGIAVGMATNIPPHNLTDTINACLRLLDEPKTEIDELIDIIQA
FT                   PDFPTGATIYGLGGVREGYKTGRGRVVIRGKTHIEPIGKNGEREAIVIDEIPYQVNKAK
FT                   LVEKIGDLVREKTLEGISELRDESDKSGMRVVIELKRNENAEVVLNQLYKLTPLQDSFG
FT                   INMVVLVDGQPRLLNLKQILSEFLRHRREVVTRRTLFRLKKARHEGHIAEGKAVALSNI
FT                   DEIIKLIKESPNAAEAKEKLLARPWRSSLVEEMLTRSGLDLEMMRPEGLAANIGLKKQG
FT                   YYLSEIQADAILRMSLRNLTGLDQKEIIESYKNLMGKIIDFVDILSKPERITQIIRDEL
FT                   EEIKTNYGDERRSEINPFGGDIADEDLIPQREMVVTLTHGGYIKTQPTTDYQAQRRGGR
FT                   GKQAAATKDEDFIETLFVANTHDYLMCFTNLGKCHWIKVYKLPEGGRNSRGRPINNVIQ
FT                   LEEGEKVSAILAVREFPEDQYVFFATAQGMVKKVQLSAFKNVRAQGIKAIALKEGDYLV
FT                   GAAQTGGADDIMLFSNLGKAIRFNEYWEKSGNDEAEDADIETEISDDLEDETADNENTL
FT                   PSGKNGVRPSGRGSGGLRGMRLPADGKIVSLITFAPETEESGLQVLTATANGYGKRTPI
FT                   ADYSRKNKGGQGSIAINTGERNGDLVAATLVGETDDLMLITSGGVLIRTKVEQIRETGR
FT                   AAAGVKLINLDEGETLVSLERVAEDESELSGASVISNVTEPEAEN"
FT   gene            complement(621287..621640)
FT                   /locus_tag="NGO_0630"
FT   CDS_pept        complement(621287..621640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0630"
FT                   /product="putative chaperone protein HscB"
FT                   /note="Best Blastp Hit: gb|AAF62332.1| (AE002486) chaperone
FT                   protein HscB [Neisseria meningitidis MC58]; COG1076
FT                   DnaJ-domain-containing proteins 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89358"
FT                   /db_xref="GOA:Q5F8X9"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8X9"
FT                   /protein_id="AAW89358.1"
FT                   /translation="MMSSTINDAYRTLKNPIDRAAYLLKTSGIDADAPEHTSFAPDFLM
FT                   QQMEWRETLMEARAGNNLESLKNLDNEIRAEQEKLFCGLKQSFARQDCDTAAQQVRQGR
FT                   FLDKLRHEISSAL"
FT   gene            621869..622090
FT                   /locus_tag="NGO_03320"
FT   CDS_pept        621869..622090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_03320"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63634"
FT                   /db_xref="GOA:A0A0H4ISP1"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4ISP1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003751095.1"
FT                   /protein_id="AKO63634.1"
FT                   /translation="MGGKAQHNKGKIRDNALKALVKSDLFRHKVERKRKGKGSYNRQEA
FT                   KKRRDGFDTVPPFLCLKRGSSRRSRRSL"
FT   gene            complement(622050..622370)
FT                   /gene="iscA"
FT                   /locus_tag="NGO_0632"
FT   CDS_pept        complement(622050..622370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA"
FT                   /locus_tag="NGO_0632"
FT                   /product="iron-sulfur cluster assembly protein"
FT                   /note="forms iron-sulfur clusters of ferredoxin [2FE-2S];
FT                   binds iron in the presence of the thioredoxin reductase
FT                   system; forms homodimers and tetramers; similar to SufA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89360"
FT                   /db_xref="GOA:Q5F8X7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8X7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004333248.1"
FT                   /protein_id="AAW89360.1"
FT                   /translation="MITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFVD
FT                   EANGDDLIFEGHGARIYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGESF
FT                   HV"
FT   gene            complement(622457..622843)
FT                   /locus_tag="NGO_0633"
FT   CDS_pept        complement(622457..622843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0633"
FT                   /product="scaffolding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89361"
FT                   /db_xref="GOA:Q5F8X6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8X6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003674559.1"
FT                   /protein_id="AAW89361.1"
FT                   /translation="MAYSDKVIDHYENPRNVGTFDKNDESVGTGMVGAPACGDVMRLQI
FT                   KVNDEGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLDDALAIKNSEIAEELELPPVKI
FT                   HCSILAEDAVKAAVADYRKRQENR"
FT   gene            complement(622856..623350)
FT                   /locus_tag="NGO_03335"
FT   CDS_pept        complement(622856..623350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_03335"
FT                   /product="cell filamentation protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_03335"
FT                   /db_xref="EnsemblGenomes-Tr:AKO63635"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H4IV19"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003688888.1"
FT                   /protein_id="AKO63635.1"
FT                   /translation="MQPITGNFDLAHLQTIHRELFGNVYDWAGKIRRVDISKGNTRFAN
FT                   FAFIENESRKLLEKLKNENYLRVLDKDKFAERAAYYLDELNVLHPFREGNGRTLRLFMT
FT                   QLAIKNGFQIHWQNISAEQMIQACIQAYHADSSLLARLIIRQFRTIVFFRRLKHQQTTI
FT                   F"
FT   gene            complement(623656..623967)
FT                   /locus_tag="NGO_0635"
FT   CDS_pept        complement(623656..623967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89362"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8X5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003688887.1"
FT                   /protein_id="AAW89362.2"
FT                   /translation="MGGALRLMSNKGCLRKNTMKVKIINLPNGYKRIIYGKYFEQFDLD
FT                   YEQDLDVLKKDIEFALSVIEYNRSIFKKFSSLFENKIIFVYQGGHHLDIIDRDKGSLK"
FT   gene            complement(623952..625166)
FT                   /locus_tag="NGO_0636"
FT   CDS_pept        complement(623952..625166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0636"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="catalyzes the removal of elemental sulfur from
FT                   cysteine to produce alanine; involved in NAD biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89363"
FT                   /db_xref="GOA:Q5F8X4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8X4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016687546.1"
FT                   /protein_id="AAW89363.1"
FT                   /translation="MTVKTPVYLDYAATTPVDKRVAEKMIPYLTETFGNPASNSHAFGW
FT                   TAEEAVEKARADIAALINADPKEIVFTSGATESDNLAIKGAANFYKTKGKHLITVKTEH
FT                   KAVLDTMRELERQGFEVTYLGVQENGLIDLEELKAAIRDDTILISIMWVNNEIGVVQNI
FT                   PAIGEICRERKIAFHVDAAQACGKVPVDVEAAKIDLLSMSAHKVYGPKGIGALYVRRKP
FT                   RVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELAQDTAHYLKLRDIFLKGI
FT                   EGIEEVYINGDLEHRAPNNLNVSFNFVEGESLIMAVKELAVSSGSACTSASLEPSYVLR
FT                   ALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSI
FT                   EWAAH"
FT   gene            complement(625195..625641)
FT                   /locus_tag="NGO_0637"
FT   CDS_pept        complement(625195..625641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0637"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89364"
FT                   /db_xref="GOA:Q5F8X3"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8X3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004519894.1"
FT                   /protein_id="AAW89364.1"
FT                   /translation="MRLTTKGRFAVTAMLDLAMNAQTGAVKLSAISERQNISLSYLEQL
FT                   FGKLRRAGLVESLRGPGGGYILAAPPAQINIAQIISAAEDRLDATQCGSKANCHHGAPC
FT                   LTHDLWENLNKTINDYLGSVTLQSIIEQKNNGDGSRVVQFTHIH"
FT   gene            625640..625870
FT                   /locus_tag="NGO_0638"
FT   CDS_pept        625640..625870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89365"
FT                   /db_xref="GOA:Q5F8X2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8X2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003691301.1"
FT                   /protein_id="AAW89365.1"
FT                   /translation="MVVVARVGFFIVGGIVQYLSVSVKYGGAVADCLFKWRYSLILLYL
FT                   FGFLNQLVMFFEERRLGRFAGKRFQNDLIYF"
FT   gene            625991..627163
FT                   /gene="lldD"
FT                   /locus_tag="NGO_0639"
FT   CDS_pept        625991..627163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /locus_tag="NGO_0639"
FT                   /product="lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /note="flavin mononucleotide-dependent dehydrogenase;
FT                   functions in aerobic respiration and also has a role in
FT                   anaerobic nitrate respiration"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89366"
FT                   /db_xref="GOA:Q5F8X1"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8X1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002213180.1"
FT                   /protein_id="AAW89366.1"
FT                   /translation="MKRDLSKMTCIEDLHRVAKRKMPRMFYDYIDSGSWTETTYRENTS
FT                   DFKDIRFRQKVLVNMEGRSLETKMIGGDVKMPVAIAPTGFTGMAHADGEILAARAAEKF
FT                   GIPFTLSTMSICSIEDVAENTSAPFWFQLYVMRDREFMENLIKRAKDAKCSALVLTADL
FT                   QVLGQRHKDIKNGLSAPPKPTIANLINLATKPEWCMKMLNTERRTFRNIVGHAKNVGDL
FT                   SSLSSWTAEQFDPRLSWDDVARIKDLWGGKLIIKGIMEPEDAEKAAKSGADALVVSNHG
FT                   GRQLDDTVSAIKALPDIVSAVGSDIEVWMDSGIRSGQDILKAWALGAKGTMIGRAFLYG
FT                   LGAYGEEGVTRALEILYKEMDVSMAFTGHRDIQDVDASILRSKDWGRETV"
FT   gene            complement(627312..630086)
FT                   /locus_tag="NGO_0640"
FT   CDS_pept        complement(627312..630086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0640"
FT                   /product="type III restriction-modification system HindVIP
FT                   enzyme res"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89367"
FT                   /db_xref="GOA:Q5F8X0"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8X0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012503692.1"
FT                   /protein_id="AAW89367.1"
FT                   /translation="MANNKTLFDWVEDRKSMLEEMEQTDFFALPEFVSNNLKYPFFEWQ
FT                   KSALENFVIFDRTSKLKDFPDIKNRPTHLLFNMATGAGKTMMIAALILYYFEKGYRHFL
FT                   FFVNKNNIVYKTENNFIDPTHPKFLFTEKILQGDTVIPIRKVETFSQYSDGIEIKFTSI
FT                   QKLYNDIHTERENQTTLADLHELNLVILGDEAHHLNAQTKGKKQGELDLEKEMNERTSD
FT                   AEIERKGWEHMVLELLLNKNGNPGQNVLLEFTATLPENAEVQQKYADKIITKFGLKEFL
FT                   QKGYTKEINLVSGTLNKKERVLHALLFAWYRHQIALKYGIANFKPVMLFRSKTIDESKA
FT                   DYSAFLNWVENVQADDFSFLTTFSTSLSDSNNANEQGKTRTEQALKFMQENKFEFVHLA
FT                   NWVKQNYQKHNVIITNSETNKTKTEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWD
FT                   VLNLFDIVRLYEGQNGGGSNKKSGKTAAATVSEKQLIGRGVRYFPFAFEGKQPNKRKFD
FT                   NDMQHELRILEELFYYTHDEQSRYITELKNELRKDGYLPEKDDDKVLTTFKLKSEFADN
FT                   KDFRELLIWANKKIPNPNAKSNNADSLQANPQTLSFQVHGNQLLQETQFTADENDETAR
FT                   QIGTQNNFTQTIKMSEMERHIFNKALHIKGKNSQSLFHFDRLQSKLDIQNRNELQNKLL
FT                   KDWQIEFLGLEQDKQVRPDDKLAGCLKILEMVEKHLNESDIPFIGTKEFTPKKLWEIFG
FT                   TPKQKWVKKDDIKTAIATQNDWYVMDNFAGTGLEEALIQFISARLGDLKSQYDVHLIRN
FT                   EEVFKLNNFADGEGFMPDFVLLLKDKQKSSSDSVDDFLHYQIFIEPKGGHLVENDSWKE
FT                   AFLKSITVEYGRDKILQKNTPHYRLIGLPFFTDHQKNGQFTELFPLGAASLEK"
FT   gene            complement(630076..632346)
FT                   /locus_tag="NGO_0641"
FT   CDS_pept        complement(630076..632346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0641"
FT                   /product="restriction endonuclease subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89368"
FT                   /db_xref="GOA:Q5F8W9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR022221"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8W9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014581039.1"
FT                   /protein_id="AAW89368.1"
FT                   /translation="MKTGIQTELAQALLSHEKIWANEEKTILAKNILLDLVEKTDPSII
FT                   GLLLNNDELKRHFFVEVNGVLVFKLQDFRFFLDKHSINNSYTKYANRIGLTDGNRFLKD
FT                   NSDIVLDFPFKDCVLNGGQSTEEGEEIYFKRNNSQPASQPASQPASQPASQPASQPASQ
FT                   PASQPASQPASQPASQPASQPASQLYTKLTRKRQEIFFNQTLAFDEIDRLFDAKAFSKF
FT                   SRHTADGKQPVGEIKRRSDGTPAENLIIKGNNLIAMHSLAKQFKGKVKLIYIDPPYNTE
FT                   TDSFAYNDKFSHSTWLTFMKNRLEIAKELLKDDGLIFVQCDDKEQAYLKVLLDETFTRE
FT                   NFINCIAVKMSEPSGNKMAHTSHRLPKIKEYILIYKNKNIKLNPIREQKSEWDNEYNIF
FT                   LENFTQEDKKFIDLIVNSQTENKEINGNTLKEIDILLKKISPISVNQKLAQLNIKDNEV
FT                   IKWKLDNAYRIVRTAASSSVKKLADEKKEICQQQFFSVISKRDKLLYIVKSDYSKDAKA
FT                   PRVQVLFAEDYLSISLCDLWTNINTTGLEAEGNVELKNGKKPESLIETIIKLATNENDI
FT                   VLDYHLGSGTTAAVAHKMNRQYIGIEQMDYIETLAVERMKKVIDGEQGGISKAVNWQGG
FT                   GEFVYAELSPFNETAKQQILACENSDGIKTLFEGLCERHFLKYNVSVNEFSQIIEEPEF
FT                   QSLALDEQKQMMLEMLDLNQMYISLSEMDDEQFAGCLNDDDKALSRAFYQSVKHQAEKK
FT                   DGE"
FT   gene            complement(632563..633483)
FT                   /locus_tag="NGO_0642"
FT   CDS_pept        complement(632563..633483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0642"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89369"
FT                   /db_xref="GOA:Q5F8W8"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8W8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B4RMB1.1"
FT                   /protein_id="AAW89369.1"
FT                   /translation="MTNKPAKRPVNGVLLLDKPEGLSSNTALQKARRLFHAEKAGHTGV
FT                   LDPLATGLLPVCFGEAAKFAQYLLDADKAYTATLKLGEASSTGDAEGEIIAAARADISL
FT                   AEFQTACQALTGNIRQVPPMFSALKHEGKPLYEYARKGIVIERKPRDITVYSIDIAEFD
FT                   APKAVISVRCSKGTYIRTLSEGIAKHIGTFAHLTALRRTETAGFTIAQSHTLEALANLN
FT                   ETERDGLLLPCDVLVSHFPQTVLNDYAVHMLQCGQRPRFEEDLPSDTPVRVYTENGRFV
FT                   GLAEYQKEICRMKALRLMNTAASSA"
FT   gene            complement(633541..634065)
FT                   /locus_tag="NGO_0643"
FT   CDS_pept        complement(633541..634065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89370"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8W7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002237089.1"
FT                   /protein_id="AAW89370.2"
FT                   /translation="MNNLIPEHLAAYAHSDNLQIEGGHRCFSLSCQGRDTFHIRYYGEP
FT                   FDGLITDTDKAPVKIVAVEAVSGDEIVLFDGAEHGYNAMFCDKYSQNQKQNRTLTDLDE
FT                   YTYRVPIHLYYNIDYEDEYEDFVNSEGQVPLIDGRIISFDSLKRNGFDAISIDLIDEKH
FT                   SVRELLNEELS"
FT   gene            complement(634076..634447)
FT                   /locus_tag="NGO_0644"
FT   CDS_pept        complement(634076..634447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0644"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89371"
FT                   /db_xref="GOA:Q5F8W6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8W6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5F8W6.1"
FT                   /protein_id="AAW89371.1"
FT                   /translation="MKKPQRGYARQDRVKEQIMRELAELVRTGLKDPRAGFITINEVEI
FT                   TRDYSHATVFYTVLNQDTREITEEVLEHARGHLRSELSKRIKLFKIPELHFKYDESLER
FT                   GMSLSALIDQVAAEKPVED"
FT   gene            634630..635874
FT                   /gene="clpX"
FT                   /locus_tag="NGO_0645"
FT   CDS_pept        634630..635874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="NGO_0645"
FT                   /product="Clp protease ClpX"
FT                   /note="binds and unfolds substrates as part of the ClpXP
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89372"
FT                   /db_xref="GOA:Q5F8W5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8W5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q9JTX8.1"
FT                   /protein_id="AAW89372.1"
FT                   /translation="MSNENRTCSFCGKSKSHAKHLIEGKNAYICDECVANCLEILYEGD
FT                   NGGTPPENAGGEPEESGKLPTPAEIVANLDDYVIGQGQAKKALAVAVYNHYKRLRHPKA
FT                   DGGVELSKSNILLIGPTGSGKTLLAQSLARKLDVPFVMADATTLTEAGYVGEDVEQIIT
FT                   KLLGKCDFDVEKARHGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVASV
FT                   PPQGGRKHPNQEFINVDTANILFICGGAFAGLEKVIRQRTEKGGIGFGASVHSKDENAG
FT                   ITKLFGIVEPEDLIKFGLIPELIGRLPVIATLEELDEDALINILTEPKNALVKQYQALF
FT                   GIENVGLEFEEGALRSIARQAMERKTGARGLRSIVERCLLDTMYRLPDLQGLKKVVVGK
FT                   AVIEEGREPELVFES"
FT   gene            complement(635981..637174)
FT                   /gene="argD"
FT                   /locus_tag="NGO_0646"
FT   CDS_pept        complement(635981..637174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="NGO_0646"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /EC_number="2.6.1.17"
FT                   /note="DapATase; bifunctional enzyme that functions in
FT                   arginine and lysine biosynthetic pathways; catalyzes the
FT                   formation of N-acetyl-L-glutamate 5-semialdehyde from
FT                   2-oxoglutarate and N(2)-acetyl-L-ornithine or
FT                   N-succinyl-2-L-amino-6-oxoheptanedioate from 2-oxoglutarate
FT                   and N-succinyl-L-2,6-diaminoheptanedioate"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89373"
FT                   /db_xref="GOA:Q5F8W4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8W4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002247586.1"
FT                   /protein_id="AAW89373.1"
FT                   /translation="MQNYLTPNFAFAPMIPERASGSRVWDTEGREYIDFSGGIAVNALG
FT                   HCHPALVDALNAQMHKLWHISNIYTTRPAQELAQKLVKHSFADKVFFCNSGAEANEAAL
FT                   KLARKYARDRFGGGKSEIVACINSFHGRTLFTVSVGGQPKYSKDYAPLPQGITHVPFND
FT                   IAALEAAVGEQTCAVIIEPIQGESGILPATAEYLQAARRLCDRHNALLILDEVQTGMGH
FT                   TGRLFAYEHYGVVPDILSSAKALGCGFPIGTMLATEKIAAAFQPGTHGSTFGGNPMACA
FT                   VGSRAFDIINAPETLHNVRSQGQKLQTALLDLGRKTGLFSQVRGMGLLLGCALDTPYRG
FT                   RSSEIAATSLKHGVMILVAGADVLRFAPSLLLNDEDIAEGLRRLEHVLTEFAAANRP"
FT   gene            complement(637273..637481)
FT                   /pseudo
FT                   /locus_tag="NGO_03400"
FT                   /note="hypothetical protein; disrupted"
FT   gene            637578..638078
FT                   /locus_tag="NGO_0647"
FT   CDS_pept        637578..638078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8W3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010357954.1"
FT                   /protein_id="AAW89374.1"
FT                   /translation="MDAMPQTAVQNENLHTCSIIVDDAQDFSPMLLDAGRDDTLISESM
FT                   IPQIRTVAALIAAERHDFSRSSPAEFTDAADFFAARILVLGVRRFHLDVSLLQILKTAN
FT                   KRACRFAEKHRLFFTPAQAELSLNKHKNRRLLTIETEHEVENKGNPVANSLAFVRKLHT
FT                   LPL"
FT   gene            638163..638717
FT                   /locus_tag="NGO_0648"
FT   CDS_pept        638163..638717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0648"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89375"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8W2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014580810.1"
FT                   /protein_id="AAW89375.1"
FT                   /translation="MKKIIASALIATFALTACQDDTQARLERQQKQIEALQQQLAQQAD
FT                   DTVYQLTPEAVKDTIPAQAQANGNNGQPVTGKDGQQYIYDQSTGSWLLQSLIGAAAGAF
FT                   IGNALANKFTRAGNQDSPVARRARAAYHQSARPNARTSRDLNTRSLRAKQQAAQAQRYR
FT                   PTTRPPVNYRRPAMRGFGRRR"
FT   gene            638731..638931
FT                   /locus_tag="NGO_0649"
FT   CDS_pept        638731..638931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89376"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8W1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009348581.1"
FT                   /protein_id="AAW89376.1"
FT                   /translation="MPSEGLSDGIFVFVRGIVMLPFDFQTAFCFQAFDVGMAILIYVRW
FT                   QGGIVIPPLGFQTASYRTVKP"
FT   gene            complement(639282..640670)
FT                   /locus_tag="NGO_0650"
FT   CDS_pept        complement(639282..640670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0650"
FT                   /product="RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89377"
FT                   /db_xref="GOA:Q5F8W0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8W0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002237086.1"
FT                   /protein_id="AAW89377.1"
FT                   /translation="MSIKFADLNLDKNILSAVSSEGYESPTPIQAQAIPFALEGCDIMA
FT                   SAQTGSGKTAAFLLPTLQRLTKRSEKPGKGPRALVLAPTRELAAQVEKNALAYAKNMRW
FT                   FRTVSIVGGTSFGYQTRALSKPVDLIVATPGRLTDLMQSGKVDFERLEVLILDEADRML
FT                   DMGFIDDIETIVEATPADRQTLLFSATWDGAVGKLARKLTKDSEIIEVERVDGQGKIEE
FT                   QLLYCDDMRHKNRLLDHILRDANIDQCVIFTSTKAMTEVIADELYEKGFAANCLHGDMP
FT                   QGWRNRTLTDLRKGRCKILVATDVAARGIDVPTITHVINYDLPKQAEDYVHRIGRTGRA
FT                   GRTGIAITFAEVNEYVKVHKIEKYINRKLPELTIEGMEPARKRKSAGGKPKGKGGWGDR
FT                   KSGGRRGDHKPGKEGFGGKTRGEGFKKEGFKKDSFKKTGEGFKGKRKAGDSFAGKSERR
FT                   YKDR"
FT   gene            640998..641945
FT                   /locus_tag="NGO_0651"
FT   CDS_pept        640998..641945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0651"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89378"
FT                   /db_xref="GOA:Q5F8V9"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8V9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014582085.1"
FT                   /protein_id="AAW89378.2"
FT                   /translation="MTDITPFANRLGKNIKHLMKWAKRNGIEAWRIYDRDIPQFPFAAD
FT                   VYGDRIHLQEYDTGWLMRPGEYEAWLAEVLEAVAFVTGFEPEQIRLKRRERQKGLQQYE
FT                   KTGKAGDDFVIAENGRKFWVNLDKYLDTGFFLDHRNTRKKVGETAAGKRFLNLFSYTGS
FT                   FTVYAATGGAASSETVDLSNTYLDWARRNFELNGIDMERHKIVRADVFQYLQTAYGEGR
FT                   QFDLIVMDPPSFSNSKKMPGILDIQRDHQKLIDGAVNLLASDGILYFSNNLRSFVLDDS
FT                   VSEQYAVKDISKQSVPEDFRNKKIHRCWEIRHKS"
FT   gene            complement(641997..642329)
FT                   /locus_tag="NGO_0652"
FT   CDS_pept        complement(641997..642329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0652"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89379"
FT                   /db_xref="GOA:Q5F8V8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8V8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003823052.1"
FT                   /protein_id="AAW89379.1"
FT                   /translation="MSSELIVHTGDAAFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILD
FT                   DIAAEFEGRLKVVKINIDDNEATPSRFGVRGIPTLMVFKNGEVVATKVGALAKGQLTAF
FT                   VEASIA"
FT   gene            642627..643100
FT                   /locus_tag="NGO_0653"
FT   CDS_pept        642627..643100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0653"
FT                   /product="iron-sulfur cluster repair protein DnrN"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89380"
FT                   /db_xref="GOA:Q5F8V7"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8V7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019273051.1"
FT                   /protein_id="AAW89380.1"
FT                   /translation="MTDFSVWEAAPFGATVDHILQRYHNVHRAQFEELVPLAQKVAQVH
FT                   ADTFPAEIAGLLADMRDELLMHMMKEERMLFPMINQGVGRGAAMPISVMMHEHEEHDRA
FT                   IARLKELTGNFHAPEGACGSWTRLYALAKEMADDLNDHIHLENDILFARVLDS"
FT   gene            complement(643171..643962)
FT                   /locus_tag="NGO_0654"
FT   CDS_pept        complement(643171..643962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0654"
FT                   /product="NAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89381"
FT                   /db_xref="GOA:Q5F8V6"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8V6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003713680.1"
FT                   /protein_id="AAW89381.2"
FT                   /translation="MDTQAVITHIVRWLDEYAAQANAKGFVVGVSGGIDSAVVSTLAAR
FT                   TGRTTLLLDMPIRQHPGQLERARRHIRNLQGQYANVSAQTANLTDTFQTFEQTVGVHQT
FT                   AFANQPLSLANARSRLRMLTLYYYGQIHGLLVTGTGNKVEDFGVGFFTKYGDGGVDISP
FT                   IADLTKTQVYRLAEALGVDEAIQKAPPTDGLWDTERTDEEQMGASYPELEWAMGVYGTR
FT                   KPEDFEGRRREVLEIYTRLHRAMQHKINPIPVCRIPPELLG"
FT   gene            644189..645544
FT                   /locus_tag="NGO_0655"
FT   CDS_pept        644189..645544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0655"
FT                   /product="exodeoxyribonuclease VII large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89382"
FT                   /db_xref="GOA:Q5F8V5"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8V5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A1KUI5.1"
FT                   /protein_id="AAW89382.1"
FT                   /translation="MSDFFHSDVLSVSELNAFAKSILENHLAGLWIAGEVSNLTRAASG
FT                   HYYFSLKDSRAQVRCAMFKGAAARLAQPLKEGDHIEVAGKISIYEARGEFQITVNEVRL
FT                   KGLGQLYEAYERLKAQLQAEGAFAAERKKPLPVRPQCIGIVTSLAAAALRDVVTTLKRR
FT                   APEIPVIVYPAAVQGAGSGFQIAQAIKTASQRAECDVLIVCRGGGSIEDLRAFNEEPVV
FT                   RAIEACTIPVVSGVGHETDFTLADFVADVRAPTPTGAAELVSPNRQESLHRLVQAQGRL
FT                   KTVLEQRYFDASQKLDWLARQIRHPRQKLDEQRASIGKLAQTLSYSMTQNLRAHTARFE
FT                   RQTQALQHCRPDVSVYRQDIVRLQTALPAAFSRLLARRRQSLTAQAALLEAVSPQHILE
FT                   RGFSVVKNTRGQVIRNADVLKQGQKLHITFSDGETDVRVSKEQGQQDLFDCI"
FT   gene            646046..647587
FT                   /locus_tag="NGO_0656"
FT   CDS_pept        646046..647587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0656"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89383"
FT                   /db_xref="GOA:Q5F8V4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8V4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003707780.1"
FT                   /protein_id="AAW89383.1"
FT                   /translation="MKFLDREASIAKPGFNRWLVPPAALAVHLAIGQIYAYSVFNAPLT
FT                   KLIGITESAAGDWKLTTVGWIFSIALAMLGASAALFGTWMERVGPRKAIFAAACCFSLG
FT                   FFVSAFGVRTHNLFLLYLGNGVIGGVGLGLGYIGPVSTLMKWFPDKPGMATGLAIMGFG
FT                   GGAMLASPLSVSLMNAFSNAASVGVAETFAVLGLFYLALMMFGAFTIRVPADGWKPEGY
FT                   TVPKTQNKPVSSNHVNVSQAMKTPQFWLLFWVLCLNVTAGIGVLGQASVMIQELFSETS
FT                   AGRQAAVGAGAAAGFVSLLSLFNMGGRFLWSSVSDKIGRKNTYTIFFVLGSLLYFAVPS
FT                   IGEGGSKALFIIGFCVIISMYGGGFAAIPAYLKDLFGTYQVGAIHGRILLAWSTAAVIG
FT                   PVLVNYIRQSQIDSGIPAAQAYSVTMYIMAGLLIVGLLCNLAVKSVHEKHHEKDIKTAA
FT                   RSGNPDDETAISDAYLVGEKVSGDGISVWWRWALAVIPLAYGVVMVFVKALDLFS"
FT   gene            complement(647646..648695)
FT                   /locus_tag="NGO_0657"
FT   CDS_pept        complement(647646..648695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0657"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89384"
FT                   /db_xref="GOA:Q5F8V3"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8V3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003764594.1"
FT                   /protein_id="AAW89384.2"
FT                   /translation="MSKQPTSKRQWRDGAAPSAKKTAKPFKSKARPKDETRKTAAQAYG
FT                   QKASDGIKLQNAPKQRAAKAKKLVVRNPNQKIMEHARDLKERRSDLSRMEPERLQKVLA
FT                   ASGVGSRREMEEWINNGWVTVNGKTAQLGDKVTPDDHVTVKGSIIKLKWADRLPRIILY
FT                   YKQEGEIVSRDDPQGRVSIFDRLPQAASSRWVAIGRLDINTSGLLILTTSGELVQRFAH
FT                   PSFEVEREYAVRVLGGLTTEQMRSLTEEGVMLEDGLAKVERIYEQGGEGANKWYNIVIK
FT                   EGRNREVRRIFESQGLTVSRLVRVAFGPIGLPNRLKRGQFYELNPAEVANILKWADMLL
FT                   PGERRRKKA"
FT   gene            648916..649548
FT                   /locus_tag="NGO_0658"
FT   CDS_pept        648916..649548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0658"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89385"
FT                   /db_xref="GOA:Q5F8V2"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8V2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013449040.1"
FT                   /protein_id="AAW89385.1"
FT                   /translation="MDLHNIREDYSKRELSEADCADNPIEQFERWLDEAVRAEVNEPTA
FT                   VNVAAVDGRGRPNSRMVLLKEVNSEGFVFFTNYHSRKGRSLELNPFAAMTFFWPELERQ
FT                   VRVEGRVGRLAEKLSDEYFESRPYQSRLGAWASAQSEVIPNKAVLVAKAAAVGLKHPLH
FT                   VPRPPHWGGYIVIPDLIEFWQGRPSRLHDRIQYRLLDGGWIRERLSP"
FT   gene            complement(649678..650688)
FT                   /locus_tag="NGO_0659"
FT   CDS_pept        complement(649678..650688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0659"
FT                   /product="CDP-6-deoxy-delta-3,4-glucoseen reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89386"
FT                   /db_xref="GOA:Q5F8V1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8V1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002213233.1"
FT                   /protein_id="AAW89386.1"
FT                   /translation="MNHTVTLPDQTTFAAGDGETVLSAAARQNLNLPHSCKNGVCGQCK
FT                   AELASGDIQMGGHSEQALSEAEKAQGKILMCRTTAQSDININIPGCKADALPVRTLPAR
FT                   IESMVFKHDVAFLKLALPKAPPFAFYAGQYIDLLLPGNVSRSYSIANSPDQEGILELHI
FT                   RRRENGVCSEMIFGSEPKVKEKGIVRVKGPLGSFTLQEDSGKPVILPATDTGYAPIRSI
FT                   LLDLIRQNSSRAAHFYWGARHQDDLYALEEAQGLACRLKNTCFTPVLSRPGEGWQGRKG
FT                   HVQDIAAQDHPDLSEYEVFACGSPAMTEQAKNLFVQQHKLPENLFFSDAFTPSAS"
FT   gene            complement(650780..652210)
FT                   /gene="gatB"
FT                   /locus_tag="NGO_0660"
FT   CDS_pept        complement(650780..652210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="NGO_0660"
FT                   /product="glutamyl-tRNA amidotransferase"
FT                   /EC_number="6.3.5.-"
FT                   /note="allows the formation of correctly charged
FT                   Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
FT                   of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
FT                   which lack either or both of asparaginyl-tRNA or
FT                   glutaminyl-tRNA synthetases; reaction takes place in the
FT                   presence of glutamine and ATP through an activated
FT                   phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89387"
FT                   /db_xref="GOA:Q5F8V0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8V0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003698528.1"
FT                   /protein_id="AAW89387.1"
FT                   /translation="MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALP
FT                   GVLPVMNREVVEKAIKLGLALDAKINRKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGK
FT                   LEIVVGGDVKTINVTRAHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAA
FT                   EAVAYAKALHSLVTWLDICDGNMAEGSFRIDANVSVRPKGQAEFGTRREIKNLNSFRFL
FT                   DQAINYEAEAQIEILEDGGTVQQATMLFDPEKGETRVMRLKEDAHDYGYFPDPDLLPVI
FT                   ISDAQMQKAKAEMPELPKEMAARFVADYGVSEYDARLLTASRVQAAYFEEAAKESGQGK
FT                   PTANWMNGELAATLNKEGMELADSPITAPRLAALVGKIADGTLSGKLAKKAFEAMWAEP
FT                   ETSIAEIIEKHSLQQMTDTGAVEAMVDEVLANNAKAVEQFKSGNEKALNAIVGQVMKTS
FT                   KGKANPAQVQELIKAKLA"
FT   gene            complement(652253..653185)
FT                   /locus_tag="NGO_0661"
FT   CDS_pept        complement(652253..653185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0661"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89388"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8U9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003702780.1"
FT                   /protein_id="AAW89388.1"
FT                   /translation="MKQNRTFTFPDFRTVYSYAPLYRLQHLKYTLRKFFGKKEIYAFEQ
FT                   FVNASPIRQGLFLHCPQDAYPLLREFVDRRFNCKRRLDAMTADFLMAEKLFGTDVLCQM
FT                   EDCRFHLVLAHLSDGISLWLNRNDNCVEEGAWSLSLRDEAGNRLYMATFAFVGTHLLTA
FT                   SVQGPSGEEAKDTVRRITKQLHGLRPQQLMVTALQYFAAALKLDGAIGIAQKHQVKLRW
FT                   KLKKRVKMNYDAFWQEYGASLERDGYWHLPQTPARKDLADIESKKRSMYRKRYEMLDDM
FT                   VAKMKDSLKTEARGISDGIQTEKPLRRTV"
FT   gene            complement(653182..654627)
FT                   /locus_tag="NGO_0662"
FT   CDS_pept        complement(653182..654627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0662"
FT                   /product="glutamyl-tRNA amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89389"
FT                   /db_xref="GOA:Q5F8U8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8U8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002242745.1"
FT                   /protein_id="AAW89389.1"
FT                   /translation="MTQYTLKQAGSLLQSKQISAVELASAYLAAIAEKNPALNGYITID
FT                   QDKTLAEARAADERIAQGNASALTGVPVAYKDIFCQTGWRSACASKMLDNFIFPYTATV
FT                   VQNLLDEGMVTLGRTNMDEFAMGSTNENSFYGAAKNPWNPEHVPGGSSGGSAAVVAARL
FT                   APAALGSDTGGSIRQPASHCGITGIKPTYGTVSRFGMVAYASSFDQAGPMAQTAEDCAI
FT                   LLNAMAGFDPKDSTSFEREKEDYTRDLDKPLKGVKIGLPKEYFSEGNSTDVQTALQNTI
FT                   DLLKAQGAELVEVSLPQTKLSIPAYYVLASAEAGTNLSRYDGVRYGHRAAQFGDLEEMY
FT                   GKTRAEGFGSEVKRRIMIGTYVLSHGYYDAYYLKAQKLRRLVADDFQTAFARCDLILAP
FT                   TAPSAAPKIGADTSPVETYLSDIYTIAVNLAGLPALTLPAGFSGGGLPVGVQLVGNYFA
FT                   EAKILGAAHQIQLNSDWHGKRPE"
FT   gene            complement(654690..654980)
FT                   /locus_tag="NGO_0663"
FT   CDS_pept        complement(654690..654980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0663"
FT                   /product="glutamyl-tRNA amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89390"
FT                   /db_xref="GOA:Q5F8U7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F8U7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002241686.1"
FT                   /protein_id="AAW89390.1"
FT                   /translation="MALTLADVDKIARLSRLQLTAEEKEKSLQELNDIFTMVEQMQNIN
FT                   TDGIEPMAHPHEVALRLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIEE"
FT   gene            655130..655783
FT                   /locus_tag="NGO_0664"
FT   CDS_pept        655130..655783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0664"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89391"
FT                   /db_xref="GOA:Q5F8U6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8U6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012221757.1"
FT                   /protein_id="AAW89391.1"
FT                   /translation="MGLGMEIGKLIVAFLVLINPFSALSLYLDLTNGHSTKERRKVART
FT                   AAVAVFAVIAVFALIGGALLKVLGISVGSFQVGGGILVLLIAISMMNGNDNPAKQNLGA
FT                   QPETGQARPARNAGAIAVVPIAIPITIGPGGISTVIIYASAAKTYSDIALIIAAGLVVS
FT                   AICYAILIVAGKVSRLLGATGLTILNRIMGMMLAAVSVEIIVSGLKTIFPQLAG"
FT   gene            655788..657131
FT                   /locus_tag="NGO_0665"
FT   CDS_pept        655788..657131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGO_0665"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGO_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAW89392"
FT                   /db_xref="GOA:Q5F8U5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F8U5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002219139.1"
FT                   /protein_id="AAW89392.1"
FT                   /translation="MFHSVNVFTGETLYRRPDQDYAEFERRLADLKMHGRAFAQLGVTE
FT                   RAARLQKFAGRLEAEKERFAEMVCEEVGRCLHECRAEIVKSI