(data stored in SCRATCH zone)

EMBL: AE005174

ID   AE005174; SV 2; circular; genomic DNA; STD; PRO; 5528445 BP.
XX
AC   AE005174; AE005177-AE005671; AE006457-AE006461;
XX
PR   Project:PRJNA259;
XX
DT   08-DEC-2004 (Rel. 82, Created)
DT   08-MAY-2017 (Rel. 132, Last updated, Version 16)
XX
DE   Escherichia coli O157:H7 str. EDL933 genome.
XX
KW   .
XX
OS   Escherichia coli O157:H7 str. EDL933
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-5528445
RX   DOI; 10.1038/35054089.
RX   PUBMED; 11206551.
RA   Perna N.T., Plunkett G.III., Burland V., Mau B., Glasner J.D., Rose D.J.,
RA   Mayhew G.F., Evans P.S., Gregor J., Kirkpatrick H.A., Posfai G.,
RA   Hackett J., Klink S., Boutin A., Shao Y., Miller L., Grotbeck E.J.,
RA   Davis N.W., Lim A., Dimalanta E., Potamousis K., Apodaca J.,
RA   Anantharaman T.S., Lin J., Yen G., Schwartz D.C., Welch R.A.,
RA   Blattner F.R.;
RT   "Genome sequence of enterohaemorrhagic Escherichia coli O157:H7";
RL   Nature 409(6819):529-533(2001).
XX
RN   [2]
RP   1-5528445
RA   Perna N.T., Plunkett G.III., Burland V., Mau B., Glasner J.D., Rose D.J.,
RA   Mayhew G.F., Evans P.S., Gregor J., Kirkpatrick H.A., Posfai G.,
RA   Hackett J., Klink S., Boutin A., Shao Y., Miller L., Grotbeck E.J.,
RA   Davis N.W., Lim A., Dimalanta E., Potamousis K., Apodaca J.,
RA   Anantharaman T.S., Lin J., Yen G., Schwartz D.C., Welch R.A.,
RA   Blattner F.R.;
RT   ;
RL   Submitted (22-OCT-2000) to the INSDC.
RL   Laboratory of Genetics, University of Wisconsin, 445 Henry Mall, Madison,
RL   WI 53706, USA
XX
DR   MD5; 3d4771bb227da418b82f5f9db518849c.
DR   BioSample; SAMN02604092.
DR   COMPARE-RefGenome; EDL933.
DR   EnsemblGenomes-Gn; EBG00001044707.
DR   EnsemblGenomes-Gn; EBG00001044708.
DR   EnsemblGenomes-Gn; EBG00001044709.
DR   EnsemblGenomes-Gn; EBG00001044710.
DR   EnsemblGenomes-Gn; EBG00001044711.
DR   EnsemblGenomes-Gn; EBG00001044712.
DR   EnsemblGenomes-Gn; EBG00001044713.
DR   EnsemblGenomes-Gn; EBG00001044714.
DR   EnsemblGenomes-Gn; EBG00001044715.
DR   EnsemblGenomes-Gn; EBG00001044716.
DR   EnsemblGenomes-Gn; EBG00001044717.
DR   EnsemblGenomes-Gn; EBG00001044718.
DR   EnsemblGenomes-Gn; EBG00001044719.
DR   EnsemblGenomes-Gn; EBG00001044720.
DR   EnsemblGenomes-Gn; EBG00001044721.
DR   EnsemblGenomes-Gn; EBG00001044722.
DR   EnsemblGenomes-Gn; EBG00001044723.
DR   EnsemblGenomes-Gn; EBG00001044724.
DR   EnsemblGenomes-Gn; EBG00001044725.
DR   EnsemblGenomes-Gn; EBG00001044726.
DR   EnsemblGenomes-Gn; EBG00001044727.
DR   EnsemblGenomes-Gn; EBG00001044728.
DR   EnsemblGenomes-Gn; EBG00001044729.
DR   EnsemblGenomes-Gn; EBG00001044730.
DR   EnsemblGenomes-Gn; EBG00001044731.
DR   EnsemblGenomes-Gn; EBG00001044732.
DR   EnsemblGenomes-Gn; EBG00001044733.
DR   EnsemblGenomes-Gn; EBG00001044734.
DR   EnsemblGenomes-Gn; EBG00001044735.
DR   EnsemblGenomes-Gn; EBG00001044736.
DR   EnsemblGenomes-Gn; EBG00001044737.
DR   EnsemblGenomes-Gn; EBG00001044738.
DR   EnsemblGenomes-Gn; EBG00001044739.
DR   EnsemblGenomes-Gn; EBG00001044740.
DR   EnsemblGenomes-Gn; EBG00001044741.
DR   EnsemblGenomes-Gn; EBG00001044742.
DR   EnsemblGenomes-Gn; EBG00001044743.
DR   EnsemblGenomes-Gn; EBG00001044744.
DR   EnsemblGenomes-Gn; EBG00001044745.
DR   EnsemblGenomes-Gn; EBG00001044746.
DR   EnsemblGenomes-Gn; EBG00001044747.
DR   EnsemblGenomes-Gn; EBG00001044748.
DR   EnsemblGenomes-Gn; EBG00001044749.
DR   EnsemblGenomes-Gn; EBG00001044750.
DR   EnsemblGenomes-Gn; EBG00001044751.
DR   EnsemblGenomes-Gn; EBG00001044752.
DR   EnsemblGenomes-Gn; EBG00001044753.
DR   EnsemblGenomes-Gn; EBG00001044754.
DR   EnsemblGenomes-Gn; EBG00001044755.
DR   EnsemblGenomes-Gn; EBG00001044756.
DR   EnsemblGenomes-Gn; EBG00001044757.
DR   EnsemblGenomes-Gn; EBG00001044758.
DR   EnsemblGenomes-Gn; EBG00001044759.
DR   EnsemblGenomes-Gn; EBG00001044760.
DR   EnsemblGenomes-Gn; EBG00001044761.
DR   EnsemblGenomes-Gn; EBG00001044762.
DR   EnsemblGenomes-Gn; EBG00001044763.
DR   EnsemblGenomes-Gn; EBG00001044764.
DR   EnsemblGenomes-Gn; EBG00001044765.
DR   EnsemblGenomes-Gn; EBG00001044766.
DR   EnsemblGenomes-Gn; EBG00001044767.
DR   EnsemblGenomes-Gn; EBG00001044768.
DR   EnsemblGenomes-Gn; EBG00001044769.
DR   EnsemblGenomes-Gn; EBG00001044770.
DR   EnsemblGenomes-Gn; EBG00001044771.
DR   EnsemblGenomes-Gn; EBG00001044772.
DR   EnsemblGenomes-Gn; EBG00001044773.
DR   EnsemblGenomes-Gn; EBG00001044774.
DR   EnsemblGenomes-Gn; EBG00001044775.
DR   EnsemblGenomes-Gn; EBG00001044776.
DR   EnsemblGenomes-Gn; EBG00001044777.
DR   EnsemblGenomes-Gn; EBG00001044778.
DR   EnsemblGenomes-Gn; EBG00001044779.
DR   EnsemblGenomes-Gn; EBG00001044780.
DR   EnsemblGenomes-Gn; EBG00001044781.
DR   EnsemblGenomes-Gn; EBG00001044782.
DR   EnsemblGenomes-Gn; EBG00001044783.
DR   EnsemblGenomes-Gn; EBG00001044784.
DR   EnsemblGenomes-Gn; EBG00001044785.
DR   EnsemblGenomes-Gn; EBG00001044786.
DR   EnsemblGenomes-Gn; EBG00001044787.
DR   EnsemblGenomes-Gn; EBG00001044788.
DR   EnsemblGenomes-Gn; EBG00001044789.
DR   EnsemblGenomes-Gn; EBG00001044790.
DR   EnsemblGenomes-Gn; EBG00001044791.
DR   EnsemblGenomes-Gn; EBG00001044792.
DR   EnsemblGenomes-Gn; EBG00001044793.
DR   EnsemblGenomes-Gn; EBG00001044794.
DR   EnsemblGenomes-Gn; EBG00001044795.
DR   EnsemblGenomes-Gn; EBG00001044796.
DR   EnsemblGenomes-Gn; EBG00001044797.
DR   EnsemblGenomes-Gn; EBG00001044798.
DR   EnsemblGenomes-Gn; EBG00001044799.
DR   EnsemblGenomes-Gn; EBG00001044800.
DR   EnsemblGenomes-Gn; EBG00001044801.
DR   EnsemblGenomes-Gn; EBG00001044802.
DR   EnsemblGenomes-Gn; EBG00001044803.
DR   EnsemblGenomes-Gn; EBG00001044804.
DR   EnsemblGenomes-Gn; EBG00001044805.
DR   EnsemblGenomes-Gn; EBG00001044806.
DR   EnsemblGenomes-Gn; EBG00001044807.
DR   EnsemblGenomes-Gn; EBG00001044808.
DR   EnsemblGenomes-Gn; EBG00001044809.
DR   EnsemblGenomes-Gn; EBG00001044810.
DR   EnsemblGenomes-Gn; EBG00001044811.
DR   EnsemblGenomes-Gn; EBG00001044812.
DR   EnsemblGenomes-Gn; EBG00001044813.
DR   EnsemblGenomes-Gn; EBG00001044814.
DR   EnsemblGenomes-Gn; EBG00001044815.
DR   EnsemblGenomes-Gn; EBG00001044816.
DR   EnsemblGenomes-Gn; EBG00001044817.
DR   EnsemblGenomes-Gn; EBG00001044818.
DR   EnsemblGenomes-Gn; EBG00001044819.
DR   EnsemblGenomes-Gn; EBG00001044820.
DR   EnsemblGenomes-Gn; EBG00001044821.
DR   EnsemblGenomes-Gn; EBG00001044822.
DR   EnsemblGenomes-Gn; EBG00001044823.
DR   EnsemblGenomes-Gn; EBG00001044824.
DR   EnsemblGenomes-Gn; EBG00001044825.
DR   EnsemblGenomes-Gn; EBG00001044826.
DR   EnsemblGenomes-Gn; EBG00001044827.
DR   EnsemblGenomes-Gn; EBG00001044828.
DR   EnsemblGenomes-Gn; EBG00001044829.
DR   EnsemblGenomes-Gn; EBG00001044830.
DR   EnsemblGenomes-Gn; EBG00001044831.
DR   EnsemblGenomes-Gn; EBG00001044832.
DR   EnsemblGenomes-Gn; EBG00001044833.
DR   EnsemblGenomes-Gn; EBG00001044834.
DR   EnsemblGenomes-Gn; EBG00001044835.
DR   EnsemblGenomes-Gn; EBG00001044836.
DR   EnsemblGenomes-Gn; EBG00001044837.
DR   EnsemblGenomes-Gn; EBG00001044838.
DR   EnsemblGenomes-Gn; EBG00001044839.
DR   EnsemblGenomes-Gn; EBG00001044840.
DR   EnsemblGenomes-Gn; EBG00001044841.
DR   EnsemblGenomes-Gn; EBG00001044842.
DR   EnsemblGenomes-Gn; EBG00001044843.
DR   EnsemblGenomes-Gn; EBG00001044844.
DR   EnsemblGenomes-Gn; EBG00001044845.
DR   EnsemblGenomes-Gn; EBG00001044846.
DR   EnsemblGenomes-Gn; EBG00001044847.
DR   EnsemblGenomes-Gn; EBG00001044848.
DR   EnsemblGenomes-Gn; EBG00001044849.
DR   EnsemblGenomes-Gn; EBG00001044850.
DR   EnsemblGenomes-Gn; EBG00001044851.
DR   EnsemblGenomes-Gn; EBG00001044852.
DR   EnsemblGenomes-Gn; EBG00001044853.
DR   EnsemblGenomes-Gn; EBG00001044854.
DR   EnsemblGenomes-Gn; EBG00001044855.
DR   EnsemblGenomes-Gn; EBG00001044856.
DR   EnsemblGenomes-Gn; EBG00001044857.
DR   EnsemblGenomes-Gn; EBG00001044858.
DR   EnsemblGenomes-Gn; EBG00001044859.
DR   EnsemblGenomes-Gn; EBG00001044860.
DR   EnsemblGenomes-Gn; EBG00001044861.
DR   EnsemblGenomes-Gn; EBG00001044862.
DR   EnsemblGenomes-Gn; EBG00001044863.
DR   EnsemblGenomes-Gn; EBG00001044864.
DR   EnsemblGenomes-Gn; EBG00001044865.
DR   EnsemblGenomes-Gn; EBG00001044866.
DR   EnsemblGenomes-Gn; EBG00001044867.
DR   EnsemblGenomes-Gn; EBG00001044868.
DR   EnsemblGenomes-Gn; EBG00001044869.
DR   EnsemblGenomes-Gn; EBG00001044870.
DR   EnsemblGenomes-Gn; EBG00001044871.
DR   EnsemblGenomes-Gn; EBG00001044872.
DR   EnsemblGenomes-Gn; EBG00001044873.
DR   EnsemblGenomes-Gn; EBG00001044874.
DR   EnsemblGenomes-Gn; EBG00001044875.
DR   EnsemblGenomes-Gn; EBG00001044876.
DR   EnsemblGenomes-Gn; EBG00001044877.
DR   EnsemblGenomes-Gn; EBG00001044878.
DR   EnsemblGenomes-Gn; EBG00001044879.
DR   EnsemblGenomes-Gn; EBG00001044880.
DR   EnsemblGenomes-Gn; EBG00001044881.
DR   EnsemblGenomes-Gn; EBG00001044882.
DR   EnsemblGenomes-Gn; EBG00001044883.
DR   EnsemblGenomes-Gn; EBG00001044884.
DR   EnsemblGenomes-Gn; EBG00001044885.
DR   EnsemblGenomes-Gn; EBG00001044886.
DR   EnsemblGenomes-Gn; EBG00001044887.
DR   EnsemblGenomes-Gn; EBG00001044888.
DR   EnsemblGenomes-Gn; EBG00001044889.
DR   EnsemblGenomes-Gn; EBG00001044890.
DR   EnsemblGenomes-Gn; EBG00001044891.
DR   EnsemblGenomes-Gn; EBG00001044892.
DR   EnsemblGenomes-Gn; EBG00001044893.
DR   EnsemblGenomes-Gn; EBG00001044894.
DR   EnsemblGenomes-Gn; EBG00001044895.
DR   EnsemblGenomes-Gn; EBG00001044896.
DR   EnsemblGenomes-Gn; EBG00001044897.
DR   EnsemblGenomes-Gn; EBG00001044898.
DR   EnsemblGenomes-Gn; EBG00001044899.
DR   EnsemblGenomes-Gn; EBG00001044900.
DR   EnsemblGenomes-Gn; EBG00001044901.
DR   EnsemblGenomes-Gn; EBG00001044902.
DR   EnsemblGenomes-Gn; EBG00001044903.
DR   EnsemblGenomes-Gn; EBG00001044904.
DR   EnsemblGenomes-Gn; EBG00001044905.
DR   EnsemblGenomes-Gn; EBG00001044906.
DR   EnsemblGenomes-Gn; EBG00001044907.
DR   EnsemblGenomes-Gn; EBG00001044908.
DR   EnsemblGenomes-Gn; EBG00001044909.
DR   EnsemblGenomes-Gn; EBG00001044910.
DR   EnsemblGenomes-Gn; EBG00001044911.
DR   EnsemblGenomes-Gn; EBG00001044912.
DR   EnsemblGenomes-Gn; EBG00001044913.
DR   EnsemblGenomes-Gn; EBG00001044914.
DR   EnsemblGenomes-Gn; EBG00001044915.
DR   EnsemblGenomes-Gn; EBG00001044916.
DR   EnsemblGenomes-Gn; EBG00001044917.
DR   EnsemblGenomes-Gn; EBG00001044918.
DR   EnsemblGenomes-Gn; EBG00001044919.
DR   EnsemblGenomes-Gn; EBG00001044920.
DR   EnsemblGenomes-Gn; EBG00001044921.
DR   EnsemblGenomes-Gn; EBG00001044922.
DR   EnsemblGenomes-Gn; EBG00001044923.
DR   EnsemblGenomes-Gn; EBG00001044924.
DR   EnsemblGenomes-Gn; EBG00001044925.
DR   EnsemblGenomes-Gn; EBG00001044926.
DR   EnsemblGenomes-Gn; EBG00001044927.
DR   EnsemblGenomes-Gn; EBG00001044928.
DR   EnsemblGenomes-Gn; EBG00001044929.
DR   EnsemblGenomes-Gn; EBG00001044930.
DR   EnsemblGenomes-Gn; EBG00001044931.
DR   EnsemblGenomes-Gn; EBG00001044932.
DR   EnsemblGenomes-Gn; EBG00001044933.
DR   EnsemblGenomes-Gn; EBG00001044934.
DR   EnsemblGenomes-Gn; EBG00001044935.
DR   EnsemblGenomes-Gn; EBG00001044936.
DR   EnsemblGenomes-Gn; EBG00001044937.
DR   EnsemblGenomes-Gn; EBG00001044938.
DR   EnsemblGenomes-Gn; EBG00001044939.
DR   EnsemblGenomes-Gn; EBG00001044940.
DR   EnsemblGenomes-Gn; EBG00001044941.
DR   EnsemblGenomes-Gn; EBG00001044942.
DR   EnsemblGenomes-Gn; EBG00001044943.
DR   EnsemblGenomes-Gn; EBG00001044944.
DR   EnsemblGenomes-Gn; EBG00001044945.
DR   EnsemblGenomes-Gn; EBG00001044946.
DR   EnsemblGenomes-Gn; EBG00001044947.
DR   EnsemblGenomes-Gn; EBG00001044948.
DR   EnsemblGenomes-Gn; EBG00001044949.
DR   EnsemblGenomes-Gn; EBG00001044950.
DR   EnsemblGenomes-Gn; EBG00001044951.
DR   EnsemblGenomes-Gn; EBG00001044952.
DR   EnsemblGenomes-Gn; EBG00001044953.
DR   EnsemblGenomes-Gn; EBG00001044954.
DR   EnsemblGenomes-Gn; EBG00001044955.
DR   EnsemblGenomes-Gn; EBG00001044956.
DR   EnsemblGenomes-Gn; EBG00001044957.
DR   EnsemblGenomes-Gn; EBG00001044958.
DR   EnsemblGenomes-Gn; EBG00001044959.
DR   EnsemblGenomes-Gn; EBG00001044960.
DR   EnsemblGenomes-Gn; EBG00001044961.
DR   EnsemblGenomes-Gn; EBG00001044962.
DR   EnsemblGenomes-Gn; EBG00001044963.
DR   EnsemblGenomes-Gn; EBG00001044964.
DR   EnsemblGenomes-Gn; EBG00001044965.
DR   EnsemblGenomes-Gn; EBG00001044966.
DR   EnsemblGenomes-Gn; EBG00001044967.
DR   EnsemblGenomes-Gn; EBG00001044968.
DR   EnsemblGenomes-Gn; EBG00001044969.
DR   EnsemblGenomes-Gn; EBG00001044970.
DR   EnsemblGenomes-Gn; EBG00001044971.
DR   EnsemblGenomes-Gn; EBG00001044972.
DR   EnsemblGenomes-Gn; EBG00001044973.
DR   EnsemblGenomes-Gn; Z0213.
DR   EnsemblGenomes-Gn; Z0217.
DR   EnsemblGenomes-Gn; Z0218.
DR   EnsemblGenomes-Gn; Z0219.
DR   EnsemblGenomes-Gn; Z0226.
DR   EnsemblGenomes-Gn; Z0228.
DR   EnsemblGenomes-Gn; Z0242.
DR   EnsemblGenomes-Gn; Z0305.
DR   EnsemblGenomes-Gn; Z0422.
DR   EnsemblGenomes-Gn; Z0695.
DR   EnsemblGenomes-Gn; Z0813.
DR   EnsemblGenomes-Gn; Z0814.
DR   EnsemblGenomes-Gn; Z0815.
DR   EnsemblGenomes-Gn; Z0816.
DR   EnsemblGenomes-Gn; Z0817.
DR   EnsemblGenomes-Gn; Z0819.
DR   EnsemblGenomes-Gn; Z0820.
DR   EnsemblGenomes-Gn; Z0911.
DR   EnsemblGenomes-Gn; Z0912.
DR   EnsemblGenomes-Gn; Z0913.
DR   EnsemblGenomes-Gn; Z0914.
DR   EnsemblGenomes-Gn; Z0915.
DR   EnsemblGenomes-Gn; Z0917.
DR   EnsemblGenomes-Gn; Z1227.
DR   EnsemblGenomes-Gn; Z1388.
DR   EnsemblGenomes-Gn; Z1461.
DR   EnsemblGenomes-Gn; Z1462.
DR   EnsemblGenomes-Gn; Z1463.
DR   EnsemblGenomes-Gn; Z1665.
DR   EnsemblGenomes-Gn; Z1790.
DR   EnsemblGenomes-Gn; Z1792.
DR   EnsemblGenomes-Gn; Z2006.
DR   EnsemblGenomes-Gn; Z2007.
DR   EnsemblGenomes-Gn; Z2061.
DR   EnsemblGenomes-Gn; Z2062.
DR   EnsemblGenomes-Gn; Z2380.
DR   EnsemblGenomes-Gn; Z2381.
DR   EnsemblGenomes-Gn; Z2692.
DR   EnsemblGenomes-Gn; Z2693.
DR   EnsemblGenomes-Gn; Z2997.
DR   EnsemblGenomes-Gn; Z2998.
DR   EnsemblGenomes-Gn; Z2999.
DR   EnsemblGenomes-Gn; Z3110.
DR   EnsemblGenomes-Gn; Z3112.
DR   EnsemblGenomes-Gn; Z3113.
DR   EnsemblGenomes-Gn; Z3131.
DR   EnsemblGenomes-Gn; Z3133.
DR   EnsemblGenomes-Gn; Z3141.
DR   EnsemblGenomes-Gn; Z3145.
DR   EnsemblGenomes-Gn; Z3149.
DR   EnsemblGenomes-Gn; Z3448.
DR   EnsemblGenomes-Gn; Z3612.
DR   EnsemblGenomes-Gn; Z3661.
DR   EnsemblGenomes-Gn; Z3667.
DR   EnsemblGenomes-Gn; Z3668.
DR   EnsemblGenomes-Gn; Z3669.
DR   EnsemblGenomes-Gn; Z3670.
DR   EnsemblGenomes-Gn; Z3874.
DR   EnsemblGenomes-Gn; Z3875.
DR   EnsemblGenomes-Gn; Z3881.
DR   EnsemblGenomes-Gn; Z3882.
DR   EnsemblGenomes-Gn; Z3952.
DR   EnsemblGenomes-Gn; Z3992.
DR   EnsemblGenomes-Gn; Z3993.
DR   EnsemblGenomes-Gn; Z3995.
DR   EnsemblGenomes-Gn; Z3996.
DR   EnsemblGenomes-Gn; Z3997.
DR   EnsemblGenomes-Gn; Z4131.
DR   EnsemblGenomes-Gn; Z4132.
DR   EnsemblGenomes-Gn; Z4133.
DR   EnsemblGenomes-Gn; Z4202.
DR   EnsemblGenomes-Gn; Z4312.
DR   EnsemblGenomes-Gn; Z4422.
DR   EnsemblGenomes-Gn; Z4532.
DR   EnsemblGenomes-Gn; Z4536.
DR   EnsemblGenomes-Gn; Z4633.
DR   EnsemblGenomes-Gn; Z4635.
DR   EnsemblGenomes-Gn; Z4636.
DR   EnsemblGenomes-Gn; Z4637.
DR   EnsemblGenomes-Gn; Z4643.
DR   EnsemblGenomes-Gn; Z4644.
DR   EnsemblGenomes-Gn; Z4645.
DR   EnsemblGenomes-Gn; Z4963.
DR   EnsemblGenomes-Gn; Z5086.
DR   EnsemblGenomes-Gn; Z5259.
DR   EnsemblGenomes-Gn; Z5263.
DR   EnsemblGenomes-Gn; Z5264.
DR   EnsemblGenomes-Gn; Z5271.
DR   EnsemblGenomes-Gn; Z5273.
DR   EnsemblGenomes-Gn; Z5274.
DR   EnsemblGenomes-Gn; Z5308.
DR   EnsemblGenomes-Gn; Z5310.
DR   EnsemblGenomes-Gn; Z5311.
DR   EnsemblGenomes-Gn; Z5312.
DR   EnsemblGenomes-Gn; Z5373.
DR   EnsemblGenomes-Gn; Z5377.
DR   EnsemblGenomes-Gn; Z5378.
DR   EnsemblGenomes-Gn; Z5379.
DR   EnsemblGenomes-Gn; Z5386.
DR   EnsemblGenomes-Gn; Z5529.
DR   EnsemblGenomes-Gn; Z5533.
DR   EnsemblGenomes-Gn; Z5534.
DR   EnsemblGenomes-Gn; Z5541.
DR   EnsemblGenomes-Gn; Z5548.
DR   EnsemblGenomes-Gn; Z5550.
DR   EnsemblGenomes-Gn; Z5551.
DR   EnsemblGenomes-Gn; Z5552.
DR   EnsemblGenomes-Gn; Z5585.
DR   EnsemblGenomes-Gn; Z5588.
DR   EnsemblGenomes-Gn; Z5589.
DR   EnsemblGenomes-Gn; Z5596.
DR   EnsemblGenomes-Gn; Z5738.
DR   EnsemblGenomes-Gn; Z5770.
DR   EnsemblGenomes-Gn; Z5771.
DR   EnsemblGenomes-Gn; Z5772.
DR   EnsemblGenomes-Gn; Z5877.
DR   EnsemblGenomes-Gn; Z5971.
DR   EnsemblGenomes-Gn; Z6057.
DR   EnsemblGenomes-Gn; Z6058.
DR   EnsemblGenomes-Gn; Z6059.
DR   EnsemblGenomes-Tr; EBT00001645752.
DR   EnsemblGenomes-Tr; EBT00001645753.
DR   EnsemblGenomes-Tr; EBT00001645754.
DR   EnsemblGenomes-Tr; EBT00001645755.
DR   EnsemblGenomes-Tr; EBT00001645756.
DR   EnsemblGenomes-Tr; EBT00001645757.
DR   EnsemblGenomes-Tr; EBT00001645758.
DR   EnsemblGenomes-Tr; EBT00001645759.
DR   EnsemblGenomes-Tr; EBT00001645760.
DR   EnsemblGenomes-Tr; EBT00001645761.
DR   EnsemblGenomes-Tr; EBT00001645762.
DR   EnsemblGenomes-Tr; EBT00001645763.
DR   EnsemblGenomes-Tr; EBT00001645764.
DR   EnsemblGenomes-Tr; EBT00001645765.
DR   EnsemblGenomes-Tr; EBT00001645766.
DR   EnsemblGenomes-Tr; EBT00001645768.
DR   EnsemblGenomes-Tr; EBT00001645770.
DR   EnsemblGenomes-Tr; EBT00001645773.
DR   EnsemblGenomes-Tr; EBT00001645775.
DR   EnsemblGenomes-Tr; EBT00001645777.
DR   EnsemblGenomes-Tr; EBT00001645779.
DR   EnsemblGenomes-Tr; EBT00001645780.
DR   EnsemblGenomes-Tr; EBT00001645781.
DR   EnsemblGenomes-Tr; EBT00001645782.
DR   EnsemblGenomes-Tr; EBT00001645783.
DR   EnsemblGenomes-Tr; EBT00001645784.
DR   EnsemblGenomes-Tr; EBT00001645785.
DR   EnsemblGenomes-Tr; EBT00001645786.
DR   EnsemblGenomes-Tr; EBT00001645787.
DR   EnsemblGenomes-Tr; EBT00001645788.
DR   EnsemblGenomes-Tr; EBT00001645790.
DR   EnsemblGenomes-Tr; EBT00001645792.
DR   EnsemblGenomes-Tr; EBT00001645794.
DR   EnsemblGenomes-Tr; EBT00001645796.
DR   EnsemblGenomes-Tr; EBT00001645799.
DR   EnsemblGenomes-Tr; EBT00001645800.
DR   EnsemblGenomes-Tr; EBT00001645802.
DR   EnsemblGenomes-Tr; EBT00001645804.
DR   EnsemblGenomes-Tr; EBT00001645805.
DR   EnsemblGenomes-Tr; EBT00001645807.
DR   EnsemblGenomes-Tr; EBT00001645810.
DR   EnsemblGenomes-Tr; EBT00001645812.
DR   EnsemblGenomes-Tr; EBT00001645814.
DR   EnsemblGenomes-Tr; EBT00001645817.
DR   EnsemblGenomes-Tr; EBT00001645818.
DR   EnsemblGenomes-Tr; EBT00001645821.
DR   EnsemblGenomes-Tr; EBT00001645823.
DR   EnsemblGenomes-Tr; EBT00001645827.
DR   EnsemblGenomes-Tr; EBT00001645828.
DR   EnsemblGenomes-Tr; EBT00001645830.
DR   EnsemblGenomes-Tr; EBT00001645832.
DR   EnsemblGenomes-Tr; EBT00001645833.
DR   EnsemblGenomes-Tr; EBT00001645835.
DR   EnsemblGenomes-Tr; EBT00001645836.
DR   EnsemblGenomes-Tr; EBT00001645838.
DR   EnsemblGenomes-Tr; EBT00001645840.
DR   EnsemblGenomes-Tr; EBT00001645843.
DR   EnsemblGenomes-Tr; EBT00001645845.
DR   EnsemblGenomes-Tr; EBT00001645846.
DR   EnsemblGenomes-Tr; EBT00001645847.
DR   EnsemblGenomes-Tr; EBT00001645849.
DR   EnsemblGenomes-Tr; EBT00001645851.
DR   EnsemblGenomes-Tr; EBT00001645852.
DR   EnsemblGenomes-Tr; EBT00001645853.
DR   EnsemblGenomes-Tr; EBT00001645855.
DR   EnsemblGenomes-Tr; EBT00001645856.
DR   EnsemblGenomes-Tr; EBT00001645857.
DR   EnsemblGenomes-Tr; EBT00001645858.
DR   EnsemblGenomes-Tr; EBT00001645859.
DR   EnsemblGenomes-Tr; EBT00001645861.
DR   EnsemblGenomes-Tr; EBT00001645863.
DR   EnsemblGenomes-Tr; EBT00001645866.
DR   EnsemblGenomes-Tr; EBT00001645868.
DR   EnsemblGenomes-Tr; EBT00001645869.
DR   EnsemblGenomes-Tr; EBT00001645870.
DR   EnsemblGenomes-Tr; EBT00001645872.
DR   EnsemblGenomes-Tr; EBT00001645874.
DR   EnsemblGenomes-Tr; EBT00001645875.
DR   EnsemblGenomes-Tr; EBT00001645876.
DR   EnsemblGenomes-Tr; EBT00001645878.
DR   EnsemblGenomes-Tr; EBT00001645879.
DR   EnsemblGenomes-Tr; EBT00001645881.
DR   EnsemblGenomes-Tr; EBT00001645883.
DR   EnsemblGenomes-Tr; EBT00001645886.
DR   EnsemblGenomes-Tr; EBT00001645888.
DR   EnsemblGenomes-Tr; EBT00001645890.
DR   EnsemblGenomes-Tr; EBT00001645893.
DR   EnsemblGenomes-Tr; EBT00001645894.
DR   EnsemblGenomes-Tr; EBT00001645897.
DR   EnsemblGenomes-Tr; EBT00001645898.
DR   EnsemblGenomes-Tr; EBT00001645901.
DR   EnsemblGenomes-Tr; EBT00001645902.
DR   EnsemblGenomes-Tr; EBT00001645903.
DR   EnsemblGenomes-Tr; EBT00001645904.
DR   EnsemblGenomes-Tr; EBT00001645906.
DR   EnsemblGenomes-Tr; EBT00001645908.
DR   EnsemblGenomes-Tr; EBT00001645909.
DR   EnsemblGenomes-Tr; EBT00001645911.
DR   EnsemblGenomes-Tr; EBT00001645914.
DR   EnsemblGenomes-Tr; EBT00001645915.
DR   EnsemblGenomes-Tr; EBT00001645916.
DR   EnsemblGenomes-Tr; EBT00001645917.
DR   EnsemblGenomes-Tr; EBT00001645918.
DR   EnsemblGenomes-Tr; EBT00001645919.
DR   EnsemblGenomes-Tr; EBT00001645920.
DR   EnsemblGenomes-Tr; EBT00001645921.
DR   EnsemblGenomes-Tr; EBT00001645922.
DR   EnsemblGenomes-Tr; EBT00001645923.
DR   EnsemblGenomes-Tr; EBT00001645925.
DR   EnsemblGenomes-Tr; EBT00001645926.
DR   EnsemblGenomes-Tr; EBT00001645927.
DR   EnsemblGenomes-Tr; EBT00001645928.
DR   EnsemblGenomes-Tr; EBT00001645929.
DR   EnsemblGenomes-Tr; EBT00001645931.
DR   EnsemblGenomes-Tr; EBT00001645934.
DR   EnsemblGenomes-Tr; EBT00001645936.
DR   EnsemblGenomes-Tr; EBT00001645938.
DR   EnsemblGenomes-Tr; EBT00001645940.
DR   EnsemblGenomes-Tr; EBT00001645941.
DR   EnsemblGenomes-Tr; EBT00001645943.
DR   EnsemblGenomes-Tr; EBT00001645945.
DR   EnsemblGenomes-Tr; EBT00001645946.
DR   EnsemblGenomes-Tr; EBT00001645947.
DR   EnsemblGenomes-Tr; EBT00001645948.
DR   EnsemblGenomes-Tr; EBT00001645950.
DR   EnsemblGenomes-Tr; EBT00001645951.
DR   EnsemblGenomes-Tr; EBT00001645952.
DR   EnsemblGenomes-Tr; EBT00001645954.
DR   EnsemblGenomes-Tr; EBT00001645956.
DR   EnsemblGenomes-Tr; EBT00001645959.
DR   EnsemblGenomes-Tr; EBT00001645960.
DR   EnsemblGenomes-Tr; EBT00001645963.
DR   EnsemblGenomes-Tr; EBT00001645965.
DR   EnsemblGenomes-Tr; EBT00001645967.
DR   EnsemblGenomes-Tr; EBT00001645969.
DR   EnsemblGenomes-Tr; EBT00001645971.
DR   EnsemblGenomes-Tr; EBT00001645973.
DR   EnsemblGenomes-Tr; EBT00001645976.
DR   EnsemblGenomes-Tr; EBT00001645978.
DR   EnsemblGenomes-Tr; EBT00001645979.
DR   EnsemblGenomes-Tr; EBT00001645980.
DR   EnsemblGenomes-Tr; EBT00001645981.
DR   EnsemblGenomes-Tr; EBT00001645983.
DR   EnsemblGenomes-Tr; EBT00001645985.
DR   EnsemblGenomes-Tr; EBT00001645988.
DR   EnsemblGenomes-Tr; EBT00001645989.
DR   EnsemblGenomes-Tr; EBT00001645990.
DR   EnsemblGenomes-Tr; EBT00001645993.
DR   EnsemblGenomes-Tr; EBT00001645996.
DR   EnsemblGenomes-Tr; EBT00001645998.
DR   EnsemblGenomes-Tr; EBT00001645999.
DR   EnsemblGenomes-Tr; EBT00001646000.
DR   EnsemblGenomes-Tr; EBT00001646002.
DR   EnsemblGenomes-Tr; EBT00001646004.
DR   EnsemblGenomes-Tr; EBT00001646006.
DR   EnsemblGenomes-Tr; EBT00001646008.
DR   EnsemblGenomes-Tr; EBT00001646010.
DR   EnsemblGenomes-Tr; EBT00001646013.
DR   EnsemblGenomes-Tr; EBT00001646015.
DR   EnsemblGenomes-Tr; EBT00001646016.
DR   EnsemblGenomes-Tr; EBT00001646018.
DR   EnsemblGenomes-Tr; EBT00001646021.
DR   EnsemblGenomes-Tr; EBT00001646023.
DR   EnsemblGenomes-Tr; EBT00001646025.
DR   EnsemblGenomes-Tr; EBT00001646028.
DR   EnsemblGenomes-Tr; EBT00001646029.
DR   EnsemblGenomes-Tr; EBT00001646031.
DR   EnsemblGenomes-Tr; EBT00001646032.
DR   EnsemblGenomes-Tr; EBT00001646034.
DR   EnsemblGenomes-Tr; EBT00001646036.
DR   EnsemblGenomes-Tr; EBT00001646038.
DR   EnsemblGenomes-Tr; EBT00001646040.
DR   EnsemblGenomes-Tr; EBT00001646041.
DR   EnsemblGenomes-Tr; EBT00001646043.
DR   EnsemblGenomes-Tr; EBT00001646045.
DR   EnsemblGenomes-Tr; EBT00001646047.
DR   EnsemblGenomes-Tr; EBT00001646049.
DR   EnsemblGenomes-Tr; EBT00001646050.
DR   EnsemblGenomes-Tr; EBT00001646052.
DR   EnsemblGenomes-Tr; EBT00001646054.
DR   EnsemblGenomes-Tr; EBT00001646056.
DR   EnsemblGenomes-Tr; EBT00001646058.
DR   EnsemblGenomes-Tr; EBT00001646060.
DR   EnsemblGenomes-Tr; EBT00001646062.
DR   EnsemblGenomes-Tr; EBT00001646064.
DR   EnsemblGenomes-Tr; EBT00001646069.
DR   EnsemblGenomes-Tr; EBT00001646070.
DR   EnsemblGenomes-Tr; EBT00001646071.
DR   EnsemblGenomes-Tr; EBT00001646073.
DR   EnsemblGenomes-Tr; EBT00001646074.
DR   EnsemblGenomes-Tr; EBT00001646076.
DR   EnsemblGenomes-Tr; EBT00001646077.
DR   EnsemblGenomes-Tr; EBT00001646079.
DR   EnsemblGenomes-Tr; EBT00001646082.
DR   EnsemblGenomes-Tr; EBT00001646083.
DR   EnsemblGenomes-Tr; EBT00001646084.
DR   EnsemblGenomes-Tr; EBT00001646086.
DR   EnsemblGenomes-Tr; EBT00001646089.
DR   EnsemblGenomes-Tr; EBT00001646092.
DR   EnsemblGenomes-Tr; EBT00001646094.
DR   EnsemblGenomes-Tr; EBT00001646096.
DR   EnsemblGenomes-Tr; EBT00001646098.
DR   EnsemblGenomes-Tr; EBT00001646099.
DR   EnsemblGenomes-Tr; EBT00001646101.
DR   EnsemblGenomes-Tr; EBT00001646103.
DR   EnsemblGenomes-Tr; EBT00001646107.
DR   EnsemblGenomes-Tr; EBT00001646108.
DR   EnsemblGenomes-Tr; EBT00001646111.
DR   EnsemblGenomes-Tr; EBT00001646112.
DR   EnsemblGenomes-Tr; EBT00001646113.
DR   EnsemblGenomes-Tr; EBT00001646115.
DR   EnsemblGenomes-Tr; EBT00001646117.
DR   EnsemblGenomes-Tr; EBT00001646119.
DR   EnsemblGenomes-Tr; EBT00001646121.
DR   EnsemblGenomes-Tr; EBT00001646123.
DR   EnsemblGenomes-Tr; EBT00001646125.
DR   EnsemblGenomes-Tr; EBT00001646127.
DR   EnsemblGenomes-Tr; EBT00001646128.
DR   EnsemblGenomes-Tr; EBT00001646129.
DR   EnsemblGenomes-Tr; EBT00001646130.
DR   EnsemblGenomes-Tr; EBT00001646133.
DR   EnsemblGenomes-Tr; EBT00001646134.
DR   EnsemblGenomes-Tr; EBT00001646136.
DR   EnsemblGenomes-Tr; EBT00001646139.
DR   EnsemblGenomes-Tr; EBT00001646141.
DR   EnsemblGenomes-Tr; EBT00001646143.
DR   EnsemblGenomes-Tr; EBT00001646145.
DR   EnsemblGenomes-Tr; EBT00001646146.
DR   EnsemblGenomes-Tr; EBT00001646147.
DR   EnsemblGenomes-Tr; EBT00001646150.
DR   EnsemblGenomes-Tr; EBT00001646152.
DR   EnsemblGenomes-Tr; EBT00001646154.
DR   EnsemblGenomes-Tr; EBT00001646156.
DR   EnsemblGenomes-Tr; EBT00001646158.
DR   EnsemblGenomes-Tr; EBT00001646160.
DR   EnsemblGenomes-Tr; EBT00001646162.
DR   EnsemblGenomes-Tr; EBT00001646164.
DR   EnsemblGenomes-Tr; EBT00001646166.
DR   EnsemblGenomes-Tr; EBT00001646167.
DR   EnsemblGenomes-Tr; EBT00001646168.
DR   EnsemblGenomes-Tr; EBT00001646171.
DR   EnsemblGenomes-Tr; EBT00001646172.
DR   EnsemblGenomes-Tr; EBT00001646174.
DR   EnsemblGenomes-Tr; EBT00001646176.
DR   EnsemblGenomes-Tr; EBT00001646177.
DR   EnsemblGenomes-Tr; EBT00001646179.
DR   EnsemblGenomes-Tr; EBT00001646181.
DR   EnsemblGenomes-Tr; EBT00001646183.
DR   EnsemblGenomes-Tr; EBT00001646187.
DR   EnsemblGenomes-Tr; EBT00001646189.
DR   EnsemblGenomes-Tr; EBT00001646191.
DR   EnsemblGenomes-Tr; EBT00001646194.
DR   EnsemblGenomes-Tr; EBT00001646197.
DR   EnsemblGenomes-Tr; EBT00001646199.
DR   EnsemblGenomes-Tr; EBT00001646200.
DR   EnsemblGenomes-Tr; EBT00001646202.
DR   EnsemblGenomes-Tr; EBT00001646204.
DR   EnsemblGenomes-Tr; EBT00001646205.
DR   EnsemblGenomes-Tr; EBT00001646207.
DR   EnsemblGenomes-Tr; EBT00001646208.
DR   EnsemblGenomes-Tr; EBT00001646210.
DR   EnsemblGenomes-Tr; EBT00001646212.
DR   EnsemblGenomes-Tr; EBT00001646215.
DR   EnsemblGenomes-Tr; EBT00001646217.
DR   EnsemblGenomes-Tr; EBT00001646219.
DR   EnsemblGenomes-Tr; EBT00001646220.
DR   EnsemblGenomes-Tr; EBT00001646223.
DR   EnsemblGenomes-Tr; Z0213-1.
DR   EnsemblGenomes-Tr; Z0217-1.
DR   EnsemblGenomes-Tr; Z0218-1.
DR   EnsemblGenomes-Tr; Z0219-1.
DR   EnsemblGenomes-Tr; Z0226-1.
DR   EnsemblGenomes-Tr; Z0228-1.
DR   EnsemblGenomes-Tr; Z0242-1.
DR   EnsemblGenomes-Tr; Z0305-1.
DR   EnsemblGenomes-Tr; Z0422-1.
DR   EnsemblGenomes-Tr; Z0695-1.
DR   EnsemblGenomes-Tr; Z0813-1.
DR   EnsemblGenomes-Tr; Z0814-1.
DR   EnsemblGenomes-Tr; Z0815-1.
DR   EnsemblGenomes-Tr; Z0816-1.
DR   EnsemblGenomes-Tr; Z0817-1.
DR   EnsemblGenomes-Tr; Z0819-1.
DR   EnsemblGenomes-Tr; Z0820-1.
DR   EnsemblGenomes-Tr; Z0911-1.
DR   EnsemblGenomes-Tr; Z0912-1.
DR   EnsemblGenomes-Tr; Z0913-1.
DR   EnsemblGenomes-Tr; Z0914-1.
DR   EnsemblGenomes-Tr; Z0915-1.
DR   EnsemblGenomes-Tr; Z0917-1.
DR   EnsemblGenomes-Tr; Z1227-1.
DR   EnsemblGenomes-Tr; Z1388-1.
DR   EnsemblGenomes-Tr; Z1461-1.
DR   EnsemblGenomes-Tr; Z1462-1.
DR   EnsemblGenomes-Tr; Z1463-1.
DR   EnsemblGenomes-Tr; Z1665-1.
DR   EnsemblGenomes-Tr; Z1790-1.
DR   EnsemblGenomes-Tr; Z1792-1.
DR   EnsemblGenomes-Tr; Z2006-1.
DR   EnsemblGenomes-Tr; Z2007-1.
DR   EnsemblGenomes-Tr; Z2061-1.
DR   EnsemblGenomes-Tr; Z2062-1.
DR   EnsemblGenomes-Tr; Z2380-1.
DR   EnsemblGenomes-Tr; Z2381-1.
DR   EnsemblGenomes-Tr; Z2692-1.
DR   EnsemblGenomes-Tr; Z2693-1.
DR   EnsemblGenomes-Tr; Z2997-1.
DR   EnsemblGenomes-Tr; Z2998-1.
DR   EnsemblGenomes-Tr; Z2999-1.
DR   EnsemblGenomes-Tr; Z3110-1.
DR   EnsemblGenomes-Tr; Z3112-1.
DR   EnsemblGenomes-Tr; Z3113-1.
DR   EnsemblGenomes-Tr; Z3131-1.
DR   EnsemblGenomes-Tr; Z3133-1.
DR   EnsemblGenomes-Tr; Z3141-1.
DR   EnsemblGenomes-Tr; Z3145-1.
DR   EnsemblGenomes-Tr; Z3149-1.
DR   EnsemblGenomes-Tr; Z3448-1.
DR   EnsemblGenomes-Tr; Z3612-1.
DR   EnsemblGenomes-Tr; Z3661-1.
DR   EnsemblGenomes-Tr; Z3667-1.
DR   EnsemblGenomes-Tr; Z3668-1.
DR   EnsemblGenomes-Tr; Z3669-1.
DR   EnsemblGenomes-Tr; Z3670-1.
DR   EnsemblGenomes-Tr; Z3874-1.
DR   EnsemblGenomes-Tr; Z3875-1.
DR   EnsemblGenomes-Tr; Z3881-1.
DR   EnsemblGenomes-Tr; Z3882-1.
DR   EnsemblGenomes-Tr; Z3952-1.
DR   EnsemblGenomes-Tr; Z3992-1.
DR   EnsemblGenomes-Tr; Z3993-1.
DR   EnsemblGenomes-Tr; Z3995-1.
DR   EnsemblGenomes-Tr; Z3996-1.
DR   EnsemblGenomes-Tr; Z3997-1.
DR   EnsemblGenomes-Tr; Z4131-1.
DR   EnsemblGenomes-Tr; Z4132-1.
DR   EnsemblGenomes-Tr; Z4133-1.
DR   EnsemblGenomes-Tr; Z4202-1.
DR   EnsemblGenomes-Tr; Z4312-1.
DR   EnsemblGenomes-Tr; Z4422-1.
DR   EnsemblGenomes-Tr; Z4532-1.
DR   EnsemblGenomes-Tr; Z4536-1.
DR   EnsemblGenomes-Tr; Z4633-1.
DR   EnsemblGenomes-Tr; Z4635-1.
DR   EnsemblGenomes-Tr; Z4636-1.
DR   EnsemblGenomes-Tr; Z4637-1.
DR   EnsemblGenomes-Tr; Z4643-1.
DR   EnsemblGenomes-Tr; Z4644-1.
DR   EnsemblGenomes-Tr; Z4645-1.
DR   EnsemblGenomes-Tr; Z4963-1.
DR   EnsemblGenomes-Tr; Z5086-1.
DR   EnsemblGenomes-Tr; Z5259-1.
DR   EnsemblGenomes-Tr; Z5263-1.
DR   EnsemblGenomes-Tr; Z5264-1.
DR   EnsemblGenomes-Tr; Z5271-1.
DR   EnsemblGenomes-Tr; Z5273-1.
DR   EnsemblGenomes-Tr; Z5274-1.
DR   EnsemblGenomes-Tr; Z5308-1.
DR   EnsemblGenomes-Tr; Z5310-1.
DR   EnsemblGenomes-Tr; Z5311-1.
DR   EnsemblGenomes-Tr; Z5312-1.
DR   EnsemblGenomes-Tr; Z5373-1.
DR   EnsemblGenomes-Tr; Z5377-1.
DR   EnsemblGenomes-Tr; Z5378-1.
DR   EnsemblGenomes-Tr; Z5379-1.
DR   EnsemblGenomes-Tr; Z5386-1.
DR   EnsemblGenomes-Tr; Z5529-1.
DR   EnsemblGenomes-Tr; Z5533-1.
DR   EnsemblGenomes-Tr; Z5534-1.
DR   EnsemblGenomes-Tr; Z5541-1.
DR   EnsemblGenomes-Tr; Z5548-1.
DR   EnsemblGenomes-Tr; Z5550-1.
DR   EnsemblGenomes-Tr; Z5551-1.
DR   EnsemblGenomes-Tr; Z5552-1.
DR   EnsemblGenomes-Tr; Z5585-1.
DR   EnsemblGenomes-Tr; Z5588-1.
DR   EnsemblGenomes-Tr; Z5589-1.
DR   EnsemblGenomes-Tr; Z5596-1.
DR   EnsemblGenomes-Tr; Z5738-1.
DR   EnsemblGenomes-Tr; Z5770-1.
DR   EnsemblGenomes-Tr; Z5771-1.
DR   EnsemblGenomes-Tr; Z5772-1.
DR   EnsemblGenomes-Tr; Z5877-1.
DR   EnsemblGenomes-Tr; Z5971-1.
DR   EnsemblGenomes-Tr; Z6057-1.
DR   EnsemblGenomes-Tr; Z6058-1.
DR   EnsemblGenomes-Tr; Z6059-1.
DR   EuropePMC; PMC1087426; 15784583.
DR   EuropePMC; PMC123954; 12039721.
DR   EuropePMC; PMC1272980; 16237038.
DR   EuropePMC; PMC128238; 12183566.
DR   EuropePMC; PMC135096; 12029051.
DR   EuropePMC; PMC135296; 12169592.
DR   EuropePMC; PMC1386717; 16423288.
DR   EuropePMC; PMC1418941; 16552063.
DR   EuropePMC; PMC149678; 12574266.
DR   EuropePMC; PMC154664; 12734215.
DR   EuropePMC; PMC155755; 12761152.
DR   EuropePMC; PMC1698345; 17088369.
DR   EuropePMC; PMC1779527; 16737554.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC1828755; 17220264.
DR   EuropePMC; PMC1829071; 17108073.
DR   EuropePMC; PMC1855899; 17351047.
DR   EuropePMC; PMC1913345; 17322310.
DR   EuropePMC; PMC1995754; 17925872.
DR   EuropePMC; PMC2258581; 18083883.
DR   EuropePMC; PMC2268344; 18216214.
DR   EuropePMC; PMC2394748; 17547764.
DR   EuropePMC; PMC2446816; 18441064.
DR   EuropePMC; PMC2566221; 18676672.
DR   EuropePMC; PMC2612248; 18981247.
DR   EuropePMC; PMC2663176; 19179421.
DR   EuropePMC; PMC2745777; 19570210.
DR   EuropePMC; PMC2782684; 19019141.
DR   EuropePMC; PMC2808357; 20098708.
DR   EuropePMC; PMC2813021; 19948859.
DR   EuropePMC; PMC2832396; 20038689.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC2918981; 20581183.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC2974192; 20623278.
DR   EuropePMC; PMC2976316; 20823207.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3064760; 21299654.
DR   EuropePMC; PMC3068680; 20378655.
DR   EuropePMC; PMC308975; 14662916.
DR   EuropePMC; PMC3133052; 21317333.
DR   EuropePMC; PMC3133550; 21689465.
DR   EuropePMC; PMC3147399; 21622790.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC317293; 14672541.
DR   EuropePMC; PMC317353; 14664722.
DR   EuropePMC; PMC3209187; 21908635.
DR   EuropePMC; PMC3218036; 22110755.
DR   EuropePMC; PMC3256229; 22253910.
DR   EuropePMC; PMC3273018; 22179243.
DR   EuropePMC; PMC3318423; 22252878.
DR   EuropePMC; PMC3346384; 22447607.
DR   EuropePMC; PMC3416394; 22582067.
DR   EuropePMC; PMC3416439; 22635992.
DR   EuropePMC; PMC3416474; 22526675.
DR   EuropePMC; PMC3417533; 22919600.
DR   EuropePMC; PMC3434749; 22522897.
DR   EuropePMC; PMC3457275; 22811533.
DR   EuropePMC; PMC3503007; 23035199.
DR   EuropePMC; PMC3536084; 23104414.
DR   EuropePMC; PMC3584874; 23275093.
DR   EuropePMC; PMC3623240; 23377937.
DR   EuropePMC; PMC3641635; 23493634.
DR   EuropePMC; PMC3666763; 23325824.
DR   EuropePMC; PMC3675940; 23563955.
DR   EuropePMC; PMC3695514; 23625966.
DR   EuropePMC; PMC3771896; 24069274.
DR   EuropePMC; PMC3777172; 24093095.
DR   EuropePMC; PMC3811616; 23884997.
DR   EuropePMC; PMC3897532; 24465756.
DR   EuropePMC; PMC3957642; 24413602.
DR   EuropePMC; PMC4060028; 24987616.
DR   EuropePMC; PMC4076223; 24979038.
DR   EuropePMC; PMC4097640; 24799627.
DR   EuropePMC; PMC4136169; 24899022.
DR   EuropePMC; PMC4148811; 24858089.
DR   EuropePMC; PMC4172979; 25276419.
DR   EuropePMC; PMC4209514; 25349632.
DR   EuropePMC; PMC427851; 15184409.
DR   EuropePMC; PMC4279260; 25579622.
DR   EuropePMC; PMC4309606; 25629697.
DR   EuropePMC; PMC4325149; 25548040.
DR   EuropePMC; PMC4391668; 25889651.
DR   EuropePMC; PMC4399054; 25667270.
DR   EuropePMC; PMC4495197; 26002893.
DR   EuropePMC; PMC4609730; 26292302.
DR   EuropePMC; PMC4615214; 25751035.
DR   EuropePMC; PMC4763077; 26941726.
DR   EuropePMC; PMC4764202; 26900701.
DR   EuropePMC; PMC4875606; 27206522.
DR   EuropePMC; PMC4897388; 27379312.
DR   EuropePMC; PMC4945794; 27417834.
DR   EuropePMC; PMC5038053; 27474715.
DR   EuropePMC; PMC5083709; 27840628.
DR   EuropePMC; PMC517426; 15322038.
DR   EuropePMC; PMC5331693; 28245801.
DR   EuropePMC; PMC540180; 15634952.
DR   EuropePMC; PMC5429811; 28404985.
DR   EuropePMC; PMC546176; 15640440.
DR   EuropePMC; PMC549229; 15728886.
DR   EuropePMC; PMC5583481; 28687651.
DR   EuropePMC; PMC5829826; 29487233.
DR   EuropePMC; PMC5915783; 29507091.
DR   EuropePMC; PMC6199705; 30352567.
DR   EuropePMC; PMC93071; 11472947.
DR   EuropePMC; PMC93247; 11571200.
DR   GOA; P0ACG7.
DR   GOA; P0ADG6.
DR   GOA; P0C1Y6.
DR   GOA; P0CJ67.
DR   GOA; P61468.
DR   InterPro; IPR000760; Inositol_monophosphatase-like.
DR   InterPro; IPR002696; Membr_insert_effic_factor.
DR   InterPro; IPR009624; UPF0253.
DR   InterPro; IPR020583; Inositol_monoP_metal-BS.
DR   InterPro; IPR020870; UPF0387_membrane.
DR   InterPro; IPR022337; Inositol_monophosphatase_SuhB.
DR   InterPro; IPR028955; Imm57.
DR   InterPro; IPR033942; IMPase.
DR   InterPro; IPR038570; HicA_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00262; sar.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00372; sroH.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02083; OrzO-P.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02111; IS009.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; AE005174.
DR   SILVA-SSU; AE005174.
DR   StrainInfo; 118705; 0.
DR   UniProtKB/Swiss-Prot; P0A8K6; YAEP_ECO57.
DR   UniProtKB/Swiss-Prot; P0ACG7; HOKD_ECO57.
DR   UniProtKB/Swiss-Prot; P0ACW1; YDAF_ECO57.
DR   UniProtKB/Swiss-Prot; P0ADG6; SUHB_ECO57.
DR   UniProtKB/Swiss-Prot; P0C1Y6; YOHO_ECO57.
DR   UniProtKB/Swiss-Prot; P0C265; YIBT_ECO57.
DR   UniProtKB/Swiss-Prot; P0CJ67; HICA_ECO57.
DR   UniProtKB/Swiss-Prot; P61468; YIDD_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X2F6; YAFF_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X2T9; YIBV_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X2V7; YCHS_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X367; YAHH_ECO57.
XX
CC   On or before Dec 6, 2004 this sequence version replaced AE005177.1,
CC   AE005178.1, AE005179.1, AE005180.1, AE005181.1, AE005182.1,
CC   AE005183.1, AE005184.1, AE005185.1, AE005186.1, AE005187.1,
CC   AE005188.1, AE005189.1, AE005190.1, AE005191.1, AE005192.1,
CC   AE005193.1, AE005194.1, AE005195.1, AE005196.1, AE005197.1,
CC   AE005198.1, AE005199.1, AE005200.1, AE005201.1, AE005202.1,
CC   AE005203.1, AE005204.1, AE005205.1, AE005206.1, AE005207.1,
CC   AE005208.1, AE005209.1, AE005210.1, AE005211.1, AE005212.1,
CC   AE005213.1, AE005214.1, AE005215.1, AE005216.1, AE005217.1,
CC   AE005218.1, AE005219.1, AE005220.1, AE005221.1, AE005222.1,
CC   AE005223.1, AE005224.1, AE005225.1, AE005226.1, AE005227.1,
CC   AE005228.1, AE005229.1, AE005230.1, AE005231.1, AE005232.1,
CC   AE005233.1, AE005234.1, AE005235.1, AE005236.1, AE005237.1,
CC   AE005238.1, AE005239.1, AE005240.1, AE005241.1, AE005242.1,
CC   AE005243.1, AE005244.1, AE005245.1, AE005246.1, AE005247.1,
CC   AE005248.1, AE005249.1, AE005250.1, AE005251.1, AE005252.1,
CC   AE005253.1, AE005254.1, AE005255.1, AE005256.1, AE005257.1,
CC   AE005258.1, AE005259.1, AE005260.1, AE005261.1, AE005262.1,
CC   AE005263.1, AE005264.1, AE005265.1, AE005266.1, AE005267.1,
CC   AE005268.1, AE005269.1, AE005270.1, AE005271.1, AE005272.1,
CC   AE005273.1, AE005274.1, AE005275.1, AE005276.1, AE005277.1,
CC   AE005278.1, AE005279.1, AE005280.1, AE005281.1, AE005282.1,
CC   AE005283.1, AE005284.1, AE005285.1, AE005286.1, AE005287.1,
CC   AE005288.1, AE005289.1, AE005290.1, AE005291.1, AE005292.1,
CC   AE005293.1, AE005294.1, AE005295.1, AE005296.1, AE005297.1,
CC   AE005298.1, AE005299.1, AE005300.1, AE005301.1, AE005302.1,
CC   AE005303.1, AE005304.1, AE005305.1, AE005306.1, AE005307.1,
CC   AE005308.1, AE005309.1, AE005310.1, AE005311.1, AE005312.1,
CC   AE005313.1, AE005314.1, AE005315.1, AE005316.1, AE005317.1,
CC   AE005318.1, AE005319.1, AE005320.1, AE005321.1, AE005322.1,
CC   AE005323.1, AE005324.1, AE005325.1, AE005326.1, AE005327.1,
CC   AE005328.1, AE005329.1, AE005330.1, AE005331.1, AE005332.1,
CC   AE005333.1, AE005334.1, AE005335.1, AE005336.1, AE005337.1,
CC   AE005338.1, AE005339.1, AE005340.1, AE005341.1, AE005342.1,
CC   AE005343.1, AE005344.1, AE005345.1, AE005346.1, AE005347.1,
CC   AE005348.1, AE005349.1, AE005350.1, AE005351.1, AE005352.1,
CC   AE005353.1, AE005354.1, AE005355.1, AE005356.1, AE005357.1,
CC   AE005358.1, AE005359.1, AE005360.1, AE005361.1, AE005362.1,
CC   AE005363.1, AE005364.1, AE005365.1, AE005366.1, AE005367.1,
CC   AE005368.1, AE005369.1, AE005370.1, AE005371.1, AE005372.1,
CC   AE005373.1, AE005374.1, AE005375.1, AE005376.1, AE005377.1,
CC   AE005378.1, AE005379.1, AE005380.1, AE005381.2, AE005382.2,
CC   AE005383.1, AE005384.1, AE005385.1, AE005386.1, AE005387.1,
CC   AE005388.1, AE005389.1, AE005390.1, AE005391.1, AE005392.1,
CC   AE005393.1, AE005394.1, AE005395.1, AE005396.1, AE005397.1,
CC   AE005398.1, AE005399.1, AE005400.1, AE005401.1, AE005402.1,
CC   AE005403.1, AE005404.1, AE005405.1, AE005406.1, AE005407.1,
CC   AE005408.1, AE005409.1, AE005410.1, AE005411.1, AE005412.1,
CC   AE005413.1, AE005414.1, AE005415.1, AE005416.1, AE005417.1,
CC   AE005418.1, AE005419.1, AE005420.1, AE005421.1, AE005422.1,
CC   AE005423.1, AE005424.1, AE005425.1, AE005426.1, AE005427.1,
CC   AE005428.1, AE005429.1, AE005430.1, AE005431.1, AE005432.1,
CC   AE005433.1, AE005434.1, AE005435.1, AE005436.1, AE005437.1,
CC   AE005438.1, AE005439.1, AE005440.1, AE005441.1, AE005442.1,
CC   AE005443.1, AE005444.1, AE005445.1, AE005446.1, AE005447.1,
CC   AE005448.1, AE005449.1, AE005450.1, AE005451.1, AE005452.1,
CC   AE005453.1, AE005454.1, AE005455.1, AE005456.1, AE005457.1,
CC   AE005458.1, AE005459.1, AE005460.1, AE005461.1, AE005462.1,
CC   AE005463.1, AE005464.1, AE005465.1, AE005466.1, AE005467.1,
CC   AE005468.1, AE005469.1, AE005470.1, AE005471.1, AE005472.1,
CC   AE005473.1, AE005474.1, AE005475.1, AE005476.1, AE005477.1,
CC   AE005478.1, AE005479.1, AE005480.1, AE005481.1, AE005482.1,
CC   AE005483.1, AE005484.1, AE005485.1, AE005486.1, AE005487.1,
CC   AE005488.1, AE005489.1, AE005490.1, AE005491.1, AE005492.1,
CC   AE005493.1, AE005494.1, AE005495.1, AE005496.1, AE005497.1,
CC   AE005498.1, AE005499.1, AE005500.1, AE005501.1, AE005502.1,
CC   AE005503.1, AE005504.1, AE005505.1, AE005506.1, AE005507.1,
CC   AE005508.1, AE005509.1, AE005510.1, AE005511.1, AE005512.1,
CC   AE005513.1, AE005514.1, AE005515.1, AE005516.1, AE005517.1,
CC   AE005518.1, AE005519.1, AE005520.1, AE005521.1, AE005522.1,
CC   AE005523.1, AE005524.1, AE005525.1, AE005526.1, AE005527.1,
CC   AE005528.1, AE005529.1, AE005530.1, AE005531.1, AE005532.1,
CC   AE005533.1, AE005534.1, AE005535.1, AE005536.1, AE005537.1,
CC   AE005538.1, AE005539.1, AE005540.1, AE005541.1, AE005542.1,
CC   AE005543.1, AE005544.1, AE005545.1, AE005546.1, AE005547.1,
CC   AE005548.1, AE005549.1, AE005550.1, AE005551.1, AE005552.1,
CC   AE005553.1, AE005554.1, AE005555.1, AE005556.1, AE005557.1,
CC   AE005558.1, AE005559.1, AE005560.1, AE005561.1, AE005562.1,
CC   AE005563.1, AE005564.1, AE005565.1, AE005566.1, AE005567.1,
CC   AE005568.1, AE005569.1, AE005570.1, AE005571.1, AE005572.1,
CC   AE005573.1, AE005574.1, AE005575.1, AE005576.1, AE005577.1,
CC   AE005578.1, AE005579.1, AE005580.1, AE005581.1, AE005582.1,
CC   AE005583.1, AE005584.1, AE005585.1, AE005586.1, AE005587.1,
CC   AE005588.1, AE005589.1, AE005590.1, AE005591.1, AE005592.1,
CC   AE005593.1, AE005594.1, AE005595.1, AE005596.1, AE005597.1,
CC   AE005598.1, AE005599.1, AE005600.1, AE005601.1, AE005602.1,
CC   AE005603.1, AE005604.1, AE005605.1, AE005606.1, AE005607.1,
CC   AE005608.1, AE005609.1, AE005610.1, AE005611.1, AE005612.1,
CC   AE005613.1, AE005614.1, AE005615.1, AE005616.1, AE005617.1,
CC   AE005618.1, AE005619.1, AE005620.1, AE005621.1, AE005622.1,
CC   AE005623.1, AE005624.1, AE005625.1, AE005626.1, AE005627.1,
CC   AE005628.1, AE005629.1, AE005630.1, AE005631.1, AE005632.1,
CC   AE005633.1, AE005634.1, AE005635.1, AE005636.1, AE005637.1,
CC   AE005638.1, AE005639.1, AE005640.1, AE005641.1, AE005642.1,
CC   AE005643.1, AE005644.1, AE005645.1, AE005646.1, AE005647.1,
CC   AE005648.1, AE005649.1, AE005650.1, AE005651.1, AE005652.1,
CC   AE005653.1, AE005654.1, AE005655.1, AE005656.1, AE005657.1,
CC   AE005658.1, AE005659.1, AE005660.1, AE005661.1, AE005662.1,
CC   AE005663.1, AE005664.1, AE005665.1, AE005666.1, AE005667.1,
CC   AE005668.1, AE005669.1, AE005670.1, AE005671.1, AE006457.1,
CC   AE006458.1, AE006459.1, AE006460.1, AE006461.1, AE005174.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5528445
FT                   /organism="Escherichia coli O157:H7 str. EDL933"
FT                   /strain="EDL933"
FT                   /serotype="O157:H7"
FT                   /mol_type="genomic DNA"
FT                   /note="enterohemorrhagic"
FT                   /db_xref="taxon:155864"
FT   gene            190..273
FT                   /gene="thrL"
FT                   /locus_tag="Z0001"
FT   CDS_pept        190..273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="Z0001"
FT                   /product="thr operon leader peptide"
FT                   /function="leader; Amino acid biosynthesis: Threonine"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54301"
FT                   /db_xref="GOA:Q8XA85"
FT                   /db_xref="InterPro:IPR011720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA85"
FT                   /protein_id="AAG54301.1"
FT                   /translation="MKRISTTITTTITTTITITITTGNGAG"
FT   gene            354..2816
FT                   /gene="thrA"
FT                   /locus_tag="Z0002"
FT   CDS_pept        354..2816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="Z0002"
FT                   /product="aspartokinase I, homoserine dehydrogenase I"
FT                   /function="enzyme; Amino acid biosynthesis: Threonine"
FT                   /note="Residues 1 to 820 of 820 are 99.75 pct identical to
FT                   residues 1 to 820 of 820 from Escherichia coli K-12 Strain
FT                   MG1655: B0002"
FT                   /db_xref="EnsemblGenomes-Gn:Z0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54302"
FT                   /db_xref="GOA:A0A4Q0C119"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C119"
FT                   /protein_id="AAG54302.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTISGQDALPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASRIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASRDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMS
FT                   RARISVVLITQSSSEYSISFCVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LENWQEELAQAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHLLRHAAEKSRRKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGI
FT                   LSGSLSYIFGKLDEGMSFSEATTLAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELADIEIEPVLPAEFNAEGDVAAFMANLSQLDDLFAARVAKARDEGKVLRYVGNIDEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2818..3750
FT                   /gene="thrB"
FT                   /locus_tag="Z0003"
FT   CDS_pept        2818..3750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="Z0003"
FT                   /product="homoserine kinase"
FT                   /function="enzyme; Amino acid biosynthesis: Threonine"
FT                   /note="Residues 1 to 310 of 310 are 99.35 pct identical to
FT                   residues 1 to 310 of 310 from Escherichia coli K-12 Strain
FT                   MG1655: B0003"
FT                   /db_xref="EnsemblGenomes-Gn:Z0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54303"
FT                   /db_xref="GOA:Q8XA82"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA82"
FT                   /protein_id="AAG54303.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVESAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
FT   gene            3751..5037
FT                   /gene="thrC"
FT                   /locus_tag="Z0004"
FT   CDS_pept        3751..5037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="Z0004"
FT                   /product="threonine synthase"
FT                   /function="enzyme; Amino acid biosynthesis: Threonine"
FT                   /note="Residues 1 to 428 of 428 are 99.76 pct identical to
FT                   residues 1 to 428 of 428 from Escherichia coli K-12 Strain
FT                   MG1655: B0004"
FT                   /db_xref="EnsemblGenomes-Gn:Z0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54304"
FT                   /db_xref="GOA:A0A4Q0C150"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C150"
FT                   /protein_id="AAG54304.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDE
FT                   MLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTM
FT                   RELKELGYTSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKE
FT                   LAERADLPLLSHNLPADFAALRKLMMNHQ"
FT   gene            5251..5547
FT                   /locus_tag="Z0005"
FT   CDS_pept        5251..5547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0005"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 98 of 98 are 96.93 pct identical to
FT                   residues 1 to 98 of 98 from Escherichia coli K-12 Strain
FT                   MG1655: B0005"
FT                   /db_xref="EnsemblGenomes-Gn:Z0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54305"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1H1"
FT                   /protein_id="AAG54305.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMATQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAHHDHHGGHGPGKHHR"
FT   gene            complement(5700..6476)
FT                   /gene="yaaA"
FT                   /locus_tag="Z0006"
FT   CDS_pept        complement(5700..6476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="Z0006"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 258 of 258 are 99.22 pct identical to
FT                   residues 1 to 258 of 258 from Escherichia coli K-12 Strain
FT                   MG1655: B0006"
FT                   /db_xref="EnsemblGenomes-Gn:Z0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54306"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA76"
FT                   /protein_id="AAG54306.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQ
FT                   ISTLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR"
FT   gene            complement(6546..7976)
FT                   /gene="yaaJ"
FT                   /locus_tag="Z0007"
FT   CDS_pept        complement(6546..7976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="Z0007"
FT                   /product="inner membrane transport protein"
FT                   /function="putative transport; Transport of small
FT                   molecules: Amino acids, amines"
FT                   /note="Residues 1 to 476 of 476 are 99.15 pct identical to
FT                   residues 1 to 476 of 476 from Escherichia coli K-12 Strain
FT                   MG1655: B0007"
FT                   /db_xref="EnsemblGenomes-Gn:Z0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54307"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDF3"
FT                   /protein_id="AAG54307.1"
FT                   /translation="MPDFFSFINSVLWGSVMIYLLFGAGCWFTFRTGFVQFRYIRQFGK
FT                   SLKNSIHPQPGGLTSFQSLCTSLAARVGSGNLAGVALAITAGGPGAVFWMWVAAFIGMA
FT                   TSFAECSLAQLYKERDVNGQFRGGPAWYMARGLGMRWMGVLFAVFLLIAYGIIFSGVQA
FT                   NAVARALSFSFDFPPLVTGIILAVFALLAIIRGLHGVARLMQGFVPLMAIIWVLTSLVI
FT                   CVINIGQLPHVIWSIFESAFGWQEAAGGAAGYTLSQAITNGFQRSMFSNEAGMGSTPNA
FT                   AAAAASWPPHPAAQGIVQMIGIFIDTLVICTASAMLILLAGNGTTYMPLEGIQLIQKAM
FT                   RVLMGSWGAEFVTLVVILFAFSSIVANYIYAENNLFFLRLNNPKAIWCLRICTFATVIG
FT                   GTLLSLPLMWQLADIIMACMAITNLTAILLLSPVVHTIASDYLRQRKLGVRPVFDPLRY
FT                   PDIGRQLSRDAWDDVSQE"
FT   gene            8255..9208
FT                   /gene="talB"
FT                   /locus_tag="Z0008"
FT   CDS_pept        8255..9208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="Z0008"
FT                   /product="transaldolase B"
FT                   /function="enzyme; Central intermediary metabolism:
FT                   Non-oxidative branch, pentose pwy"
FT                   /note="Residues 1 to 317 of 317 are 100.00 pct identical to
FT                   residues 1 to 317 of 317 from Escherichia coli K-12 Strain
FT                   MG1655: B0008"
FT                   /db_xref="EnsemblGenomes-Gn:Z0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54308"
FT                   /db_xref="GOA:P0A871"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A871"
FT                   /protein_id="AAG54308.1"
FT                   /translation="MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSNDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYQYYKEHGYETVV
FT                   MGASFRNIGEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPARITESEF
FT                   LWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL"
FT   gene            9323..9910
FT                   /gene="mog"
FT                   /locus_tag="Z0009"
FT   CDS_pept        9323..9910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="Z0009"
FT                   /product="required for the efficient incorporation of
FT                   molybdate into molybdoproteins"
FT                   /function="transport; Biosynthesis of cofactors, carriers:
FT                   Molybdopterin"
FT                   /note="Residues 1 to 195 of 195 are 100.00 pct identical to
FT                   residues 1 to 195 of 195 from Escherichia coli K-12 Strain
FT                   MG1655: B0009"
FT                   /db_xref="EnsemblGenomes-Gn:Z0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54309"
FT                   /db_xref="GOA:P0AF04"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AF04"
FT                   /protein_id="AAG54309.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETR
FT                   LIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVP
FT                   YCIQLLEGPYVETAPEVVAAFRPKSARRDVSE"
FT   gene            complement(9945..10511)
FT                   /gene="yaaH"
FT                   /locus_tag="Z0010"
FT   CDS_pept        complement(9945..10511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="Z0010"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 188 of 188 are 100.00 pct identical to
FT                   residues 1 to 188 of 188 from Escherichia coli K-12 Strain
FT                   MG1655: B0010"
FT                   /db_xref="EnsemblGenomes-Gn:Z0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54310"
FT                   /db_xref="GOA:P0AC99"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AC99"
FT                   /protein_id="AAG54310.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
FT   gene            complement(10660..11373)
FT                   /locus_tag="Z0011"
FT   CDS_pept        complement(10660..11373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0011"
FT                   /product="putative oxidoreductase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 237 of 237 are 99.57 pct identical to
FT                   residues 1 to 237 of 237 from Escherichia coli K-12 Strain
FT                   MG1655: B0011"
FT                   /db_xref="EnsemblGenomes-Gn:Z0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54311"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58316"
FT                   /protein_id="AAG54311.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSSYRVTIPAV
FT                   LQIACLRRMVSATQV"
FT   gene            10742..11362
FT                   /gene="htgA"
FT                   /locus_tag="Z0012"
FT   CDS_pept        10742..11362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htgA"
FT                   /locus_tag="Z0012"
FT                   /product="positive regulator for sigma 32 heat shock
FT                   promoters"
FT                   /function="regulator; Adaptations, atypical conditions"
FT                   /note="Residues 1 to 196 of 206 are 98.97 pct identical to
FT                   residues 1 to 196 of 196 from Escherichia coli K-12 Strain
FT                   MG1655: B0012"
FT                   /db_xref="EnsemblGenomes-Gn:Z0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA70"
FT                   /protein_id="AAG54312.1"
FT                   /translation="MTALTPFSAAPTGPPSPAPRSKPCPSTLIAAWVRKMRVSWLESRC
FT                   DTPFANNLSFISSGSSSSSSFTLASTACRNSCLCSSSIFFQVLRRNCSSNCCSISNVDI
FT                   SLSAFSFNRFETSSKMARYNLPCPRSLLAILSPPKCCNSPAISCQLRRCCSGCPSIDLN
FT                   SSLRISTLERRVLPFSLWVSSRAKFANCSSLQCWRKSRSESFR"
FT   gene            complement(11399..11803)
FT                   /gene="yaaI"
FT                   /locus_tag="Z0013"
FT   CDS_pept        complement(11399..11803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="Z0013"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 134 of 134 are 98.50 pct identical to
FT                   residues 1 to 134 of 134 from Escherichia coli K-12 Strain
FT                   MG1655: B0013"
FT                   /db_xref="EnsemblGenomes-Gn:Z0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54313"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA68"
FT                   /protein_id="AAG54313.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKLLGVIAMPRNETNALALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
FT   gene            12180..14096
FT                   /gene="dnaK"
FT                   /locus_tag="Z0014"
FT   CDS_pept        12180..14096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="Z0014"
FT                   /product="chaperone Hsp70; DNA biosynthesis; autoregulated
FT                   heat shock proteins"
FT                   /function="factor; Folding and ushering proteins:
FT                   Chaperones"
FT                   /note="Residues 1 to 638 of 638 are 100.00 pct identical to
FT                   residues 1 to 638 of 638 from Escherichia coli K-12 Strain
FT                   MG1655: B0014"
FT                   /db_xref="EnsemblGenomes-Gn:Z0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54314"
FT                   /db_xref="GOA:P0A6Z0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Z0"
FT                   /protein_id="AAG54314.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVE
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            14185..15315
FT                   /gene="dnaJ"
FT                   /locus_tag="Z0015"
FT   CDS_pept        14185..15315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="Z0015"
FT                   /product="chaperone with DnaK; heat shock protein"
FT                   /function="factor; Folding and ushering proteins:
FT                   Chaperones"
FT                   /note="Residues 1 to 376 of 376 are 99.46 pct identical to
FT                   residues 1 to 376 of 376 from Escherichia coli K-12 Strain
FT                   MG1655: B0015"
FT                   /db_xref="EnsemblGenomes-Gn:Z0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54315"
FT                   /db_xref="GOA:Q8XA65"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA65"
FT                   /protein_id="AAG54315.1"
FT                   /translation="MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGG
FT                   GRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPT
FT                   CHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDT
FT                   GDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIE
FT                   VPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQL
FT                   LQELQESFGGPTGEHNSPRSKSFFDGVKKFFDDLTR"
FT   gene            complement(15419..15628)
FT                   /gene="gef"
FT                   /locus_tag="Z0016"
FT   CDS_pept        complement(15419..15628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gef"
FT                   /locus_tag="Z0016"
FT                   /product="Gef protein interferes with membrane function
FT                   when in excess"
FT                   /function="membrane; Protection responses: Cell killing"
FT                   /note="Residues 1 to 69 of 69 are 97.10 pct identical to
FT                   residues 1 to 69 of 69 from Escherichia coli K-12 Strain
FT                   MG1655: B0018"
FT                   /db_xref="EnsemblGenomes-Gn:Z0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54316"
FT                   /db_xref="GOA:Q8XA64"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA64"
FT                   /protein_id="AAG54316.1"
FT                   /translation="MLNTCRVPLTDRKVKEKRAMKQHKVMIVALIVXCITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
FT   gene            16157..17323
FT                   /gene="nhaA"
FT                   /locus_tag="Z0018"
FT   CDS_pept        16157..17323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="Z0018"
FT                   /product="Na+/H antiporter, pH dependent"
FT                   /function="transport; Transport of small molecules:
FT                   Cations"
FT                   /note="Residues 1 to 388 of 388 are 99.22 pct identical to
FT                   residues 1 to 388 of 388 from Escherichia coli K-12 Strain
FT                   MG1655: B0019"
FT                   /db_xref="EnsemblGenomes-Gn:Z0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54317"
FT                   /db_xref="GOA:Q8XA63"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA63"
FT                   /protein_id="AAG54317.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAILAMMMANSGATSGWYHDFLETP
FT                   VQLRVGSLEINKNMLLWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYADPITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIIIIALFYTNDLSMASLGVAAVAIAVLAVLNLCGVRRTGVYILVGVVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTL
FT                   DGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKLAHLPEGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGSVDPELINWAKLGILVGSISSAVIGYSWLRVRLRPSV"
FT   gene            17383..18288
FT                   /gene="nhaR"
FT                   /locus_tag="Z0019"
FT   CDS_pept        17383..18288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="Z0019"
FT                   /product="transcriptional activator of nhaA"
FT                   /function="regulator; Transport of small molecules:
FT                   Cations"
FT                   /note="Residues 1 to 301 of 301 are 99.66 pct identical to
FT                   residues 1 to 301 of 301 from Escherichia coli K-12 Strain
FT                   MG1655: B0020"
FT                   /db_xref="EnsemblGenomes-Gn:Z0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54318"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDF4"
FT                   /protein_id="AAG54318.1"
FT                   /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALYLTPQTITGQIRALE
FT                   ERLQGKLFKRKGRGLEPSELGELVYRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADV
FT                   LSKRLVSSVLNAAVVEGEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLF
FT                   SVRIGECGVSFWCTNPPPEKPFPACLEERRLLIPGRRSMLGRKLLNWFNSQGLNVEILG
FT                   EFDDAALMKAFGAMHNAIFVAPTLYAYDFYADKTVVEIGRVENVMEEYHAIFAERMIQH
FT                   PAVQRICNTDYSALFSPAVR"
FT   gene            complement(18326..18949)
FT                   /locus_tag="Z0020"
FT   CDS_pept        complement(18326..18949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0020"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54319"
FT                   /db_xref="GOA:Q8XA62"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA62"
FT                   /protein_id="AAG54319.1"
FT                   /translation="MLSAINFTIPYSIASVSDSSNTADIFPGTPFPLLFEIEVSSCTGN
FT                   NTNCNSVRFNFNLNTILQVNLMTCGFEDQSIDTGLFVLSRINNENYQFHHIRFDCIQGE
FT                   QGELVFEPSDVEYYFEPVTIQESGTSILKNELENSEDGAGQIGFQLSNDGTNEIQYGKS
FT                   NYYSFQHPHEGSNQIPLFIRPRTYGNNVSSGQIMSRVKIVVMYN"
FT   misc_feature    18464..24969
FT                   /note="O-island #1; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(18960..19286)
FT                   /locus_tag="Z0021"
FT   CDS_pept        complement(18960..19286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0021"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JD89"
FT                   /protein_id="AAG54320.1"
FT                   /translation="MKWLLLITLSLYSFIVQSAPCGLTNVGEQRGTYILKPLSMKGNLT
FT                   AEKIENTGNIIECADLQETTNAIKVHFLTQNALRFKVGSRHYIINFPFESDGKKNSASR
FT                   EVIL"
FT   gene            complement(19299..21749)
FT                   /locus_tag="Z0022"
FT   CDS_pept        complement(19299..21749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0022"
FT                   /product="putative usher protein"
FT                   /function="putative membrane; Not classified"
FT                   /note="Residues 1 to 816 of 816 are 58.47 pct identical to
FT                   residues 1 to 826 of 826 from GenPept 118 :
FT                   gi|1788427|gb|AAC75170.1| (AE000300) putative outer
FT                   membrane protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54321"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2Y5"
FT                   /protein_id="AAG54321.1"
FT                   /translation="MLRTTRWVAAIIFLYSFPGYAEETFDTHFMIGGMKGEKVSEYHFD
FT                   NKQPLPGNYELDFYVNNQWRGKQDITIPESPVKPCLPKVLLTKLGVKTGNLNTEDNCIL
FT                   LDKAVHGGQYQWDISEHRLNLTVPQAYINELERGYVPPESWDRGIDAFYTSYNLSQYRS
FT                   YDSNNNSNTASYGRFNSGLNLFSWQLHSDASYSKPDDMKGTWQSNTLYLEHGWSQILST
FT                   VQIGENYTSSLIFDSLRFSGIRLFRDMQMLPDSMQSFTPLVQGVAQSNALITVSQNGYI
FT                   IYQKEVPPGPFTIADLQLSGSGSDLDVSIKEADGSVRSFLVPYSSVPNMLQPGISNFDF
FT                   IAGRSKIYGVKNQEDFLEANYIYGLNNLLTLYGGTILSDNYNAITLGNGWNTPLGAISF
FT                   DATRSSSKLNNDITHEGTSYQVAYNKYLVQTATRFSVAAWRYASQDYRTFSDHLYENDK
FT                   INHQSDYDDFYDIGRKNSLSANIMQPLSNNLGNVSLSALWRNYWGRSGNAKDYQFSYSN
FT                   SWQRISYTFSASQSYDENDKEEERFNLFISIPFYWGDDIAKTRHQINLSNSTSFSKDGY
FT                   SSNNTGITGIAGEHDQLNYGIYVNQQQQNNDTSLGTNLSWRTPIATIDGSYSHSKNAWQ
FT                   SGGSISSGLVVWPGGINITNQLSDTFAILDAPGLEGAHINGQKYNRTNSKGQVVYDLMI
FT                   PHRENHLVLDTANSESETELQGNRQIIAPYRGAVSYVQFTTDQRKPWYIQALRPDGSPL
FT                   TFGYDVLDLQENNIGVVGQGSRLFIRVDEIPTGIKVALNDEQNLFCTITFQHVIDENKT
FT                   YICQ"
FT   gene            complement(21762..22445)
FT                   /locus_tag="Z0023"
FT   CDS_pept        complement(21762..22445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0023"
FT                   /product="putative chaperone protein"
FT                   /function="putative factor; Not classified"
FT                   /note="Residues 1 to 224 of 227 are 55.80 pct identical to
FT                   residues 16 to 239 of 239 from GenPept 118 :
FT                   gi|1788428|gb|AAC75171.1| (AE000300) putative chaperone
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54322"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C123"
FT                   /protein_id="AAG54322.1"
FT                   /translation="MRIITALLMSFFILPVHAGVVIYGTRIIYPEKNREVLVQLMNQSK
FT                   NASLIQAWIDDGNTTIAPEKIQVTFILTPPVSRVAGGSGQQLKIRKMPNNLPHNKESLF
FT                   YLNVLDIPPNNPQNAGKNKIKLALQNRIKLLWRPSGIAPVDKKSLSQLNIKKKNNAISI
FT                   NNETANWITVTTIKAQNVKVNNESILLPPFSHNDITLKNNHASEYELTVVDDYGNNIHS
FT                   KIAAR"
FT   gene            complement(22495..23028)
FT                   /locus_tag="Z0024"
FT   CDS_pept        complement(22495..23028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0024"
FT                   /product="putative type-1 fimbrial protein"
FT                   /function="putative structure; Not classified"
FT                   /note="Residues 1 to 177 of 177 are 26.66 pct identical to
FT                   residues 1 to 180 of 180 from GenPept 118 :
FT                   gi|1788429|gb|AAC75172.1| (AE000300) putative fimbrial-like
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54323"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2A1"
FT                   /protein_id="AAG54323.1"
FT                   /translation="MKKYIIPFVATTLMFSATTFAKDVDQGTLTIRGEVVDTTCYFVNG
FT                   DSTTDIVVEDVVTSAMNQLINNEIYTLKTGSTSHDLEIQCDGNTAPSIEVLASEFDANN
FT                   FTLNKGTAENIGFAIFLDDGTLTRMRPGLKTPLKDNGSGQYFLNLNAQYARTSGNPVTK
FT                   GSVESTVTIKISAD"
FT   gene            complement(23330..24751)
FT                   /locus_tag="Z0025"
FT   CDS_pept        complement(23330..24751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0025"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3G4WT27"
FT                   /protein_id="AAG54324.1"
FT                   /translation="MTDGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSQDLPKPSPVLHHFFQYTHLRDAHFYRCKLIEHTVQFSFFKHKGITLLRLDVF
FT                   DDRTSECLSEEIKIYQECHEKFIKFLKANFNQEIYPELYTPEIFYEACRNLQSFYDHQE
FT                   TSQNAKYSAIVKKKSYFNKEIRNLIKKNIYPELYNEQCNKIPASSTDDNQKITWQNFKT
FT                   SNAAYSQLCEKLSLLKSSPSRLIEKSAYCSNENMITDKFDVVFSYCGDNVKEFILLLPY
FT                   NKSLEMHELNEQNIQYLTALNINIHKLLLSNITIEKSNLSYGYYFGCVLSNISCFESDL
FT                   SNTIFSNGEINNLFIKKSNIFGTSFTNTMIKNLRCEDIMPGRWTTQLVNKHLGYRYTGV
FT                   FKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELKKFMHDYDKTSPEMRKYLQS
FT                   INESMFLMKKISHQD"
FT   gene            complement(25221..25484)
FT                   /gene="rpsT"
FT                   /locus_tag="Z0027"
FT   CDS_pept        complement(25221..25484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="Z0027"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /function="structural component; Macromolecule synthesis,
FT                   modification: Ribosomal proteins - synthesis,
FT                   modificationRiboso"
FT                   /note="Residues 1 to 87 of 87 are 100.00 pct identical to
FT                   residues 1 to 87 of 87 from Escherichia coli K-12 Strain
FT                   MG1655: B0023"
FT                   /db_xref="EnsemblGenomes-Gn:Z0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54325"
FT                   /db_xref="GOA:P0A7U9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7U9"
FT                   /protein_id="AAG54325.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   gene            25587..25811
FT                   /locus_tag="Z0028"
FT   CDS_pept        25587..25811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0028"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 74 of 74 are 94.59 pct identical to
FT                   residues 1 to 72 of 72 from Escherichia coli K-12 Strain
FT                   MG1655: B0024"
FT                   /db_xref="EnsemblGenomes-Gn:Z0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54326"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C134"
FT                   /protein_id="AAG54326.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGSQFLPVICAMTMTM
FT                   KSHFFLISVLNRRLTLTAVQGILGRFSLF"
FT   gene            25819..26760
FT                   /gene="ribF"
FT                   /locus_tag="Z0029"
FT   CDS_pept        25819..26760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="Z0029"
FT                   /product="putative regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 1 to 313 of 313 are 100.00 pct identical to
FT                   residues 1 to 313 of 313 from Escherichia coli K-12 Strain
FT                   MG1655: B0025"
FT                   /db_xref="EnsemblGenomes-Gn:Z0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54327"
FT                   /db_xref="GOA:P0AG42"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG42"
FT                   /protein_id="AAG54327.1"
FT                   /translation="MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRK
FT                   RNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTA
FT                   QNFISDLLVKHLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVR
FT                   ISSTAVRQALADDNLALAESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVK
FT                   GVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIR
FT                   NEQRFASLDELKAQIARDELTAREFFGLTKPA"
FT   gene            26803..29619
FT                   /gene="ileS"
FT                   /locus_tag="Z0030"
FT   CDS_pept        26803..29619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="Z0030"
FT                   /product="isoleucine tRNA synthetase"
FT                   /function="enzyme; Amino acyl tRNA syn; tRNA modific'n"
FT                   /note="Residues 1 to 938 of 938 are 99.46 pct identical to
FT                   residues 1 to 938 of 938 from Escherichia coli K-12 Strain
FT                   MG1655: B0026"
FT                   /db_xref="EnsemblGenomes-Gn:Z0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54328"
FT                   /db_xref="GOA:Q8XA49"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA49"
FT                   /protein_id="AAG54328.1"
FT                   /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIEL
FT                   KVEQEYGKPDEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEA
FT                   NIIRALGKIIGNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDAL
FT                   KAKFGVSNVNGPISLVIWTTTPWTLPANRAISIAPDFDYALVQIDGQAVILAKDLVESV
FT                   MQRIGVTDYTILGTVKGAELELLRFAHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVIGQKYGLETANPVGPDGTYLPGTYPTLDGVNVFKANDIVVALLQEKGALLHVEKM
FT                   QHSYPCCWRHKTPIIFRATPQWFVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKDTEELHPRTLELMEEVAKRVEVDGIQAWWDLDAKEIL
FT                   GDEADQYVKVPDTLDVWFDSGSTHSSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMI
FT                   STAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYT
FT                   GEMAVSDEILKRAADSYRRIRNTARFLLANLNGFDPAKDMVKPEEMVVLDRWAVGCAKA
FT                   AQEDILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQTALY
FT                   HIAEALVRWMAPILSFTADEVWGYLPGEREKYVFTGEWYEGLFGLADSEAMNDAFWDEL
FT                   LKVRGEVNKVIEQARADKKVGGSLEAAVTLYTEPELAAKLTALGDELRFVLLTSGATVA
FT                   DYNDAPADAQQSEVLKGLKVALSKAEGEKCPRCWHYTQDVGKVAEHAEICGRCVSNVAG
FT                   DGEKRKFA"
FT   gene            29619..30113
FT                   /gene="lspA"
FT                   /locus_tag="Z0031"
FT   CDS_pept        29619..30113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="Z0031"
FT                   /product="prolipoprotein signal peptidase (SPase II)"
FT                   /function="enzyme; Transport of large molecules: Protein,
FT                   peptide secretion"
FT                   /note="Residues 1 to 164 of 164 are 98.17 pct identical to
FT                   residues 1 to 164 of 164 from Escherichia coli K-12 Strain
FT                   MG1655: B0027"
FT                   /db_xref="EnsemblGenomes-Gn:Z0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54329"
FT                   /db_xref="GOA:Q8XA48"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA48"
FT                   /protein_id="AAG54329.1"
FT                   /translation="MSQSICSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVPLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGISVTLVVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK
FT                   Q"
FT   gene            30201..30650
FT                   /gene="slpA"
FT                   /locus_tag="Z0033"
FT   CDS_pept        30201..30650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slpA"
FT                   /locus_tag="Z0033"
FT                   /product="probable FKBX-type 16KD peptidyl-prolyl cis-trans
FT                   isomerase (a rotamase)"
FT                   /function="putative enzyme; Macromolecule synthesis,
FT                   modification: Proteins - translation and modification"
FT                   /note="Residues 1 to 149 of 149 are 100.00 pct identical to
FT                   residues 1 to 149 of 149 from Escherichia coli K-12 Strain
FT                   MG1655: B0028"
FT                   /db_xref="EnsemblGenomes-Gn:Z0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54330"
FT                   /db_xref="GOA:P0AEM2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEM2"
FT                   /protein_id="AAG54330.1"
FT                   /translation="MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLS
FT                   EGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQYFSRREFMDAGEPEIGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALEA"
FT   gene            30652..31602
FT                   /gene="lytB"
FT                   /locus_tag="Z0034"
FT   CDS_pept        30652..31602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="Z0034"
FT                   /product="control of stringent response; involved in
FT                   penicillin tolerance"
FT                   /function="regulator; Global regulatory functions"
FT                   /note="Residues 1 to 316 of 316 are 100.00 pct identical to
FT                   residues 1 to 316 of 316 from Escherichia coli K-12 Strain
FT                   MG1655: B0029"
FT                   /db_xref="EnsemblGenomes-Gn:Z0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54331"
FT                   /db_xref="GOA:P62625"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62625"
FT                   /protein_id="AAG54331.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR
FT                   LQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD"
FT   gene            31668..32582
FT                   /gene="yaaF"
FT                   /locus_tag="Z0035"
FT   CDS_pept        31668..32582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaF"
FT                   /locus_tag="Z0035"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 302 of 304 are 99.66 pct identical to
FT                   residues 1 to 302 of 304 from Escherichia coli K-12 Strain
FT                   MG1655: B0030"
FT                   /db_xref="EnsemblGenomes-Gn:Z0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54332"
FT                   /db_xref="GOA:Q8XA41"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA41"
FT                   /protein_id="AAG54332.1"
FT                   /translation="MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKT
FT                   TRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAF
FT                   LAIRDALMRAPEPVTLVAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAE
FT                   FNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYR
FT                   SGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANV
FT                   QVALDLNVKGFQQWVAEVLALVP"
FT   gene            32749..33570
FT                   /gene="dapB"
FT                   /locus_tag="Z0036"
FT   CDS_pept        32749..33570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="Z0036"
FT                   /product="dihydrodipicolinate reductase"
FT                   /function="enzyme; Amino acid biosynthesis: Lysine"
FT                   /note="Residues 1 to 273 of 273 are 99.26 pct identical to
FT                   residues 1 to 273 of 273 from Escherichia coli K-12 Strain
FT                   MG1655: B0031"
FT                   /db_xref="EnsemblGenomes-Gn:Z0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54333"
FT                   /db_xref="GOA:P58209"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58209"
FT                   /protein_id="AAG54333.1"
FT                   /translation="MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKTGVTVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTT
FT                   GFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERLEITHKASSRMTFANGAVRSALWLSGKENGLFDMRDVLDLNNL"
FT   gene            34026..35174
FT                   /gene="carA"
FT                   /locus_tag="Z0037"
FT   CDS_pept        34026..35174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="Z0037"
FT                   /product="carbamoyl-phosphate synthetase, glutamine (small)
FT                   subunit"
FT                   /function="enzyme; Nucleotide biosynthesis: Pyrimidine
FT                   ribonucleotide biosynthesis"
FT                   /note="Residues 1 to 382 of 382 are 100.00 pct identical to
FT                   residues 1 to 382 of 382 from Escherichia coli K-12 Strain
FT                   MG1655: B0032"
FT                   /db_xref="EnsemblGenomes-Gn:Z0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54334"
FT                   /db_xref="GOA:P0A6F2"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6F2"
FT                   /protein_id="AAG54334.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK"
FT   gene            35192..38413
FT                   /gene="carB"
FT                   /locus_tag="Z0038"
FT   CDS_pept        35192..38413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="Z0038"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /function="enzyme; Nucleotide biosynthesis: Pyrimidine
FT                   ribonucleotide biosynthesis"
FT                   /note="Residues 1 to 1073 of 1073 are 99.72 pct identical
FT                   to residues 1 to 1073 of 1073 from Escherichia coli K-12
FT                   Strain MG1655: B0033"
FT                   /db_xref="EnsemblGenomes-Gn:Z0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54335"
FT                   /db_xref="GOA:P63737"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63737"
FT                   /protein_id="AAG54335.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
FT   gene            complement(38421..38639)
FT                   /locus_tag="Z0039"
FT   CDS_pept        complement(38421..38639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0039"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54336"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5XF44"
FT                   /protein_id="AAG54336.1"
FT                   /translation="MTRFEAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRISYSIKLADEKYPP"
FT   gene            38569..39069
FT                   /locus_tag="Z0040"
FT   CDS_pept        38569..39069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0040"
FT                   /product="transcriptional regulator of cai operon"
FT                   /function="regulator; Central intermediary metabolism:
FT                   Pool, multipurpose conversions of intermed. met'm"
FT                   /note="Residues 1 to 166 of 166 are 100.00 pct identical to
FT                   residues 1 to 166 of 166 from Escherichia coli K-12 Strain
FT                   MG1655: B0034"
FT                   /db_xref="EnsemblGenomes-Gn:Z0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54337"
FT                   /db_xref="GOA:A0A0H3JC41"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC41"
FT                   /protein_id="AAG54337.1"
FT                   /translation="MKLHTIDISTILIWPCLIASKRVIARLLICETGVRMCEGYVEKPL
FT                   YLLIAEWMMAENRWVIAREISIHFDIEHSKAVNTLTYILSEVTEISCEVKMIPNKLEGR
FT                   GCQCQRLVKVVDIDEQIYARLRNNSREKLVGVRKTPRIPAVPLTELNREQKWQMMLSKS
FT                   MRR"
FT   gene            complement(39188..39799)
FT                   /gene="caiE"
FT                   /locus_tag="Z0041"
FT   CDS_pept        complement(39188..39799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="Z0041"
FT                   /product="possible synthesis of cofactor for carnitine
FT                   racemase and dehydratase"
FT                   /function="putative enzyme; Central intermediary
FT                   metabolism: Pool, multipurpose conversions of intermed.
FT                   met'm"
FT                   /note="Residues 1 to 203 of 203 are 97.53 pct identical to
FT                   residues 1 to 203 of 203 from Escherichia coli K-12 Strain
FT                   MG1655: B0035"
FT                   /db_xref="EnsemblGenomes-Gn:Z0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54338"
FT                   /db_xref="GOA:Q8XA36"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA36"
FT                   /protein_id="AAG54338.1"
FT                   /translation="MERTLTTVSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIG
FT                   PLASLRGDYGRLIVQAGANIQDGCIMHGYTDTDTIVGENGHIGHGAILHGCVIGRDALV
FT                   GMNSVIMDGAVIGEESIVAAMSFVKAGFHGEKRQLLMGTPARAVRSVSDDELHWKRLNT
FT                   KEYQDLVGRCHASLHETQPLRQMEENRPRLQGTTDVTPKR"
FT   gene            complement(39784..40677)
FT                   /gene="caiD"
FT                   /locus_tag="Z0042"
FT   CDS_pept        complement(39784..40677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="Z0042"
FT                   /product="carnitine racemase"
FT                   /function="enzyme; Degradation of small molecules: Amines"
FT                   /note="Residues 1 to 297 of 297 are 98.65 pct identical to
FT                   residues 1 to 297 of 297 from Escherichia coli K-12 Strain
FT                   MG1655: B0036"
FT                   /db_xref="EnsemblGenomes-Gn:Z0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54339"
FT                   /db_xref="GOA:Q8XA35"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA35"
FT                   /protein_id="AAG54339.1"
FT                   /translation="MKRQGTTLPANNHALKQYAFFAGMLSSLKKQKWRKGMSESLHLTR
FT                   NGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFFSAGWDLKA
FT                   AAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIVCADNASF
FT                   ALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELM
FT                   DNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEESYSYIRSGVLKHYPSVLHSEDAIE
FT                   GPLAFAEKRDPVWKGR"
FT   gene            complement(40678..42246)
FT                   /gene="caiC"
FT                   /locus_tag="Z0043"
FT   CDS_pept        complement(40678..42246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="Z0043"
FT                   /product="probable crotonobetaine/carnitine-CoA ligase"
FT                   /function="putative enzyme; Central intermediary
FT                   metabolism: Pool, multipurpose conversions of intermed.
FT                   met'm"
FT                   /note="Residues 1 to 522 of 522 are 97.89 pct identical to
FT                   residues 1 to 522 of 522 from Escherichia coli K-12 Strain
FT                   MG1655: B0037"
FT                   /db_xref="EnsemblGenomes-Gn:Z0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54340"
FT                   /db_xref="GOA:Q8XA34"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA34"
FT                   /protein_id="AAG54340.1"
FT                   /translation="MDRGAMDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSY
FT                   LELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLRE
FT                   ESAWILQNSQACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKN
FT                   QQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVY
FT                   LTVMPAFHIDCQCTAAMAAFSAGATFVLVEKYSARAFWGQVQKYRATITECIPMMIRTL
FT                   MVQPPSANDRQHRLREVMFYLNLSEQEKDTFCERFGVRLLTSYGMTETIVGIIGDRPGD
FT                   KRRWPSIGRAGFCYDAEIRDDHNRPLPAGEIGEICIKGVPGKTIFKEYFLNPKATAKVL
FT                   EADGWLHTGDTGYRDEEGFFYFIDRRCNMIKRGGENVSCVELENIIATHPKIQDIVVVG
FT                   IKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSYLEIRKDLPRNCSGKII
FT                   RKNLK"
FT   gene            complement(42305..43522)
FT                   /gene="caiB"
FT                   /locus_tag="Z0044"
FT   CDS_pept        complement(42305..43522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="Z0044"
FT                   /product="l-carnitine dehydratase"
FT                   /function="enzyme; Central intermediary metabolism: Pool,
FT                   multipurpose conversions of intermed. met'm"
FT                   /note="Residues 1 to 405 of 405 are 99.50 pct identical to
FT                   residues 1 to 405 of 405 from Escherichia coli K-12 Strain
FT                   MG1655: B0038"
FT                   /db_xref="EnsemblGenomes-Gn:Z0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54341"
FT                   /db_xref="GOA:Q8XA32"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA32"
FT                   /protein_id="AAG54341.1"
FT                   /translation="MDHLPMPKFGPLAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GITDEVLWQHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMPA
FT                   FPYTADYFSGLTATTAALAALHKARETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEMC
FT                   PRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGTPEIPEGTQLI
FT                   HRIECPYGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESI
FT                   TQWQTMDGRTCKGPNIMPKFKNNPGQIWRGMPSHGMDTAAILKNIGYSENDIQELVSKG
FT                   LAKVED"
FT   gene            complement(43651..44793)
FT                   /gene="caiA"
FT                   /locus_tag="Z0045"
FT   CDS_pept        complement(43651..44793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="Z0045"
FT                   /product="probable carnitine operon oxidoreductase"
FT                   /function="putative regulator; Central intermediary
FT                   metabolism: Pool, multipurpose conversions of intermed.
FT                   met'm"
FT                   /note="Residues 1 to 380 of 380 are 100.00 pct identical to
FT                   residues 1 to 380 of 380 from Escherichia coli K-12 Strain
FT                   MG1655: B0039"
FT                   /db_xref="EnsemblGenomes-Gn:Z0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54342"
FT                   /db_xref="GOA:P60586"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60586"
FT                   /protein_id="AAG54342.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVG
FT                   IAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(44824..46338)
FT                   /gene="caiT"
FT                   /locus_tag="Z0046"
FT   CDS_pept        complement(44824..46338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="Z0046"
FT                   /product="probable carnitine transporter"
FT                   /function="putative transport; Central intermediary
FT                   metabolism: Pool, multipurpose conversions of intermed.
FT                   met'm"
FT                   /note="Residues 1 to 504 of 504 are 99.20 pct identical to
FT                   residues 1 to 504 of 504 from Escherichia coli K-12 Strain
FT                   MG1655: B0040"
FT                   /db_xref="EnsemblGenomes-Gn:Z0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54343"
FT                   /db_xref="GOA:Q8XA30"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA30"
FT                   /protein_id="AAG54343.1"
FT                   /translation="MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKELGLAYSLFXWGPLPWATYSFLSVAFAYFFFV
FT                   RKMEVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRXYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLIDKNIINIPNLIEQYGVARAIIETWA
FT                   XLPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD"
FT   gene            46781..47587
FT                   /gene="fixA"
FT                   /locus_tag="Z0047"
FT   CDS_pept        46781..47587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="Z0047"
FT                   /product="probable flavoprotein subunit, carnitine
FT                   metabolism"
FT                   /function="putative enzyme; Energy metabolism, carbon:
FT                   Electron transport"
FT                   /note="Residues 1 to 268 of 268 are 100.00 pct identical to
FT                   residues 1 to 268 of 268 from Escherichia coli K-12 Strain
FT                   MG1655: B0041"
FT                   /db_xref="EnsemblGenomes-Gn:Z0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54344"
FT                   /db_xref="GOA:P60567"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60567"
FT                   /protein_id="AAG54344.1"
FT                   /translation="MNDVSFMISGDAMKIITCYKCVPDEQDIAVNNADGSLDFSKADAK
FT                   ISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQF
FT                   EQALPQQTASALAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIIS
FT                   LTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAAD
FT                   IGFNAEAAWSEQQVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
FT   gene            47602..48543
FT                   /gene="fixB"
FT                   /locus_tag="Z0048"
FT   CDS_pept        47602..48543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="Z0048"
FT                   /product="probable flavoprotein subunit, carnitine
FT                   metabolism"
FT                   /function="putative enzyme; Energy metabolism, carbon:
FT                   Electron transport"
FT                   /note="Residues 1 to 313 of 313 are 99.36 pct identical to
FT                   residues 1 to 313 of 313 from Escherichia coli K-12 Strain
FT                   MG1655: B0042"
FT                   /db_xref="EnsemblGenomes-Gn:Z0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54345"
FT                   /db_xref="GOA:Q8XA27"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA27"
FT                   /protein_id="AAG54345.1"
FT                   /translation="MNTFSQVWVFSDTPSRLPELMNGAQALANQINAFVLNDADGAQAI
FT                   QLGANHVWKLNGKPDDRMIEDYASVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLK
FT                   AAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTG
FT                   ETHTVEWQAPAVAITRTATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAIN
FT                   KDKNAPIFQYADYGIVGDAVKILPALTAALAR"
FT   gene            48594..49880
FT                   /gene="fixC"
FT                   /locus_tag="Z0049"
FT   CDS_pept        48594..49880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="Z0049"
FT                   /product="flavoprotein; electron transport"
FT                   /function="putative carrier; Energy metabolism, carbon:
FT                   Electron transport"
FT                   /note="Residues 1 to 428 of 428 are 99.29 pct identical to
FT                   residues 1 to 428 of 428 from Escherichia coli K-12 Strain
FT                   MG1655: B0043"
FT                   /db_xref="EnsemblGenomes-Gn:Z0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54346"
FT                   /db_xref="GOA:Q7AHT0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AHT0"
FT                   /protein_id="AAG54346.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLEHIIPGFAESAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVN
FT                   SILAEKLGMAKRVKPTNVAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVV
FT                   PEAGINMLPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDF
FT                   SKQKLAEYRQHLESGPLRDMRMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPE
FT                   LMRKKIXRHGKKVGFINLIKDGMKGVTVL"
FT   gene            49877..50164
FT                   /gene="fixX"
FT                   /locus_tag="Z0050"
FT   CDS_pept        49877..50164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="Z0050"
FT                   /product="putative ferredoxin"
FT                   /function="putative carrier; Not classified"
FT                   /note="Residues 1 to 95 of 95 are 100.00 pct identical to
FT                   residues 1 to 95 of 95 from Escherichia coli K-12 Strain
FT                   MG1655: B0044"
FT                   /db_xref="EnsemblGenomes-Gn:Z0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54347"
FT                   /db_xref="GOA:P68648"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68648"
FT                   /protein_id="AAG54347.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
FT   gene            50222..51553
FT                   /gene="yaaU"
FT                   /locus_tag="Z0051"
FT   CDS_pept        50222..51553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="Z0051"
FT                   /product="putative transport protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 443 of 443 are 99.77 pct identical to
FT                   residues 1 to 443 of 443 from Escherichia coli K-12 Strain
FT                   MG1655: B0045"
FT                   /db_xref="EnsemblGenomes-Gn:Z0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54348"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TWV8"
FT                   /protein_id="AAG54348.1"
FT                   /translation="MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYILVMIGVALEQLT
FT                   PALKLDADWIGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVS
FT                   SPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGY
FT                   WLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVA
FT                   FDEEQPQQTRFRDLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNA
FT                   ALGNVVISLFFMLGCIPPMLWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGI
FT                   SNTMLMGAGISLFGLLISVAFAPETRGMSLAQTSNMTIRGQRMG"
FT   gene            51661..52191
FT                   /gene="yabF"
FT                   /locus_tag="Z0052"
FT   CDS_pept        51661..52191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabF"
FT                   /locus_tag="Z0052"
FT                   /product="putative NAD(P)H oxidoreductase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 176 of 176 are 99.43 pct identical to
FT                   residues 1 to 176 of 176 from Escherichia coli K-12 Strain
FT                   MG1655: B0046"
FT                   /db_xref="EnsemblGenomes-Gn:Z0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54349"
FT                   /db_xref="GOA:Q8XA24"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA24"
FT                   /protein_id="AAG54349.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMFEQARTLEGVEIRSLYQLYPDFNID
FT                   IAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHY
FT                   KQRLLEWQEAHHG"
FT   gene            52184..54046
FT                   /gene="kefC"
FT                   /locus_tag="Z0053"
FT   CDS_pept        52184..54046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="Z0053"
FT                   /product="K+ efflux antiporter, glutathione-regulated"
FT                   /function="transport; Transport of small molecules:
FT                   Cations"
FT                   /note="Residues 1 to 620 of 620 are 99.19 pct identical to
FT                   residues 1 to 620 of 620 from Escherichia coli K-12 Strain
FT                   MG1655: B0047"
FT                   /db_xref="EnsemblGenomes-Gn:Z0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54350"
FT                   /db_xref="GOA:Q8XA20"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA20"
FT                   /protein_id="AAG54350.1"
FT                   /translation="MDSHTLVQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFIIGLELDPQRLWKLRAAVFGGGALQMVICGGLLGLF
FT                   CMLLGLRWQVAELIGMTLALSSTAIAMQAMNERNLMVTXMGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASSASTTMGAFALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLIENPLRIVILLLGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMANVLEPEWAKSLTLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQ
FT                   PRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYICLRQAGVEKPERE
FT                   TFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNMADEPETKPSS"
FT   gene            54238..54717
FT                   /locus_tag="Z0055"
FT   CDS_pept        54238..54717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0055"
FT                   /product="dihydrofolate reductase type I; trimethoprim
FT                   resistance"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Folic acid"
FT                   /note="Residues 1 to 159 of 159 are 99.37 pct identical to
FT                   residues 1 to 159 of 159 from Escherichia coli K-12 Strain
FT                   MG1655: B0048"
FT                   /db_xref="EnsemblGenomes-Gn:Z0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54351"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1K6"
FT                   /protein_id="AAG54351.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRH
FT                   TRESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   misc_feature    54727..55361
FT                   /note="O-island #2; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            54803..55036
FT                   /locus_tag="Z0056"
FT   CDS_pept        54803..55036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0056"
FT                   /product="putative antitoxin of gyrase inhibiting
FT                   toxin-antitoxin system"
FT                   /function="putative factor; Protection responses: Cell
FT                   killing"
FT                   /note="Residues 8 to 77 of 77 are 30.00 pct identical to
FT                   residues 3 to 72 of 72 from GenPept 118 :
FT                   gi|3822176|gb|AAC70130.1| (AF074613) plasmid maintenance
FT                   protein [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54352"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1R7"
FT                   /protein_id="AAG54352.1"
FT                   /translation="MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHA
FT                   ATRWREENAEAIAALNQLADETGCFSDEYRSF"
FT   gene            55039..55353
FT                   /locus_tag="Z0057"
FT   CDS_pept        55039..55353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0057"
FT                   /product="putative toxin of gyrase inhibiting
FT                   toxin-antitoxin system"
FT                   /function="putative factor; Protection responses: Cell
FT                   killing"
FT                   /note="Residues 1 to 104 of 104 are 35.57 pct identical to
FT                   residues 1 to 101 of 101 from GenPept 118 :
FT                   gi|3822177|gb|AAC70131.1| (AF074613) plasmid maintenance
FT                   protein [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54353"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDF7"
FT                   /protein_id="AAG54353.1"
FT                   /translation="MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFSR
FT                   IRPPERLNPILLLVDGKEYVLMTHETATVPVNALGTKFCDASAHRTLIKGALDFMLDGI
FT                   "
FT   gene            complement(55350..56198)
FT                   /gene="apaH"
FT                   /locus_tag="Z0058"
FT   CDS_pept        complement(55350..56198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="Z0058"
FT                   /product="diadenosine tetraphosphatase"
FT                   /function="enzyme; Central intermediary metabolism: Salvage
FT                   of nucleosides and nucleotides"
FT                   /note="Residues 1 to 279 of 282 are 98.92 pct identical to
FT                   residues 1 to 279 of 280 from Escherichia coli K-12 Strain
FT                   MG1655: B0049"
FT                   /db_xref="EnsemblGenomes-Gn:Z0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54354"
FT                   /db_xref="GOA:Q8XA15"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA15"
FT                   /protein_id="AAG54354.1"
FT                   /translation="MATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPSNRHKDLGEGEAVA
FT                   S"
FT   gene            complement(56205..56582)
FT                   /gene="apaG"
FT                   /locus_tag="Z0059"
FT   CDS_pept        complement(56205..56582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="Z0059"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 125 of 125 are 100.00 pct identical to
FT                   residues 1 to 125 of 125 from Escherichia coli K-12 Strain
FT                   MG1655: B0050"
FT                   /db_xref="EnsemblGenomes-Gn:Z0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54355"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62674"
FT                   /protein_id="AAG54355.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
FT   gene            complement(56585..57406)
FT                   /gene="ksgA"
FT                   /locus_tag="Z0060"
FT   CDS_pept        complement(56585..57406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="Z0060"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase"
FT                   /function="enzyme; Protection responses: Drug/analog
FT                   sensitivity"
FT                   /note="Residues 1 to 273 of 273 are 99.63 pct identical to
FT                   residues 1 to 273 of 273 from Escherichia coli K-12 Strain
FT                   MG1655: B0051"
FT                   /db_xref="EnsemblGenomes-Gn:Z0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54356"
FT                   /db_xref="GOA:Q8XA14"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA14"
FT                   /protein_id="AAG54356.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQYCQMANYLAENAPFQES"
FT   gene            complement(57403..58392)
FT                   /gene="pdxA"
FT                   /locus_tag="Z0061"
FT   CDS_pept        complement(57403..58392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="Z0061"
FT                   /product="pyridoxine biosynthesis"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Pyridoxine"
FT                   /note="Residues 1 to 329 of 329 are 97.87 pct identical to
FT                   residues 1 to 329 of 329 from Escherichia coli K-12 Strain
FT                   MG1655: B0052"
FT                   /db_xref="EnsemblGenomes-Gn:Z0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54357"
FT                   /db_xref="GOA:P58713"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58713"
FT                   /protein_id="AAG54357.1"
FT                   /translation="MVKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTD
FT                   RAAMLGLPLTLRPYSPNSPAQPQTTGTLTLLPVALRESVTAGQLAIENGHYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGEADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(58392..59678)
FT                   /gene="surA"
FT                   /locus_tag="Z0062"
FT   CDS_pept        complement(58392..59678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="Z0062"
FT                   /product="survival protein"
FT                   /function="phenotype; Not classified"
FT                   /note="Residues 1 to 428 of 428 are 100.00 pct identical to
FT                   residues 1 to 428 of 428 from Escherichia coli K-12 Strain
FT                   MG1655: B0053"
FT                   /db_xref="EnsemblGenomes-Gn:Z0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54358"
FT                   /db_xref="GOA:P0ABZ8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABZ8"
FT                   /protein_id="AAG54358.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIA
FT                   KQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQ
FT                   VGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSAD
FT                   QQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNIS
FT                   VTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAASWMQEQRASAYVKILSN"
FT   gene            complement(59731..62085)
FT                   /gene="imp"
FT                   /locus_tag="Z0063"
FT   CDS_pept        complement(59731..62085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="Z0063"
FT                   /product="organic solvent tolerance"
FT                   /function="phenotype; Adaptations, atypical conditions"
FT                   /note="Residues 1 to 784 of 784 are 99.74 pct identical to
FT                   residues 1 to 784 of 784 from Escherichia coli K-12 Strain
FT                   MG1655: B0054"
FT                   /db_xref="EnsemblGenomes-Gn:Z0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54359"
FT                   /db_xref="GOA:Q8XA13"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA13"
FT                   /protein_id="AAG54359.1"
FT                   /translation="MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQG
FT                   DTNDLPVTINANHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVSIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQ
FT                   AGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYF
FT                   NDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYY
FT                   QNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHY
FT                   QQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYV
FT                   PYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFN
FT                   ISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNV
FT                   ATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIA
FT                   DRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIG
FT                   FNIELRGLSSNYGLGTQEMLRSNILPYQNTL"
FT   gene            62340..63155
FT                   /gene="yabH"
FT                   /locus_tag="Z0064"
FT   CDS_pept        62340..63155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabH"
FT                   /locus_tag="Z0064"
FT                   /product="putative DNA binding protein"
FT                   /function="phenotype; Not classified"
FT                   /note="Residues 1 to 271 of 271 are 99.63 pct identical to
FT                   residues 1 to 271 of 271 from Escherichia coli K-12 Strain
FT                   MG1655: B0055"
FT                   /db_xref="EnsemblGenomes-Gn:Z0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54360"
FT                   /db_xref="GOA:Q7AHS5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AHS5"
FT                   /protein_id="AAG54360.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
FT   gene            63450..64202
FT                   /locus_tag="Z0065"
FT   CDS_pept        63450..64202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0065"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 192 of 250 are 87.50 pct identical to
FT                   residues 1 to 192 of 216 from Escherichia coli K-12 Strain
FT                   MG1655: B0056"
FT                   /db_xref="EnsemblGenomes-Gn:Z0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54361"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8Y8"
FT                   /protein_id="AAG54361.1"
FT                   /translation="MKVSVPGMPATLLNMSNNDIYKMVSGDKMDMKMNIFQRLWETLRH
FT                   LFWSDKQTEAYKLLFNFVNKKAGNINASKYFTGAVNENEKEKFIHSLELFNELKTCAKN
FT                   PDEMVAKGNMSWVAQTFGDIELSVTFFIENKEICTQTLQLHKGPGNLGVDLREAYLPGV
FT                   DMRDCYLGLKTMKGHNKVLYLEPGWNANLDGATLDGATLDGATVDGATHLYDEVIIINK
FT                   ITPKKIDTEEVATKQSTAEQITDNAIIE"
FT   gene            complement(64620..65279)
FT                   /gene="yabO"
FT                   /locus_tag="Z0066"
FT   CDS_pept        complement(64620..65279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="Z0066"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 219 of 219 are 99.08 pct identical to
FT                   residues 1 to 219 of 219 from Escherichia coli K-12 Strain
FT                   MG1655: B0058"
FT                   /db_xref="EnsemblGenomes-Gn:Z0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54362"
FT                   /db_xref="GOA:Q8XA10"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA10"
FT                   /protein_id="AAG54362.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDDHIMVVNKPSGLLSVPGRLEEHKDS
FT                   VMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFRERVPKKQYVTRVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEARAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
FT   gene            complement(65291..68197)
FT                   /locus_tag="Z0067"
FT   CDS_pept        complement(65291..68197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0067"
FT                   /product="hypothetical protein"
FT                   /function="putative enzyme; Unknown function"
FT                   /note="Residues 1 to 968 of 968 are 100.00 pct identical to
FT                   residues 1 to 968 of 968 from Escherichia coli K-12 Strain
FT                   MG1655: B0059"
FT                   /db_xref="EnsemblGenomes-Gn:Z0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54363"
FT                   /db_xref="GOA:P60241"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60241"
FT                   /protein_id="AAG54363.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYIGTRLDTEESGVALREVFLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDE
FT                   AHHLVWSEDAPSREYQAIEQLAEHVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFA
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANSDSEDAQSA
FT                   RQELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPERIYQEFEGDNATWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   HMVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRTIYDSVYNDLINYLASPDQTEGFDDLIKNCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQALAESIEEQDDDTNLIAFAMNLFDIIGINQDDRGDNMIVLTPSDHMLVPDFPG
FT                   LSEDGITITFDREVALAREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELIYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLNAVNRH
FT                   TGSKLVNAVQQDVHAILQLGEAQIEKSARALIDAARNEADEKLSAELSRLEALRAVNPN
FT                   IRDDELTAIESNRQQVMESLDQAGWRLDALRLIVVTHQ"
FT   gene            complement(68361..70712)
FT                   /gene="polB"
FT                   /locus_tag="Z0068"
FT   CDS_pept        complement(68361..70712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="Z0068"
FT                   /product="DNA polymerase II"
FT                   /function="enzyme; Macromolecule synthesis, modification:
FT                   DNA - replication, repair, restr./modific'n"
FT                   /note="Residues 1 to 783 of 783 are 98.85 pct identical to
FT                   residues 1 to 783 of 783 from Escherichia coli K-12 Strain
FT                   MG1655: B0060"
FT                   /db_xref="EnsemblGenomes-Gn:Z0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54364"
FT                   /db_xref="GOA:A0A4Q0C321"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C321"
FT                   /protein_id="AAG54364.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFI
FT                   PADQVPRAQHILRGEQGFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVY
FT                   EADVRPPERYLMERFITSPVWVEGDMHNGAIVNARLKPHPDYRPPLKWVSIDIETTRHG
FT                   ELYCIGLEGCGQRIVYMLGPENGDASALDFELEYVASRPQLLEKLNAWFANYDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRIPLRLGRDNSELEWREHGFKNGVFFAQAKGRLIIDGIEAL
FT                   KSAFWNFSSFSLETVAQELLGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVT
FT                   QIFHKTEIMPFLLERATVNGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHAS
FT                   PGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVTNIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLVS
FT                   SITMRGHQIMRQTKALIEAQGYDVIYGDTDSTFVWLKGAHSEEEATKIGRALVQHVNVW
FT                   WAETLQKQQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLE
FT                   TVRTDWTPLAQQFQQELYLRIFRNEPYQEYFRETIDKLMAGELDARLVYRKRLRRPLSE
FT                   YQRNVPPHVRAARLADEENQKRGRPLQYQNRGTIKYVWTTNGPEPLDYQRSPLDYEHYL
FT                   TRQLQPVAEGILPFIEDNFATLMTGQLGLF"
FT   gene            complement(70787..71482)
FT                   /gene="araD"
FT                   /locus_tag="Z0069"
FT   CDS_pept        complement(70787..71482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="Z0069"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 231 of 231 are 99.13 pct identical to
FT                   residues 1 to 231 of 231 from Escherichia coli K-12 Strain
FT                   MG1655: B0061"
FT                   /db_xref="EnsemblGenomes-Gn:Z0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54365"
FT                   /db_xref="GOA:A0A4Q0C155"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C155"
FT                   /protein_id="AAG54365.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSG
FT                   VDYSIMTADDMVVVSIETGEVVEGAKKPSSDTPTHRLLYQAFPSIGGIVHTHSRHATIW
FT                   AQAGQSIPATGTTHADYFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLDKHYLRK
FT                   HGAKAYYGQ"
FT   gene            complement(71682..73184)
FT                   /gene="araA"
FT                   /locus_tag="Z0070"
FT   CDS_pept        complement(71682..73184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="Z0070"
FT                   /product="L-arabinose isomerase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 500 of 500 are 99.59 pct identical to
FT                   residues 1 to 500 of 500 from Escherichia coli K-12 Strain
FT                   MG1655: B0062"
FT                   /db_xref="EnsemblGenomes-Gn:Z0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54366"
FT                   /db_xref="GOA:P58538"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58538"
FT                   /protein_id="AAG54366.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVKALNTEAKLP
FT                   CKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSW
FT                   MRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIS
FT                   DGDVNALVDEYESCYTMTPATQIHGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAAEEKPILDVQHLGIGGKDDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALN
FT                   LNDMRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR"
FT   gene            complement(73195..74895)
FT                   /gene="araB"
FT                   /locus_tag="Z0072"
FT   CDS_pept        complement(73195..74895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="Z0072"
FT                   /product="L-ribulokinase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 566 of 566 are 99.11 pct identical to
FT                   residues 1 to 566 of 566 from Escherichia coli K-12 Strain
FT                   MG1655: B0063"
FT                   /db_xref="EnsemblGenomes-Gn:Z0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54367"
FT                   /db_xref="GOA:P58541"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58541"
FT                   /protein_id="AAG54367.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCTTGEEIATSVEWYPRWQKGQFCDA
FT                   PNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQSAASWIELCDWVPALLSGTTRPQDIRRGRCSAGHKSLWHESWGGLPPASF
FT                   FDELDPILNRHLPSPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVG
FT                   AGAQPNALVKVIGTSTCDILIADKQSVGERAVKGICGQVDGSVVPGFIGLEAGQSAFGD
FT                   IYAWFGRVLGWPLEQLAAQHPELKEQIDASQKQLLPALTEAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPSAQQKMASA
FT                   VEKTLQPRSEQAQRFEQLYRRYQQWAMSAEQHYLPTSAPAQAAQAVPTL"
FT   gene            75234..76112
FT                   /gene="araC"
FT                   /locus_tag="Z0073"
FT   CDS_pept        75234..76112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="Z0073"
FT                   /product="transcriptional regulator for ara operon"
FT                   /function="regulator; Degradation of small molecules:
FT                   Carbon compounds"
FT                   /note="Residues 1 to 292 of 292 are 100.00 pct identical to
FT                   residues 1 to 292 of 292 from Escherichia coli K-12 Strain
FT                   MG1655: B0064"
FT                   /db_xref="EnsemblGenomes-Gn:Z0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54368"
FT                   /db_xref="GOA:P0A9E1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9E1"
FT                   /protein_id="AAG54368.1"
FT                   /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
FT                   HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
FT                   MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   EKVNDVAVKLS"
FT   gene            76198..76962
FT                   /gene="yabI"
FT                   /locus_tag="Z0074"
FT   CDS_pept        76198..76962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="Z0074"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 254 of 254 are 98.81 pct identical to
FT                   residues 1 to 254 of 254 from Escherichia coli K-12 Strain
FT                   MG1655: B0065"
FT                   /db_xref="EnsemblGenomes-Gn:Z0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54369"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C167"
FT                   /protein_id="AAG54369.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLVRHPLMPVYIDILRKVVGV"
FT   gene            complement(77049..77747)
FT                   /gene="yabJ"
FT                   /locus_tag="Z0075"
FT   CDS_pept        complement(77049..77747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="Z0075"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 232 of 232 are 98.70 pct identical to
FT                   residues 1 to 232 of 232 from Escherichia coli K-12 Strain
FT                   MG1655: B0066"
FT                   /db_xref="EnsemblGenomes-Gn:Z0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54370"
FT                   /db_xref="GOA:Q8XA06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA06"
FT                   /protein_id="AAG54370.1"
FT                   /translation="MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPASGALTIDGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNA
FT                   VQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPA
FT                   LRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKA
FT                   SASALLGITG"
FT   gene            complement(77731..79341)
FT                   /gene="yabK"
FT                   /locus_tag="Z0076"
FT   CDS_pept        complement(77731..79341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="Z0076"
FT                   /product="putative transport system permease protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 536 of 536 are 97.76 pct identical to
FT                   residues 1 to 536 of 536 from Escherichia coli K-12 Strain
FT                   MG1655: B0067"
FT                   /db_xref="EnsemblGenomes-Gn:Z0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54371"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C194"
FT                   /protein_id="AAG54371.1"
FT                   /translation="MATRRQPLIPGWLIPGVSAATLVVAVALAAFLALWWNAPQGDWSA
FT                   VWQDSYLWHVVRFSFWQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALE
FT                   NIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVTALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALIQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDP
FT                   DDRLHSRICDTMLIVLALLLLLPPLLAVIVDGVNRQLPEVLAQPVLWQALWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRARQKMLAGQALEMSGMLILAMPGIVLATGFFLLLNNTIG
FT                   LPQSADGIVIFTNALMAIPYALKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFLLFSVIEKIPGRNVKTD"
FT   gene            complement(79317..80300)
FT                   /gene="tbpA"
FT                   /locus_tag="Z0077"
FT   CDS_pept        complement(79317..80300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="Z0077"
FT                   /product="thiamin-binding periplasmic protein"
FT                   /function="putative transport; Transport of small
FT                   molecules: Other"
FT                   /note="Residues 1 to 327 of 327 are 99.69 pct identical to
FT                   residues 1 to 327 of 327 from Escherichia coli K-12 Strain
FT                   MG1655: B0068"
FT                   /db_xref="EnsemblGenomes-Gn:Z0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54372"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1M3"
FT                   /protein_id="AAG54372.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDIFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
FT   misc_feature    80466..81475
FT                   /note="O-island #3; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            80672..81241
FT                   /locus_tag="Z0078"
FT   CDS_pept        80672..81241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0078"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 8 to 165 of 189 are 38.09 pct identical to
FT                   residues 2 to 163 of 216 from GenPept 118 :
FT                   gi|1786242|gb|AAC73167.1| (AE000116) orf, hypothetical
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1T4"
FT                   /protein_id="AAG54373.1"
FT                   /translation="MKVRNPEQISIPASNTTKDPGLTNSQIIRMANLVKKTENMNIFEE
FT                   LWETLRNLFQSDKHSQTAARQILKDAFYFQNSDDYSKYFTGAVDGKARDKLTHWLIKFN
FT                   ELKEYAKDPENMAAKASLSPEGTLCVSFFIGDEAIFTLELQLKKSTRTGGIDLSNAYFN
FT                   GVVICGIDCLEVDLSNAETNNSRWYD"
FT   gene            complement(81470..83128)
FT                   /gene="yabN"
FT                   /locus_tag="Z0079"
FT   CDS_pept        complement(81470..83128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="Z0079"
FT                   /product="putative transport protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 551 of 552 are 98.72 pct identical to
FT                   residues 1 to 551 of 551 from Escherichia coli K-12 Strain
FT                   MG1655: B0069"
FT                   /db_xref="EnsemblGenomes-Gn:Z0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54374"
FT                   /db_xref="GOA:Q8XA02"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA02"
FT                   /protein_id="AAG54374.1"
FT                   /translation="MPSARLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLN
FT                   TMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVR
FT                   QMLVSHLGRSFRQGRHILRVLYYRPLRNLLPGSALRRSETHIARQIFSSLTRINEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHIADIVS
FT                   PTPWTLDIHLTQPDRWLPLLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNSTNQL
FT                   KIQAFDDFFGYRALIDEVNVWVLPEIADEPAGGLMLKGPQGEEKEIESRLEEGCYYLLF
FT                   DSRTHRGANQQVRDWVSYVLSPTNLVYFAEEQYQQLWFPAYGLLPRWHHARTITSEKPA
FT                   GLESLTLTFYQDHSEHRVIAGIMQQILASHQVTLEIKEISYDQWHEGEIESDIWLNSAN
FT                   FTLPLDFSLFAHLCEVPLLQHCIPIDWQVDAARWRNGEMNLANWCQQLVASKAMVPLIH
FT                   HWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDPE"
FT   gene            complement(83456..84061)
FT                   /gene="leuD"
FT                   /locus_tag="Z0080"
FT   CDS_pept        complement(83456..84061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="Z0080"
FT                   /product="isopropylmalate isomerase subunit"
FT                   /function="enzyme; Amino acid biosynthesis: Leucine"
FT                   /note="Residues 1 to 200 of 201 are 99.50 pct identical to
FT                   residues 1 to 200 of 201 from Escherichia coli K-12 Strain
FT                   MG1655: B0071"
FT                   /db_xref="EnsemblGenomes-Gn:Z0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54375"
FT                   /db_xref="GOA:Q8XA01"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA01"
FT                   /protein_id="AAG54375.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFSQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMR"
FT   gene            complement(84072..85472)
FT                   /gene="leuC"
FT                   /locus_tag="Z0081"
FT   CDS_pept        complement(84072..85472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="Z0081"
FT                   /product="3-isopropylmalate isomerase (dehydratase)
FT                   subunit"
FT                   /function="enzyme; Amino acid biosynthesis: Leucine"
FT                   /note="Residues 1 to 466 of 466 are 99.78 pct identical to
FT                   residues 1 to 466 of 466 from Escherichia coli K-12 Strain
FT                   MG1655: B0072"
FT                   /db_xref="EnsemblGenomes-Gn:Z0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54376"
FT                   /db_xref="GOA:Q8XA00"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA00"
FT                   /protein_id="AAG54376.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGILLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
FT   gene            complement(85475..86569)
FT                   /gene="leuB"
FT                   /locus_tag="Z0082"
FT   CDS_pept        complement(85475..86569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="Z0082"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /function="enzyme; Amino acid biosynthesis: Leucine"
FT                   /note="Residues 1 to 364 of 364 are 99.45 pct identical to
FT                   residues 1 to 364 of 364 from Escherichia coli K-12 Strain
FT                   MG1655: B0073"
FT                   /db_xref="EnsemblGenomes-Gn:Z0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54377"
FT                   /db_xref="GOA:Q8X9Z9"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Z9"
FT                   /protein_id="AAG54377.1"
FT                   /translation="MMSKNYHIAVLPGDGIGPEVMTQALKVLDAVRNRFAMRITTSHYD
FT                   VGGAAIDNHGQPLPPATVEGCEQADAVLFGSVGGPKWEHLPPDQQPERGALLPLRKHFK
FT                   LFSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAF
FT                   DTEVYHRFEIERIARIAFESARKRRHKVTSIDKANVLQSSILWREIVNEIATEYPDIEL
FT                   AHMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLY
FT                   EPAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADDAASAIERAINRALEEGIRTGDL
FT                   ARGAAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(86566..88137)
FT                   /gene="leuA"
FT                   /locus_tag="Z0083"
FT   CDS_pept        complement(86566..88137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="Z0083"
FT                   /product="2-isopropylmalate synthase"
FT                   /function="enzyme; Amino acid biosynthesis: Leucine"
FT                   /note="Residues 1 to 523 of 523 are 99.61 pct identical to
FT                   residues 1 to 523 of 523 from Escherichia coli K-12 Strain
FT                   MG1655: B0074"
FT                   /db_xref="EnsemblGenomes-Gn:Z0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54378"
FT                   /db_xref="GOA:Q8X9Z8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Z8"
FT                   /protein_id="AAG54378.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARQVKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGA
FT                   TTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGLAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCSLEEVIMAIKVRKDILNVHTAINHQEIWRTSQLVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MDEMGYKESEYNLDNLYDAFLKLADKKGQVFDYDLEALAFIGKQQEEPEHFRLDYFSVQ
FT                   SGSNDIATAAVKLACGEEVKAEAANGNGPVDAVYQAINRITDYNVELVKYSLTAKGHGK
FT                   DALGQVDIVANYNGRRFHGVGLATDIVESSAKAMVHVLNNIWRATEVEKELQRKAQHNE
FT                   NNKETV"
FT   gene            complement(88230..88316)
FT                   /gene="leuL"
FT                   /locus_tag="Z0084"
FT   CDS_pept        complement(88230..88316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="Z0084"
FT                   /product="leu operon leader peptide"
FT                   /function="leader; Amino acid biosynthesis: Leucine"
FT                   /note="Residues 1 to 28 of 28 are 100.00 pct identical to
FT                   residues 1 to 28 of 28 from Escherichia coli K-12 Strain
FT                   MG1655: B0075"
FT                   /db_xref="EnsemblGenomes-Gn:Z0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54379"
FT                   /db_xref="GOA:P0AD81"
FT                   /db_xref="InterPro:IPR012570"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD81"
FT                   /protein_id="AAG54379.1"
FT                   /translation="MTHIVRFIGLLLLNASSLRGRRVSGIQH"
FT   gene            88956..89918
FT                   /gene="leuO"
FT                   /locus_tag="Z0086"
FT   CDS_pept        88956..89918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="Z0086"
FT                   /product="probable transcriptional activator for leuABCD
FT                   operon"
FT                   /function="putative regulator; Amino acid biosynthesis:
FT                   Leucine"
FT                   /note="Residues 1 to 320 of 320 are 99.06 pct identical to
FT                   residues 54 to 373 of 373 from Escherichia coli K-12 Strain
FT                   MG1655: B0076"
FT                   /db_xref="EnsemblGenomes-Gn:Z0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54380"
FT                   /db_xref="GOA:Q8X9Z7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9Z7"
FT                   /protein_id="AAG54380.1"
FT                   /translation="MTVELSMPEVQTDHPETAEFSKPQLRMVDLNLLTVFDAVMQEQNI
FT                   TRAAHVLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQN
FT                   ELPGSGFEPASSERVFHLCVCSPLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQL
FT                   RYQETEFVISYEDFHRPEFTSVPLFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSL
FT                   DRFASFSQPWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQV
FT                   LPLPLKLNSRTCYLSWHEAAGRDKGHQWMEEQLVSICKR"
FT   gene            90152..91960
FT                   /gene="ilvI"
FT                   /locus_tag="Z0087"
FT   CDS_pept        90152..91960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="Z0087"
FT                   /product="acetolactate synthase III, valine sensitive,
FT                   large subunit"
FT                   /function="enzyme; Amino acid biosynthesis: Isoleucine"
FT                   /note="Residues 1 to 602 of 602 are 99.33 pct identical to
FT                   residues 3 to 604 of 604 from Escherichia coli K-12 Strain
FT                   MG1655: B0077"
FT                   /db_xref="EnsemblGenomes-Gn:Z0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54381"
FT                   /db_xref="GOA:Q8X9Z6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9Z6"
FT                   /protein_id="AAG54381.1"
FT                   /translation="MSLAANCLSKIGRLMCFTHFFRQTVRQAMEMLSGAEMVVRSLIDQ
FT                   GVKQVFGYPGGAVLDIYDALHTVGGIGHVLVRHEQAAVHMADGLARATGEVGVVLVTSG
FT                   PGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKHSFLVKQT
FT                   EDIPQVLKKAFWLAASGRPGPVVVDLPKDILNPANKLPYVWPESVSMRSYNPTTTGHKG
FT                   QIKRALQTLVAAKKPVVYVGGGAITAGCHQQLKETVEALNLPVVSSLMGLGAFPATHRQ
FT                   ALGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATVLHIDIDPTSISK
FT                   TVTADIPIVGDARQVLEQMLELLSQESAHQPLDEIRDWWQQIEQWRARQCLKYDTHSEK
FT                   IKPQAVIETLWRLTKGGAYVTSDVGQHQMFAALYYPFDKPRRWINSGGLGTMGFGLPAA
FT                   LGVKMALPEETVVCVTGDGSIQMNIQELSTALQYELPVLVVNLNNRYLGMVKQWQDMIY
FT                   SGRHSQSYMQSLPDFVRLAEAYGHVGIQISHPQELESKLSEALEQVRNNRLVFVDVTVD
FT                   GSEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            91963..92454
FT                   /gene="ilvH"
FT                   /locus_tag="Z0088"
FT   CDS_pept        91963..92454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="Z0088"
FT                   /product="acetolactate synthase III, valine sensitive,
FT                   small subunit"
FT                   /function="enzyme; Amino acid biosynthesis: Isoleucine"
FT                   /note="Residues 1 to 163 of 163 are 98.77 pct identical to
FT                   residues 1 to 163 of 163 from Escherichia coli K-12 Strain
FT                   MG1655: B0078"
FT                   /db_xref="EnsemblGenomes-Gn:Z0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54382"
FT                   /db_xref="GOA:A0A4Q0C4P4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C4P4"
FT                   /protein_id="AAG54382.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLYKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
FT   gene            92466..92552
FT                   /gene="fruL"
FT                   /locus_tag="Z0089"
FT   CDS_pept        92466..92552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruL"
FT                   /locus_tag="Z0089"
FT                   /product="fruR leader peptide"
FT                   /function="leader; Energy metabolism, carbon: Glycolysis"
FT                   /note="Residues 1 to 28 of 28 are 100.00 pct identical to
FT                   residues 1 to 28 of 28 from Escherichia coli K-12 Strain
FT                   MG1655: B0079"
FT                   /db_xref="EnsemblGenomes-Gn:Z0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Z4"
FT                   /protein_id="AAG54383.1"
FT                   /translation="MRNLQPNMSRWAFFAKSVGTWNKSSCRS"
FT   gene            92634..93638
FT                   /gene="fruR"
FT                   /locus_tag="Z0090"
FT   CDS_pept        92634..93638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="Z0090"
FT                   /product="transcriptional repressor of fru operon and
FT                   others"
FT                   /function="regulator; Energy metabolism, carbon:
FT                   Glycolysis"
FT                   /note="Residues 1 to 334 of 334 are 100.00 pct identical to
FT                   residues 1 to 334 of 334 from Escherichia coli K-12 Strain
FT                   MG1655: B0080"
FT                   /db_xref="EnsemblGenomes-Gn:Z0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54384"
FT                   /db_xref="GOA:P0ACP3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACP3"
FT                   /protein_id="AAG54384.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
FT   gene            94240..94698
FT                   /gene="yabB"
FT                   /locus_tag="Z0091"
FT   CDS_pept        94240..94698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="Z0091"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 152 of 152 are 99.34 pct identical to
FT                   residues 1 to 152 of 152 from Escherichia coli K-12 Strain
FT                   MG1655: B0081"
FT                   /db_xref="EnsemblGenomes-Gn:Z0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54385"
FT                   /db_xref="GOA:P65435"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65435"
FT                   /protein_id="AAG54385.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
FT   gene            94700..95641
FT                   /gene="yabC"
FT                   /locus_tag="Z0092"
FT   CDS_pept        94700..95641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="Z0092"
FT                   /product="putative apolipoprotein"
FT                   /function="orf; Not classified"
FT                   /note="Residues 1 to 313 of 313 are 100.00 pct identical to
FT                   residues 1 to 313 of 313 from Escherichia coli K-12 Strain
FT                   MG1655: B0082"
FT                   /db_xref="EnsemblGenomes-Gn:Z0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54386"
FT                   /db_xref="GOA:P60391"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60391"
FT                   /protein_id="AAG54386.1"
FT                   /translation="MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLNVLAPGGRLSIISFHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQL
FT                   RALGKLMPGEEEVAENPRARSSVLRIAERTNA"
FT   gene            95638..96003
FT                   /gene="ftsL"
FT                   /locus_tag="Z0093"
FT   CDS_pept        95638..96003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="Z0093"
FT                   /product="cell division protein; ingrowth of wall at
FT                   septum"
FT                   /function="phenotype; Cell division"
FT                   /note="Residues 1 to 121 of 121 are 100.00 pct identical to
FT                   residues 1 to 121 of 121 from Escherichia coli K-12 Strain
FT                   MG1655: B0083"
FT                   /db_xref="EnsemblGenomes-Gn:Z0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54387"
FT                   /db_xref="GOA:P0AEN6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEN6"
FT                   /protein_id="AAG54387.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            96019..97785
FT                   /gene="ftsI"
FT                   /locus_tag="Z0094"
FT   CDS_pept        96019..97785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="Z0094"
FT                   /product="septum formation; penicillin-binding protein 3;
FT                   peptidoglycan synthetase"
FT                   /function="enzyme; Cell division"
FT                   /note="Residues 1 to 588 of 588 are 100.00 pct identical to
FT                   residues 1 to 588 of 588 from Escherichia coli K-12 Strain
FT                   MG1655: B0084"
FT                   /db_xref="EnsemblGenomes-Gn:Z0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54388"
FT                   /db_xref="GOA:P0AD69"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD69"
FT                   /protein_id="AAG54388.1"
FT                   /translation="MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWL
FT                   QVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERV
FT                   FPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEF
FT                   VINQGEGTGGRS"
FT   gene            97772..99259
FT                   /gene="murE"
FT                   /locus_tag="Z0095"
FT   CDS_pept        97772..99259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="Z0095"
FT                   /product="meso-diaminopimelate-adding enzyme"
FT                   /function="enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 495 of 495 are 98.98 pct identical to
FT                   residues 1 to 495 of 495 from Escherichia coli K-12 Strain
FT                   MG1655: B0085"
FT                   /db_xref="EnsemblGenomes-Gn:Z0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54389"
FT                   /db_xref="GOA:Q8X9Z2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Z2"
FT                   /protein_id="AAG54389.1"
FT                   /translation="MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKGEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHE
FT                   PSDNLXXVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHELAGLVDQDATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYE
FT                   AAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNY
FT                   HDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEDRAEAVTCAVMQAKEN
FT                   DVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIA"
FT   gene            99256..100614
FT                   /gene="murF"
FT                   /locus_tag="Z0096"
FT   CDS_pept        99256..100614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="Z0096"
FT                   /product="D-alanine:D-alanine-adding enzyme"
FT                   /function="enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 452 of 452 are 99.33 pct identical to
FT                   residues 1 to 452 of 452 from Escherichia coli K-12 Strain
FT                   MG1655: B0086"
FT                   /db_xref="EnsemblGenomes-Gn:Z0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54390"
FT                   /db_xref="GOA:A0A4Q0C2F7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2F7"
FT                   /protein_id="AAG54390.1"
FT                   /translation="MISVTLSQLTDILNGELQGADITLDAVTTDTRKLTPGCLFVALKG
FT                   ERFDAHDFADQAKAGGAGALLVSRPLDIDLPQLIVKDTRLAFGELAAWVRQQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANH
FT                   QGEIVWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNN
FT                   DWLNWQSVIGSRKVWRFSPNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRH
FT                   NIANALAAAALSMSVGATLDAIKAGLANLKAVPGRLFPIQLAENQLLLDDSYNANVGSM
FT                   TAAVQVLAEMPGYRVLVVGDMAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAIST
FT                   ASGVGEHFAEKTALITRLKSLIAEQQVITILVKGSRSAAMEEVVRALQENGTC"
FT   gene            100608..101690
FT                   /gene="mraY"
FT                   /locus_tag="Z0097"
FT   CDS_pept        100608..101690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="Z0097"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /function="enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 360 of 360 are 99.72 pct identical to
FT                   residues 1 to 360 of 360 from Escherichia coli K-12 Strain
FT                   MG1655: B0087"
FT                   /db_xref="EnsemblGenomes-Gn:Z0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54391"
FT                   /db_xref="GOA:P64258"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64258"
FT                   /protein_id="AAG54391.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   AHLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LVGYGVIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNM
FT                   NFASYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            101693..103009
FT                   /gene="murD"
FT                   /locus_tag="Z0098"
FT   CDS_pept        101693..103009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="Z0098"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /function="enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 438 of 438 are 99.77 pct identical to
FT                   residues 1 to 438 of 438 from Escherichia coli K-12 Strain
FT                   MG1655: B0088"
FT                   /db_xref="EnsemblGenomes-Gn:Z0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54392"
FT                   /db_xref="GOA:Q8X9Y9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Y9"
FT                   /protein_id="AAG54392.1"
FT                   /translation="MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLD
FT                   KLPEAVERHTGSLNDEWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDDECELYVLELSSFQ
FT                   LETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIR
FT                   GADERCVSFGVNMGDYHLNHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AAGLPRASSLKALTTFTGLPHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLARYLNGDNVRLYCFGRDGVQLAALRPEVAEQTETMEQAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGNEFARLAKELG"
FT   gene            103009..104253
FT                   /gene="ftsW"
FT                   /locus_tag="Z0099"
FT   CDS_pept        103009..104253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="Z0099"
FT                   /product="cell division; membrane protein involved in shape
FT                   determination"
FT                   /function="membrane; Cell division"
FT                   /note="Residues 1 to 414 of 414 are 100.00 pct identical to
FT                   residues 1 to 414 of 414 from Escherichia coli K-12 Strain
FT                   MG1655: B0089"
FT                   /db_xref="EnsemblGenomes-Gn:Z0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54393"
FT                   /db_xref="GOA:P0ABG6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABG6"
FT                   /protein_id="AAG54393.1"
FT                   /translation="MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYD
FT                   RTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPM
FT                   EFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANY
FT                   LVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFVRGSR"
FT   gene            104250..105317
FT                   /gene="murG"
FT                   /locus_tag="Z0100"
FT   CDS_pept        104250..105317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="Z0100"
FT                   /product="UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /function="enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 355 of 355 are 99.43 pct identical to
FT                   residues 1 to 355 of 355 from Escherichia coli K-12 Strain
FT                   MG1655: B0090"
FT                   /db_xref="EnsemblGenomes-Gn:Z0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54394"
FT                   /db_xref="GOA:Q8X9Y8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Y8"
FT                   /protein_id="AAG54394.1"
FT                   /translation="MSAQGKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIFNAWRQARAIMKAYKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGS
FT                   QQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGWSRETLLTMAERARAASIPD
FT                   ATERVANEVSRAARA"
FT   gene            105371..106846
FT                   /gene="murC"
FT                   /locus_tag="Z0101"
FT   CDS_pept        105371..106846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="Z0101"
FT                   /product="L-alanine adding enzyme,
FT                   UDP-N-acetyl-muramate:alanine ligase"
FT                   /function="enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 491 of 491 are 99.79 pct identical to
FT                   residues 1 to 491 of 491 from Escherichia coli K-12 Strain
FT                   MG1655: B0091"
FT                   /db_xref="EnsemblGenomes-Gn:Z0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54395"
FT                   /db_xref="GOA:P65471"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65471"
FT                   /protein_id="AAG54395.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLMNLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHGRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQDKEP
FT                   MRVTLNAPGRHNALNAAAAVAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKSGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLT
FT                   QVDTLLMLEVYPAGEAPIPGADSRSLCRTIRGRGKIDPILVPDPAQVAEMLAPVLTGND
FT                   LILVQGAGNIGKIARSLAEIKLKPQTPEEEQHD"
FT   gene            106839..107759
FT                   /gene="ddlB"
FT                   /locus_tag="Z0102"
FT   CDS_pept        106839..107759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="Z0102"
FT                   /product="D-alanine-D-alanine ligase B, affects cell
FT                   division"
FT                   /function="enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 306 of 306 are 99.34 pct identical to
FT                   residues 1 to 306 of 306 from Escherichia coli K-12 Strain
FT                   MG1655: B0092"
FT                   /db_xref="EnsemblGenomes-Gn:Z0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54396"
FT                   /db_xref="GOA:Q8X9Y6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Y6"
FT                   /protein_id="AAG54396.1"
FT                   /translation="MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEV
FT                   DVTQLKSMGFQKVFIALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRVEFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENAL
FT                   QDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSVRIQPSGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            107761..108591
FT                   /gene="ftsQ"
FT                   /locus_tag="Z0103"
FT   CDS_pept        107761..108591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="Z0103"
FT                   /product="cell division protein; ingrowth of wall at
FT                   septum"
FT                   /function="phenotype; Cell division"
FT                   /note="Residues 1 to 276 of 276 are 99.63 pct identical to
FT                   residues 1 to 276 of 276 from Escherichia coli K-12 Strain
FT                   MG1655: B0093"
FT                   /db_xref="EnsemblGenomes-Gn:Z0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54397"
FT                   /db_xref="GOA:A0A4V1JDG1"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDG1"
FT                   /protein_id="AAG54397.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
FT   gene            108588..109850
FT                   /gene="ftsA"
FT                   /locus_tag="Z0104"
FT   CDS_pept        108588..109850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="Z0104"
FT                   /product="ATP-binding cell division protein, septation
FT                   process, complexes with FtsZ, associated with junctions of
FT                   inner and outer membranes"
FT                   /function="phenotype; Cell division"
FT                   /note="Residues 1 to 420 of 420 are 100.00 pct identical to
FT                   residues 1 to 420 of 420 from Escherichia coli K-12 Strain
FT                   MG1655: B0094"
FT                   /db_xref="EnsemblGenomes-Gn:Z0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54398"
FT                   /db_xref="GOA:P0ABH2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABH2"
FT                   /protein_id="AAG54398.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            109911..111062
FT                   /gene="ftsZ"
FT                   /locus_tag="Z0105"
FT   CDS_pept        109911..111062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="Z0105"
FT                   /product="cell division; forms circumferential ring;
FT                   tubulin-like GTP-binding protein and GTPase"
FT                   /function="enzyme; Cell division"
FT                   /note="Residues 1 to 383 of 383 are 100.00 pct identical to
FT                   residues 1 to 383 of 383 from Escherichia coli K-12 Strain
FT                   MG1655: B0095"
FT                   /db_xref="EnsemblGenomes-Gn:Z0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54399"
FT                   /db_xref="GOA:P0A9A8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9A8"
FT                   /protein_id="AAG54399.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD"
FT   gene            111163..112080
FT                   /gene="lpxC"
FT                   /locus_tag="Z0106"
FT   CDS_pept        111163..112080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="Z0106"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase;
FT                   lipid A biosynthesis"
FT                   /function="enzyme; Cell exterior constituents: Surface
FT                   polysaccharides and antigens"
FT                   /note="Residues 1 to 305 of 305 are 100.00 pct identical to
FT                   residues 1 to 305 of 305 from Escherichia coli K-12 Strain
FT                   MG1655: B0096"
FT                   /db_xref="EnsemblGenomes-Gn:Z0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54400"
FT                   /db_xref="GOA:P0A727"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A727"
FT                   /protein_id="AAG54400.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFKPYNGFSLDFTIDFNH
FT                   PAIDSSNQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEYVTFQDDAELPLAFKAPSAVLA"
FT   gene            112236..112823
FT                   /gene="yacA"
FT                   /locus_tag="Z0107"
FT   CDS_pept        112236..112823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacA"
FT                   /locus_tag="Z0107"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 195 of 195 are 98.97 pct identical to
FT                   residues 1 to 195 of 195 from Escherichia coli K-12 Strain
FT                   MG1655: B0097"
FT                   /db_xref="EnsemblGenomes-Gn:Z0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54401"
FT                   /db_xref="GOA:P62397"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62397"
FT                   /protein_id="AAG54401.1"
FT                   /translation="MLWTSGFNDKICALNTFEYDRDGNNVSGILTRWRQFGKRYFWPHL
FT                   LLGMVAASLGLPALSNAAEPNAPAKATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVD
FT                   YWHQHAIRTVIRHLSFAMAPQTLPVAEESLPLQAQHLALLDTLSALLTQEGTPSEKGYR
FT                   IDYAHFTPQAKFSTPVWISQAQGIRAGPQRLS"
FT   gene            112885..115590
FT                   /gene="secA"
FT                   /locus_tag="Z0108"
FT   CDS_pept        112885..115590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="Z0108"
FT                   /product="preprotein translocase; secretion protein"
FT                   /function="transport; Transport of large molecules:
FT                   Protein, peptide secretion"
FT                   /note="Residues 1 to 901 of 901 are 99.88 pct identical to
FT                   residues 1 to 901 of 901 from Escherichia coli K-12 Strain
FT                   MG1655: B0098"
FT                   /db_xref="EnsemblGenomes-Gn:Z0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54402"
FT                   /db_xref="GOA:Q8X996"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X996"
FT                   /protein_id="AAG54402.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKG
FT                   KTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTIS
FT                   IEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGG
FT                   SWQAEVAALENPTAEQIEKIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
FT   gene            115650..116048
FT                   /gene="mutT"
FT                   /locus_tag="Z0109"
FT   CDS_pept        115650..116048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="Z0109"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase, prefers
FT                   dGTP, causes AT-GC transversions"
FT                   /function="enzyme; Central intermediary metabolism:
FT                   2'-Deoxyribonucleotide metabolism"
FT                   /note="Residues 1 to 129 of 132 are 97.67 pct identical to
FT                   residues 1 to 129 of 129 from Escherichia coli K-12 Strain
FT                   MG1655: B0099"
FT                   /db_xref="EnsemblGenomes-Gn:Z0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54403"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C189"
FT                   /protein_id="AAG54403.1"
FT                   /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGET
FT                   PEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVESWEGEPWGKEGQPGKW
FT                   MSLVGLNADDFPPANEPVIAKLKRVYVG"
FT   gene            complement(116054..116188)
FT                   /locus_tag="Z0110"
FT   CDS_pept        complement(116054..116188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0110"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 44 of 44 are 97.72 pct identical to
FT                   residues 1 to 44 of 44 from Escherichia coli K-12 Strain
FT                   MG1655: B0100"
FT                   /db_xref="EnsemblGenomes-Gn:Z0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBR9"
FT                   /protein_id="AAG54404.1"
FT                   /translation="MAIFPKAMTGAKSQSSDICLMPHVGLIRRGQRRIRHLVQMSDAA"
FT   gene            complement(116139..116336)
FT                   /gene="yacG"
FT                   /locus_tag="Z0111"
FT   CDS_pept        complement(116139..116336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="Z0111"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 65 of 65 are 100.00 pct identical to
FT                   residues 1 to 65 of 65 from Escherichia coli K-12 Strain
FT                   MG1655: B0101"
FT                   /db_xref="EnsemblGenomes-Gn:Z0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54405"
FT                   /db_xref="GOA:P0A8H9"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8H9"
FT                   /protein_id="AAG54405.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
FT   gene            complement(116346..117089)
FT                   /gene="yacF"
FT                   /locus_tag="Z0112"
FT   CDS_pept        complement(116346..117089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="Z0112"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 247 of 247 are 99.59 pct identical to
FT                   residues 1 to 247 of 247 from Escherichia coli K-12 Strain
FT                   MG1655: B0102"
FT                   /db_xref="EnsemblGenomes-Gn:Z0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54406"
FT                   /db_xref="GOA:Q8X988"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X988"
FT                   /protein_id="AAG54406.1"
FT                   /translation="MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFR
FT                   NVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDCQVETWIASLNP
FT                   LTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRF
FT                   AIRFMPLDTENGQVPERLDFELACC"
FT   gene            complement(117089..117709)
FT                   /gene="yacE"
FT                   /locus_tag="Z0113"
FT   CDS_pept        complement(117089..117709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacE"
FT                   /locus_tag="Z0113"
FT                   /product="putative DNA repair protein"
FT                   /function="orf; Not classified"
FT                   /note="Residues 1 to 206 of 206 are 100.00 pct identical to
FT                   residues 1 to 206 of 206 from Escherichia coli K-12 Strain
FT                   MG1655: B0103"
FT                   /db_xref="EnsemblGenomes-Gn:Z0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54407"
FT                   /db_xref="GOA:P0A6J0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6J0"
FT                   /protein_id="AAG54407.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
FT   gene            117934..118977
FT                   /gene="guaC"
FT                   /locus_tag="Z0114"
FT   CDS_pept        117934..118977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="Z0114"
FT                   /product="GMP reductase"
FT                   /function="enzyme; Nucleotide biosynthesis: Purine
FT                   ribonucleotide biosynthesis"
FT                   /note="Residues 1 to 347 of 347 are 99.71 pct identical to
FT                   residues 1 to 347 of 347 from Escherichia coli K-12 Strain
FT                   MG1655: B0104"
FT                   /db_xref="EnsemblGenomes-Gn:Z0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54408"
FT                   /db_xref="GOA:Q8X984"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X984"
FT                   /protein_id="AAG54408.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWS
FT                   GVPIIAANMDTVGTFSMASALASFDILTAVHKHYSVEEWQAFINNSSADVLKHVMVSTG
FT                   TSDADFEKTKQILDLNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIISDGGC
FT                   TTPGDVAKAFGGGADFVMLGGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGG
FT                   VAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNNL"
FT   gene            complement(118897..119004)
FT                   /locus_tag="Z0115"
FT   CDS_pept        complement(118897..119004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0115"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 35 of 35 are 88.57 pct identical to
FT                   residues 1 to 35 of 35 from Escherichia coli K-12 Strain
FT                   MG1655: B0105"
FT                   /db_xref="EnsemblGenomes-Gn:Z0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDA3"
FT                   /protein_id="AAG54409.1"
FT                   /translation="MLLHTSVGRLQVVEDAVFLFLHTDKCGALGQFFQA"
FT   gene            complement(119012..120214)
FT                   /gene="hofC"
FT                   /locus_tag="Z0116"
FT   CDS_pept        complement(119012..120214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="Z0116"
FT                   /product="putative integral membrane protein involved in
FT                   biogenesis of fimbriae, protein transport, DNA uptake"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 400 of 400 are 97.50 pct identical to
FT                   residues 1 to 400 of 400 from Escherichia coli K-12 Strain
FT                   MG1655: B0106"
FT                   /db_xref="EnsemblGenomes-Gn:Z0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54410"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C362"
FT                   /protein_id="AAG54410.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQRAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWGWLLVL
FT                   FGIMLTIANKLLMRRPTWLIARQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNIAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(120204..121589)
FT                   /gene="hofB"
FT                   /locus_tag="Z0117"
FT   CDS_pept        complement(120204..121589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="Z0117"
FT                   /product="putative integral membrane protein involved in
FT                   biogenesis of fimbriae, protein transport, DNA uptake"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 461 of 461 are 99.13 pct identical to
FT                   residues 1 to 461 of 461 from Escherichia coli K-12 Strain
FT                   MG1655: B0107"
FT                   /db_xref="EnsemblGenomes-Gn:Z0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54411"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1RTL4"
FT                   /protein_id="AAG54411.1"
FT                   /translation="MNIPQLTALCLRYQGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLPCRGGEKVVLRLLQQVSQALDVNTLGMQPLQLAGFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQKLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPVNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
FT   gene            complement(121599..122039)
FT                   /gene="ppdD"
FT                   /locus_tag="Z0118"
FT   CDS_pept        complement(121599..122039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="Z0118"
FT                   /product="prelipin peptidase dependent protein"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 146 of 146 are 99.31 pct identical to
FT                   residues 1 to 146 of 146 from Escherichia coli K-12 Strain
FT                   MG1655: B0108"
FT                   /db_xref="EnsemblGenomes-Gn:Z0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54412"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2H7"
FT                   /protein_id="AAG54412.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWARNCNIQSDSALQQACEDVFRFDDAN"
FT   gene            complement(122242..123135)
FT                   /gene="nadC"
FT                   /locus_tag="Z0119"
FT   CDS_pept        complement(122242..123135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="Z0119"
FT                   /product="quinolinate phosphoribosyltransferase"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Pyridine nucleotide"
FT                   /note="Residues 1 to 297 of 297 are 99.66 pct identical to
FT                   residues 1 to 297 of 297 from Escherichia coli K-12 Strain
FT                   MG1655: B0109"
FT                   /db_xref="EnsemblGenomes-Gn:Z0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54413"
FT                   /db_xref="GOA:A0A4Q0C197"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C197"
FT                   /protein_id="AAG54413.1"
FT                   /translation="MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDI
FT                   TAKLLPENSRSHATVITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQPL
FT                   FELEGPSRVLLTGERTALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSAL
FT                   KYAVLCGGGANHRLGLSDAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEEL
FT                   DEALKAGADIIMLDNFETEQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVG
FT                   ALTKHVQALDLSMRFR"
FT   gene            123223..123774
FT                   /gene="ampD"
FT                   /locus_tag="Z0120"
FT   CDS_pept        123223..123774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="Z0120"
FT                   /product="regulates ampC"
FT                   /function="regulator; Not classified"
FT                   /note="Residues 1 to 183 of 183 are 98.90 pct identical to
FT                   residues 1 to 183 of 183 from Escherichia coli K-12 Strain
FT                   MG1655: B0110"
FT                   /db_xref="EnsemblGenomes-Gn:Z0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54414"
FT                   /db_xref="GOA:A0A4Q0C1A1"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1A1"
FT                   /protein_id="AAG54414.1"
FT                   /translation="MLLEQGWLVGARRVPSPHYDCRPDDETPTLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPQAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSQYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRALIDCYPDIANNMTGHCDIAPDRKT
FT                   DPGPAFDWARFRALVSKETT"
FT   gene            123771..124625
FT                   /gene="ampE"
FT                   /locus_tag="Z0121"
FT   CDS_pept        123771..124625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="Z0121"
FT                   /product="regulates ampC"
FT                   /function="regulator; Protection responses: Drug/analog
FT                   sensitivity"
FT                   /note="Residues 1 to 284 of 284 are 99.64 pct identical to
FT                   residues 1 to 284 of 284 from Escherichia coli K-12 Strain
FT                   MG1655: B0111"
FT                   /db_xref="EnsemblGenomes-Gn:Z0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54415"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C192"
FT                   /protein_id="AAG54415.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFRTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
FT   gene            complement(124668..126041)
FT                   /gene="aroP"
FT                   /locus_tag="Z0122"
FT   CDS_pept        complement(124668..126041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="Z0122"
FT                   /product="aromatic amino acid transport protein"
FT                   /function="transport; Transport of small molecules: Amino
FT                   acids, amines"
FT                   /note="Residues 1 to 457 of 457 are 99.12 pct identical to
FT                   residues 1 to 457 of 457 from Escherichia coli K-12 Strain
FT                   MG1655: B0112"
FT                   /db_xref="EnsemblGenomes-Gn:Z0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54416"
FT                   /db_xref="GOA:Q8X968"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X968"
FT                   /protein_id="AAG54416.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVTVFGEMEFWFAIIKVIA
FT                   VVAMIIFGGWLLFSGNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAVVLVIMLMTPGMAISVYLIPVWLVVLGIGYLFKEKTAKAVKAH"
FT   gene            126582..127346
FT                   /gene="pdhR"
FT                   /locus_tag="Z0123"
FT   CDS_pept        126582..127346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="Z0123"
FT                   /product="transcriptional regulator for pyruvate
FT                   dehydrogenase complex"
FT                   /function="regulator; Energy metabolism, carbon: Pyruvate
FT                   dehydrogenase"
FT                   /note="Residues 1 to 254 of 254 are 100.00 pct identical to
FT                   residues 1 to 254 of 254 from Escherichia coli K-12 Strain
FT                   MG1655: B0113"
FT                   /db_xref="EnsemblGenomes-Gn:Z0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54417"
FT                   /db_xref="GOA:P0ACM1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACM1"
FT                   /protein_id="AAG54417.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQYDLLETR
FT                   HALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGDLDAESNAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYSRREMLPLVSSHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEILLDRSREESRRERSLRRLEQRKN"
FT   gene            127507..130170
FT                   /gene="aceE"
FT                   /locus_tag="Z0124"
FT   CDS_pept        127507..130170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="Z0124"
FT                   /product="pyruvate dehydrogenase (decarboxylase component)"
FT                   /function="enzyme; Energy metabolism, carbon: Pyruvate
FT                   dehydrogenase"
FT                   /note="Residues 1 to 887 of 887 are 100.00 pct identical to
FT                   residues 1 to 887 of 887 from Escherichia coli K-12 Strain
FT                   MG1655: B0114"
FT                   /db_xref="EnsemblGenomes-Gn:Z0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54418"
FT                   /db_xref="GOA:P0AFG9"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="PDB:3LPL"
FT                   /db_xref="PDB:3LQ2"
FT                   /db_xref="PDB:3LQ4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFG9"
FT                   /protein_id="AAG54418.1"
FT                   /translation="MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEAR
FT                   KGGVNVAAGTGISNYINTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQL
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGD
FT                   AAEGKNIAHQVKKMNMDGVRHIRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQK
FT                   LHGYLPSRQPNFTEKLELPSLQDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   CSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   IAKFNIDADKVNPRLA"
FT   gene            130185..132077
FT                   /gene="aceF"
FT                   /locus_tag="Z0125"
FT   CDS_pept        130185..132077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="Z0125"
FT                   /product="pyruvate dehydrogenase
FT                   (dihydrolipoyltransacetylase component)"
FT                   /function="enzyme; Energy metabolism, carbon: Pyruvate
FT                   dehydrogenase"
FT                   /note="Residues 1 to 630 of 630 are 99.52 pct identical to
FT                   residues 1 to 630 of 630 from Escherichia coli K-12 Strain
FT                   MG1655: B0115"
FT                   /db_xref="EnsemblGenomes-Gn:Z0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54419"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TZW6"
FT                   /protein_id="AAG54419.1"
FT                   /translation="MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGIVKEIKVSVGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAVPEAAA
FT                   AKDVNVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVT
FT                   EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREF
FT                   GVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGE
FT                   IEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKIT
FT                   PVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKK
FT                   GIIELSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVS
FT                   KSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLVM"
FT   gene            132285..133709
FT                   /gene="lpdA"
FT                   /locus_tag="Z0126"
FT   CDS_pept        132285..133709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="Z0126"
FT                   /product="lipoamide dehydrogenase (NADH); component of
FT                   2-oxodehydrogenase and pyruvate complexes; L-protein of
FT                   glycine cleavage complex"
FT                   /function="enzyme; Energy metabolism, carbon: Pyruvate
FT                   dehydrogenase"
FT                   /note="Residues 1 to 474 of 474 are 100.00 pct identical to
FT                   residues 1 to 474 of 474 from Escherichia coli K-12 Strain
FT                   MG1655: B0116"
FT                   /db_xref="EnsemblGenomes-Gn:Z0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54420"
FT                   /db_xref="GOA:P0A9P2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9P2"
FT                   /protein_id="AAG54420.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRIW
FT                   DSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
FT   gene            complement(133780..135633)
FT                   /gene="yacH"
FT                   /locus_tag="Z0127"
FT   CDS_pept        complement(133780..135633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="Z0127"
FT                   /product="putative membrane protein"
FT                   /function="putative membrane; Not classified"
FT                   /note="Residues 1 to 617 of 617 are 96.92 pct identical to
FT                   residues 1 to 617 of 617 from Escherichia coli K-12 Strain
FT                   MG1655: B0117"
FT                   /db_xref="EnsemblGenomes-Gn:Z0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54421"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C371"
FT                   /protein_id="AAG54421.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVETQSTQL
FT                   AVSDAAAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPT
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKTVPVTQTVTAPVIPSNTVST
FT                   ANPVITEPATTVISIEPGNPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDNYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVHEKMQTNPQNQQRREAARERIQPASPEQRQAVREKMQTN
FT                   PQIQQRRDAARERIQSASPEQRQVFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFRE
FT                   KVQESRPQRLNDSNHTARLNNEQRSAVRERLSERGARRLER"
FT   gene            135988..138585
FT                   /gene="acnB"
FT                   /locus_tag="Z0128"
FT   CDS_pept        135988..138585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="Z0128"
FT                   /product="aconitate hydrase B"
FT                   /function="enzyme; Energy metabolism, carbon: TCA cycle"
FT                   /note="Residues 1 to 865 of 865 are 99.88 pct identical to
FT                   residues 1 to 865 of 865 from Escherichia coli K-12 Strain
FT                   MG1655: B0118"
FT                   /db_xref="EnsemblGenomes-Gn:Z0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54422"
FT                   /db_xref="GOA:A0A4Q0C193"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C193"
FT                   /protein_id="AAG54422.1"
FT                   /translation="MLEEYRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFL
FT                   LDLLTNRVPPGVDEAAYVKAGFLAAVAKGEAKSPLLTPEKAIELLGTMQGGYNIHPLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLNRPALA
FT                   EKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQPGVVGPIKQ
FT                   IEALQQKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLNSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLANPELLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARPL
FT                   SAVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFNQLSQYTEKADGVIFQTAV"
FT   gene            138713..139123
FT                   /gene="yacL"
FT                   /locus_tag="Z0129"
FT   CDS_pept        138713..139123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="Z0129"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 136 of 136 are 100.00 pct identical to
FT                   residues 1 to 136 of 136 from Escherichia coli K-12 Strain
FT                   MG1655: B0119"
FT                   /db_xref="EnsemblGenomes-Gn:Z0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54423"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8E6"
FT                   /protein_id="AAG54423.1"
FT                   /translation="MAQCDFGALPGAEEHTMDYEFLRDITGVVKVRMSMGHEVVGHWFN
FT                   EEVKENLALLDEVEQAAHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEE
FT                   GMNYYDEESLSLCGVEDFLQVVAAYRNFVQQK"
FT   gene            complement(139161..139955)
FT                   /gene="speD"
FT                   /locus_tag="Z0130"
FT   CDS_pept        complement(139161..139955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="Z0130"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /function="enzyme; Central intermediary metabolism:
FT                   Polyamine biosynthesis"
FT                   /note="Residues 1 to 264 of 264 are 100.00 pct identical to
FT                   residues 1 to 264 of 264 from Escherichia coli K-12 Strain
FT                   MG1655: B0120"
FT                   /db_xref="EnsemblGenomes-Gn:Z0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54424"
FT                   /db_xref="GOA:P0A7F7"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7F7"
FT                   /protein_id="AAG54424.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV"
FT   gene            complement(139971..140837)
FT                   /gene="speE"
FT                   /locus_tag="Z0131"
FT   CDS_pept        complement(139971..140837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="Z0131"
FT                   /product="spermidine synthase = putrescine
FT                   aminopropyltransferase"
FT                   /function="enzyme; Central intermediary metabolism:
FT                   Polyamine biosynthesis"
FT                   /note="Residues 1 to 288 of 288 are 99.65 pct identical to
FT                   residues 1 to 288 of 288 from Escherichia coli K-12 Strain
FT                   MG1655: B0121"
FT                   /db_xref="EnsemblGenomes-Gn:Z0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54425"
FT                   /db_xref="GOA:P66834"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66834"
FT                   /protein_id="AAG54425.1"
FT                   /translation="MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSTEIIQARFLASGLKCRYYNPAVHTAAFALPQYLQD
FT                   ALASQPS"
FT   gene            complement(140943..141413)
FT                   /gene="yacC"
FT                   /locus_tag="Z0132"
FT   CDS_pept        complement(140943..141413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="Z0132"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 156 of 156 are 100.00 pct identical to
FT                   residues 1 to 156 of 156 from Escherichia coli K-12 Strain
FT                   MG1655: B0122"
FT                   /db_xref="EnsemblGenomes-Gn:Z0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54426"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDA9"
FT                   /protein_id="AAG54426.1"
FT                   /translation="MSIVLPLTGRSSRRHNLIDNNGRRLARSVLTFIFFKPLVEAMKTF
FT                   FRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRALVFFA
FT                   QQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK"
FT   gene            141456..143006
FT                   /gene="yacK"
FT                   /locus_tag="Z0133"
FT   CDS_pept        141456..143006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacK"
FT                   /locus_tag="Z0133"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 516 of 516 are 99.22 pct identical to
FT                   residues 1 to 516 of 516 from Escherichia coli K-12 Strain
FT                   MG1655: B0123"
FT                   /db_xref="EnsemblGenomes-Gn:Z0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54427"
FT                   /db_xref="GOA:Q8X947"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X947"
FT                   /protein_id="AAG54427.1"
FT                   /translation="MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDAR
FT                   NRIQLTIGAGQSTFGEKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHG
FT                   LEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIE
FT                   DDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYP
FT                   QHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVNELPVLMGERF
FT                   EVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPAL
FT                   PSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMVGMDHSQMMGHMGHGNMNHMNHG
FT                   GKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSEN
FT                   GKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKERAYMAHCHLLEHEDTGMMLGFTV"
FT   gene            complement(143208..145598)
FT                   /gene="gcd"
FT                   /locus_tag="Z0134"
FT   CDS_pept        complement(143208..145598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="Z0134"
FT                   /product="glucose dehydrogenase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 796 of 796 are 99.87 pct identical to
FT                   residues 1 to 796 of 796 from Escherichia coli K-12 Strain
FT                   MG1655: B0124"
FT                   /db_xref="EnsemblGenomes-Gn:Z0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54428"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1R4"
FT                   /protein_id="AAG54428.1"
FT                   /translation="MAINNTGSRRLLVTLTALFAALCGLYLLIGGGWLVAIGGSWYYPI
FT                   AGLVMLGVAWMLWRSKRAALWLYAALLLGTMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWRRLVIPASGAVAALVVALLISGSILTWAGFNDPQEINGTLSADATPAEAISPV
FT                   ADQDWPAYGRNQEGQRFSPLKQINADNVHNLKEAWVFRTGDVKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHYDPELKTNESFQHVTCRGVSYHEAKAETASPE
FT                   VMADCPRRIILPVNDGRLIAINAENGKLCETFANKGVLNLQSNMPDTKPGLYEPTSPPI
FT                   ITDKTIVMAGSVTDNFSTRETSGVIRGFDVNTGELLWAFDPGAKDPNAIPSDEHTFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVNGQKVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVTPTQPFSELSFRPTKDLSGADMWGATMFDQLVCRVMFHQMRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPNREVAIANPMALPFVSKLIPRGPGNPMEQPKDAKGT
FT                   GTESGIQPQYGVPYGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEVVWKKRIGTPQDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDVK"
FT   gene            145792..146340
FT                   /gene="hpt"
FT                   /locus_tag="Z0136"
FT   CDS_pept        145792..146340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="Z0136"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /function="enzyme; Central intermediary metabolism: Salvage
FT                   of nucleosides and nucleotides"
FT                   /note="Residues 1 to 182 of 182 are 100.00 pct identical to
FT                   residues 1 to 182 of 182 from Escherichia coli K-12 Strain
FT                   MG1655: B0125"
FT                   /db_xref="EnsemblGenomes-Gn:Z0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54429"
FT                   /db_xref="GOA:A0A0H3JFB2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFB2"
FT                   /protein_id="AAG54429.1"
FT                   /translation="MVRDMKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGL
FT                   LRGSFMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVED
FT                   IIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGID
FT                   YAQRYRHLPYIGKVILLDE"
FT   gene            complement(146381..147043)
FT                   /gene="yadF"
FT                   /locus_tag="Z0137"
FT   CDS_pept        complement(146381..147043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadF"
FT                   /locus_tag="Z0137"
FT                   /product="putative carbonic anhdrase"
FT                   /function="putative enzyme; Not classified"
FT                   /EC_number="4.2.1.1"
FT                   /note="Residues 1 to 220 of 220 are 99.54 pct identical to
FT                   residues 1 to 220 of 220 from Escherichia coli K-12 Strain
FT                   MG1655: B0126"
FT                   /db_xref="EnsemblGenomes-Gn:Z0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54430"
FT                   /db_xref="GOA:A0A4Q2TZV8"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TZV8"
FT                   /protein_id="AAG54430.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGV
FT                   QAAVENPELGLINNWLLHIRDIWFKHSSLLDEMPQERRLDTLCELNVMEQVYNLGHSTI
FT                   MQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK"
FT   gene            147152..148078
FT                   /gene="yadG"
FT                   /locus_tag="Z0138"
FT   CDS_pept        147152..148078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="Z0138"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 308 of 308 are 99.67 pct identical to
FT                   residues 1 to 308 of 308 from Escherichia coli K-12 Strain
FT                   MG1655: B0127"
FT                   /db_xref="EnsemblGenomes-Gn:Z0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54431"
FT                   /db_xref="GOA:A0A4Q0C380"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C380"
FT                   /protein_id="AAG54431.1"
FT                   /translation="MTIALELQQLKKNYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKA
FT                   LLAKLKSETFILDLAPKSPLPKLDGYQYRLVDTATLEVEVLREQGINSVFTQLSEQGIQ
FT                   VLSMRNKANRLEELFVSLVNEKQGDRA"
FT   gene            148075..148845
FT                   /gene="yadH"
FT                   /locus_tag="Z0139"
FT   CDS_pept        148075..148845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="Z0139"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 256 of 256 are 100.00 pct identical to
FT                   residues 1 to 256 of 256 from Escherichia coli K-12 Strain
FT                   MG1655: B0128"
FT                   /db_xref="EnsemblGenomes-Gn:Z0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54432"
FT                   /db_xref="GOA:P0AFN8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFN8"
FT                   /protein_id="AAG54432.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
FT   gene            148950..149390
FT                   /gene="yadI"
FT                   /locus_tag="Z0140"
FT   CDS_pept        148950..149390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="Z0140"
FT                   /product="putative PTS enzyme II B component"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 146 of 146 are 98.63 pct identical to
FT                   residues 1 to 146 of 146 from Escherichia coli K-12 Strain
FT                   MG1655: B0129"
FT                   /db_xref="EnsemblGenomes-Gn:Z0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54433"
FT                   /db_xref="GOA:A0A4Q0C2J5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2J5"
FT                   /protein_id="AAG54433.1"
FT                   /translation="MLGWVITCHDDRAQEILDVLEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSIWHQQQKNPPFVLKHNLYEY"
FT   gene            149454..150683
FT                   /gene="yadE"
FT                   /locus_tag="Z0141"
FT   CDS_pept        149454..150683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="Z0141"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 409 of 409 are 98.77 pct identical to
FT                   residues 1 to 409 of 409 from Escherichia coli K-12 Strain
FT                   MG1655: B0130"
FT                   /db_xref="EnsemblGenomes-Gn:Z0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54434"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1B4"
FT                   /protein_id="AAG54434.1"
FT                   /translation="MYKQAVILLLMLFTASVSAALPARYMQTIENAAVWAQIGDKMVTV
FT                   GNIRAGQIIAVEPTAASYYAFNFGFDKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQN
FT                   LVTWKDTPVYNAPSVGSAPFGVLADNLRYPILHKLKDRLNQTWYQIRIGDRLAYISALD
FT                   AQPDNGLPVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMVQLEGY
FT                   VKNKINLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIVTSRIKRHPQKWEPKSL
FT                   QFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNP
FT                   HVWYLSYPFGGFNDKAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETM
FT                   SRLVSNQPQG"
FT   gene            complement(150687..151067)
FT                   /gene="panD"
FT                   /locus_tag="Z0142"
FT   CDS_pept        complement(150687..151067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="Z0142"
FT                   /product="aspartate 1-decarboxylase"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Pantothenate"
FT                   /note="Residues 1 to 126 of 126 are 100.00 pct identical to
FT                   residues 1 to 126 of 126 from Escherichia coli K-12 Strain
FT                   MG1655: B0131"
FT                   /db_xref="EnsemblGenomes-Gn:Z0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54435"
FT                   /db_xref="GOA:P0A792"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A792"
FT                   /protein_id="AAG54435.1"
FT                   /translation="MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPN
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            151341..152237
FT                   /gene="yadD"
FT                   /locus_tag="Z0143"
FT   CDS_pept        151341..152237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="Z0143"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 298 of 298 are 96.97 pct identical to
FT                   residues 1 to 298 of 300 from Escherichia coli K-12 Strain
FT                   MG1655: B0132"
FT                   /db_xref="EnsemblGenomes-Gn:Z0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54436"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1A9"
FT                   /protein_id="AAG54436.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEADHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSESQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGKSMMTLAQWFEEKGIEKGIQQGRQEERQEFAQRFLSKGMSRED
FT                   VAEMTNLSLAEIDRLIN"
FT   misc_feature    152235..152529
FT                   /note="O-island #4; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(152536..153387)
FT                   /gene="panC"
FT                   /locus_tag="Z0144"
FT   CDS_pept        complement(152536..153387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="Z0144"
FT                   /product="pantothenate synthetase"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Pantothenate"
FT                   /note="Residues 1 to 283 of 283 are 99.64 pct identical to
FT                   residues 1 to 283 of 283 from Escherichia coli K-12 Strain
FT                   MG1655: B0133"
FT                   /db_xref="EnsemblGenomes-Gn:Z0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54437"
FT                   /db_xref="GOA:Q8X930"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X930"
FT                   /protein_id="AAG54437.1"
FT                   /translation="MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTE
FT                   THTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMV
FT                   ADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDL
FT                   DEIIAIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVE
FT                   LA"
FT   gene            complement(153399..154193)
FT                   /gene="panB"
FT                   /locus_tag="Z0145"
FT   CDS_pept        complement(153399..154193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="Z0145"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Pantothenate"
FT                   /note="Residues 1 to 264 of 264 are 96.21 pct identical to
FT                   residues 1 to 264 of 264 from Escherichia coli K-12 Strain
FT                   MG1655: B0134"
FT                   /db_xref="EnsemblGenomes-Gn:Z0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54438"
FT                   /db_xref="GOA:Q8X929"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X929"
FT                   /protein_id="AAG54438.1"
FT                   /translation="MKPTTIASLQKCKQEKKRFATITAYDYSFAKLFAEEGLNVMLVGD
FT                   SLGMTVQGHESTLPVTVEDIAYHTTAVRRGAPNCLLLADLPFMAYATPEQAFENAATVM
FT                   RAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEASDRL
FT                   LSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEEHSFH"
FT   gene            complement(154328..155437)
FT                   /gene="yadC"
FT                   /locus_tag="Z0146"
FT   CDS_pept        complement(154328..155437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="Z0146"
FT                   /product="putative fimbrial protein"
FT                   /function="putative structure; Cell exterior constituents:
FT                   Surface structures"
FT                   /note="Residues 207 to 368 of 369 are 27.62 pct identical
FT                   to residues 239 to 411 of 412 from Escherichia coli K-12
FT                   Strain MG1655: B0135"
FT                   /db_xref="EnsemblGenomes-Gn:Z0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54439"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR017014"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Y5"
FT                   /protein_id="AAG54439.1"
FT                   /translation="MQRKGNKLLIQLCSVILLFFTTSWYALANECYIERNAEGDYHMKI
FT                   SSTQLSLASQMVEVPTEIAEATWDVNIQLRGDAIGCKSLGDSKAVHFLNTADPSLISTY
FT                   TTTNGAALLKTTVPGIVYSVELLCLSCGAADELDLWLPAQSGADNFIPSTQTKWAYEYS
FT                   DQSWYLRFRLFITPEFKPKNGVSSGTTIAGKIASWYIGTNDQPWINFYIDNDSLKFFVD
FT                   EPTCATVALAQDQGNVSGNQVTLGNSYVSEVKNGLTREIPFSIRAEYCYASKITVKLKA
FT                   ANKPSDATLVGKTTGSASGVAVKVNSTYDNSKVLLKADGSNTVDYNFAAWSNNLLFLPF
FT                   TAQLVPDGSGNAVGVGTFSGNATFSFTYE"
FT   gene            complement(155449..156039)
FT                   /gene="yadK"
FT                   /locus_tag="Z0147"
FT   CDS_pept        complement(155449..156039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="Z0147"
FT                   /product="putative fimbrial protein"
FT                   /function="orf; Cell exterior constituents: Surface
FT                   structures"
FT                   /note="Residues 7 to 196 of 196 are 40.10 pct identical to
FT                   residues 11 to 198 of 198 from Escherichia coli K-12 Strain
FT                   MG1655: B0136"
FT                   /db_xref="EnsemblGenomes-Gn:Z0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54440"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDG5"
FT                   /protein_id="AAG54440.1"
FT                   /translation="MLCRHHKIVHFLGLATALITPFAYSGQDVDLTAKIVPSTCQVEVS
FT                   NNGVVDLGTVTLDYFADNVTPTTDYAGGKTFNVNVVSCDNIQTTQSQMKLDFQPQAGSL
FT                   AQANNQIFSNEYEQQATGAKNVGIVIFSAQPNQQTFNVRGTDGSSTAIYSVAPGNAVPS
FT                   TWTFYSRMQRVNNALPPESGMVRSQVIVNVSYE"
FT   gene            complement(156060..156665)
FT                   /gene="yadL"
FT                   /locus_tag="Z0148"
FT   CDS_pept        complement(156060..156665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="Z0148"
FT                   /product="putative fimbrial protein"
FT                   /function="orf; Cell exterior constituents: Surface
FT                   structures"
FT                   /note="Residues 9 to 200 of 201 are 41.14 pct identical to
FT                   residues 11 to 200 of 201 from Escherichia coli K-12 Strain
FT                   MG1655: B0137"
FT                   /db_xref="EnsemblGenomes-Gn:Z0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54441"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C392"
FT                   /protein_id="AAG54441.1"
FT                   /translation="MKLKVIATLIATVAVGVSFNSNFASASTTSASLTVNSNLTMGTCS
FT                   AQIMDNSNKVINEVVFGNVYISELGAKSKVQQFKIRFSNCSGLPQNSAQIVLAPNGISC
FT                   AGSQSSSAGFSNKFTDASAATRTAVEVWTTDTPESNGSTQFHCAQKIPVPVTLPADTTT
FT                   QPYDYPLSARMTVAEGRLVTDVRPGNFRSPTTFTITYQ"
FT   gene            complement(156680..157240)
FT                   /gene="yadM"
FT                   /locus_tag="Z0149"
FT   CDS_pept        complement(156680..157240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="Z0149"
FT                   /product="putative fimbrial protein"
FT                   /function="putative structure; Cell exterior constituents:
FT                   Surface structures"
FT                   /note="Residues 14 to 186 of 186 are 49.44 pct identical to
FT                   residues 26 to 203 of 203 from Escherichia coli K-12 Strain
FT                   MG1655: B0138"
FT                   /db_xref="EnsemblGenomes-Gn:Z0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54442"
FT                   /db_xref="GOA:A0A0H3JC59"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC59"
FT                   /protein_id="AAG54442.1"
FT                   /translation="MENSMKRILLTSALIGLGLPAVGSATDLNVDFTATVLATTCTITI
FT                   VEDGGPAVTGSNDEYSLTIPDVGLDKVATAAPEAQANFKLKASDCSNGYSKIFTTLTGT
FT                   TVSGKLIVNEATSGAAGVGMGIKRRDTADSTFFTPNNTDKFEWSADEKASGVPLTVALR
FT                   ETTAGAGRTGAFQAKATFNFTYE"
FT   gene            complement(157242..159740)
FT                   /gene="htrE"
FT                   /locus_tag="Z0150"
FT   CDS_pept        complement(157242..159740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="Z0150"
FT                   /product="putative fimbrial usher protein"
FT                   /function="putative membrane; Cell exterior constituents:
FT                   Surface structures"
FT                   /note="Residues 1 to 829 of 832 are 60.59 pct identical to
FT                   residues 33 to 864 of 865 from Escherichia coli K-12 Strain
FT                   MG1655: B0139"
FT                   /db_xref="EnsemblGenomes-Gn:Z0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54443"
FT                   /db_xref="GOA:Q8X3Z8"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3Z8"
FT                   /protein_id="AAG54443.1"
FT                   /translation="MEYDSSFLMGTGASTIDVKRYAQGNPTPPGLYNVRVFVNGQATSS
FT                   LEIPFVDIGENSAAACLTHKNLAQLHIKQPEQPVTLLAREGEEEDCLDLAKSYEKADVC
FT                   FDGSDQFLDLTIPQAYVLKSYGGYVDPSLWESGINAATLAYTLNAYHTSSDNDNSDSVY
FT                   GAFNSGINLGAWHFRARGNYNWTTDNGSDFDFQDRYLQRDIPAIRSQIIMGDAYTTGET
FT                   FDSVNVRGVRLYSDSRMLPSALASYAPTIRGVANSNAKVTVTQSGYKIYETTVPPGEFV
FT                   IDDISPSGFGSELVVTIEEADGSKRTFTHPFSSVVQMQRPGVGRWDFSAGKVIDDSLRS
FT                   EPNMGQASYYYGLNNLFTGYTGIQFTDNNYLAGLLGVGINTSIGAFAVDVTHSRAEIPD
FT                   DKTYQGQSYRVTWNKLFQDTGTSFNLAAYRYSTQDYLGLHDALVLIDDAKHLSADEDKN
FT                   TMQTYSRMKNQFTVSINQPLNIAYEDYGSLFISGSWTYYWAANNSRTEYNVGYSKSVSW
FT                   GSFSVNLQRSWNEDGEKDDAMYVSVSVPIENILGGKRKSSGFRNLNTQLNTDFDGSHQL
FT                   NVNSSGNTENNLVNYSVNAGYSLDKNAGDLASVGGYLNYESGLGGISASASATSDNSQQ
FT                   YSISTDGGFVLHSGGLTFTNNSFSSNDTLVLINALGAKGARINNSNNEIDRWGYAVTSS
FT                   VSPYRENRVGLNIETLENDVELKSTSATTVPRSGSVVLTRFETDEGRSAVLNITAANGK
FT                   SIPFAAEVYQGEVMIGSMGQGGQAFVRGINDSGELIVRWYENNQTIDCKLHYQFPAQPQ
FT                   TQGSTNTLLLNNLTCQVANH"
FT   gene            complement(159884..160615)
FT                   /gene="ecpD"
FT                   /locus_tag="Z0151"
FT   CDS_pept        complement(159884..160615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpD"
FT                   /locus_tag="Z0151"
FT                   /product="putative fimbrial chaperone protein"
FT                   /function="putative factor; Cell exterior constituents:
FT                   Surface structures"
FT                   /note="Residues 3 to 241 of 243 are 60.81 pct identical to
FT                   residues 1 to 244 of 246 from Escherichia coli K-12 Strain
FT                   MG1655: B0140"
FT                   /db_xref="EnsemblGenomes-Gn:Z0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54444"
FT                   /db_xref="GOA:Q8X915"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X915"
FT                   /protein_id="AAG54444.1"
FT                   /translation="MLMFPLVKKTVSALFVSTLLASAPAFADIIISGTRIIYNADKKDV
FT                   NVRLENKGNRPLLIQNWLDTGDDNADPSQIKVPFTATPPVSRVEPKRGQTVKVMYTGAT
FT                   ALPKDRESVYWFNVLEVPPKPKDAEADKNLLQLAFRTRIKLFYRPSGLQGEPAEAPAKI
FT                   TWKLNNAQLQANNPTPYYVSFNEVKLESGGKTYNVNSSMVTPFSQASFGVTSLPGSVSS
FT                   GKVVFKAINDFGGNIDGSATF"
FT   gene            complement(160696..161301)
FT                   /gene="yadN"
FT                   /locus_tag="Z0152"
FT   CDS_pept        complement(160696..161301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="Z0152"
FT                   /product="putative fimbrial protein"
FT                   /function="putative structure; Cell exterior constituents:
FT                   Surface structures"
FT                   /note="Residues 7 to 201 of 201 are 39.50 pct identical to
FT                   residues 8 to 194 of 194 from Escherichia coli K-12 Strain
FT                   MG1655: B0141"
FT                   /db_xref="EnsemblGenomes-Gn:Z0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54445"
FT                   /db_xref="GOA:Q8X913"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X913"
FT                   /protein_id="AAG54445.1"
FT                   /translation="MHVMKKALLAAALVMASGSALAVDGGHIDFNGMVQSGTCKVGVVD
FT                   TGMHSVTTDGVVTLDTANVTDTFAEVSATAVGLLPKEFMISVECDPGAPKNAELTMGSA
FT                   SYANTSGTLNNNMNITVNGIAPAQNVNIAVHNMKNKAGAAEIKQVHMNNSSEVQELTLD
FT                   AEGKGQYVFNASYVKAPNSPAVTAGHVTTNALYTVAYK"
FT   gene            complement(161573..162055)
FT                   /gene="folK"
FT                   /locus_tag="Z0153"
FT   CDS_pept        complement(161573..162055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="Z0153"
FT                   /product="7,
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Folic acid"
FT                   /note="Residues 1 to 152 of 160 are 94.73 pct identical to
FT                   residues 1 to 152 of 159 from Escherichia coli K-12 Strain
FT                   MG1655: B0142"
FT                   /db_xref="EnsemblGenomes-Gn:Z0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54446"
FT                   /db_xref="GOA:A0A4Q0C1B8"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1B8"
FT                   /protein_id="AAG54446.1"
FT                   /translation="MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPP
FT                   LGPQDQPDYLNAAVALETTLAPEELLNHTQQIELQQGRVRKAERWGPRTLDLDIMLFGN
FT                   ETINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGETLREILTSLAVLQPAIWY"
FT   gene            complement(162052..163416)
FT                   /gene="pcnB"
FT                   /locus_tag="Z0154"
FT   CDS_pept        complement(162052..163416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="Z0154"
FT                   /product="poly(A) polymerase I"
FT                   /function="enzyme; Macromolecule synthesis, modification:
FT                   RNA synthesis, modification, DNA transcript'n"
FT                   /note="Residues 1 to 454 of 454 are 100.00 pct identical to
FT                   residues 1 to 454 of 454 from Escherichia coli K-12 Strain
FT                   MG1655: B0143"
FT                   /db_xref="EnsemblGenomes-Gn:Z0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54447"
FT                   /db_xref="GOA:P0ABF3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABF3"
FT                   /protein_id="AAG54447.1"
FT                   /translation="MLSREESEAEQAVARPQVTVIPREQHAISRKDISENALKVMYRLN
FT                   KAGYEXWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGP
FT                   EIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVAD
FT                   FTVRDYVGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLGMRISPETAEPIPR
FT                   LATLLNDIPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPME
FT                   RIIEQVLKNTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMND
FT                   VLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAAYDLLALRAEV
FT                   ERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRAPRREGTA"
FT   gene            complement(163509..164435)
FT                   /gene="yadB"
FT                   /locus_tag="Z0155"
FT   CDS_pept        complement(163509..164435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="Z0155"
FT                   /product="putative tRNA synthetase"
FT                   /function="putative enzyme; Amino acyl tRNA syn; tRNA
FT                   modific'n"
FT                   /note="Residues 1 to 308 of 308 are 99.02 pct identical to
FT                   residues 1 to 308 of 308 from Escherichia coli K-12 Strain
FT                   MG1655: B0144"
FT                   /db_xref="EnsemblGenomes-Gn:Z0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54448"
FT                   /db_xref="GOA:Q8X909"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X909"
FT                   /protein_id="AAG54448.1"
FT                   /translation="MLPPYFLFKEMTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARA
FT                   RHGRWLVRIEDIDPPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHHAYREALAWLHE
FT                   QGLSYYCTCTRARIQSIGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHAD
FT                   EKLAREDFIIHRRDGLFAYNLAVVVDDHFQGVSEIVRGADLIEPTVRQISLYQLFGWKV
FT                   PDYIHLPLALNPQGAKLSKQNHAPALPKGDPRPVLIAALQFLGQQAEAHWQDFSVEQIL
FT                   QSAVKNWRLTAVPESAIVNSTFSNASC"
FT   gene            complement(164472..164927)
FT                   /gene="dksA"
FT                   /locus_tag="Z0156"
FT   CDS_pept        complement(164472..164927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="Z0156"
FT                   /product="dnaK suppressor protein"
FT                   /function="phenotype; Macromolecule synthesis,
FT                   modification: DNA - replication, repair, restr./modific'n"
FT                   /note="Residues 1 to 151 of 151 are 100.00 pct identical to
FT                   residues 1 to 151 of 151 from Escherichia coli K-12 Strain
FT                   MG1655: B0145"
FT                   /db_xref="EnsemblGenomes-Gn:Z0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54449"
FT                   /db_xref="GOA:P0ABS3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABS3"
FT                   /protein_id="AAG54449.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(165105..165809)
FT                   /gene="sfsA"
FT                   /locus_tag="Z0157"
FT   CDS_pept        complement(165105..165809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="Z0157"
FT                   /product="probable regulator for maltose metabolism"
FT                   /function="putative regulator; Degradation of small
FT                   molecules: Carbon compounds"
FT                   /note="Residues 1 to 234 of 234 are 100.00 pct identical to
FT                   residues 1 to 234 of 234 from Escherichia coli K-12 Strain
FT                   MG1655: B0146"
FT                   /db_xref="EnsemblGenomes-Gn:Z0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54450"
FT                   /db_xref="GOA:P0A824"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A824"
FT                   /protein_id="AAG54450.1"
FT                   /translation="MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGY
FT                   SSLKSEVKYGAERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRE
FT                   LMSVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE
FT                   GMALKKSLPVTL"
FT   gene            complement(165824..166363)
FT                   /gene="yadP"
FT                   /locus_tag="Z0158"
FT   CDS_pept        complement(165824..166363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadP"
FT                   /locus_tag="Z0158"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 179 of 179 are 98.32 pct identical to
FT                   residues 1 to 179 of 179 from Escherichia coli K-12 Strain
FT                   MG1655: B0147"
FT                   /db_xref="EnsemblGenomes-Gn:Z0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54451"
FT                   /db_xref="GOA:A0A0H3JC61"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC61"
FT                   /protein_id="AAG54451.1"
FT                   /translation="MPHMSDPQRLFFAIDLPAEIREQIIHWRATHFPLEAGRPVAADNL
FT                   HLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQ
FT                   LANMLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFA
FT                   RGRTRYTPLKRWVLTQ"
FT   gene            166383..168857
FT                   /gene="hrpB"
FT                   /locus_tag="Z0159"
FT   CDS_pept        166383..168857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="Z0159"
FT                   /product="helicase, ATP-dependent"
FT                   /function="enzyme; Macromolecule synthesis, modification:
FT                   DNA - replication, repair, restr./modific'n"
FT                   /note="Residues 1 to 824 of 824 are 98.17 pct identical to
FT                   residues 1 to 824 of 824 from Escherichia coli K-12 Strain
FT                   MG1655: B0148"
FT                   /db_xref="EnsemblGenomes-Gn:Z0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54452"
FT                   /db_xref="GOA:A0A0H3JFC4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFC4"
FT                   /protein_id="AAG54452.1"
FT                   /translation="MLQCGAKNVNPLERFVSSLPVAAVLPELLTALDYAPQVLLSAPTG
FT                   AGKSTWLPLQLLAHPGINGKIILLEPRRLAARNVAQRLAELLNEKPGDTVGYRMRAQNC
FT                   VGPNTRLEVVTEGVLTRMIQRDPELSGVGLVILDEFHERSLQADLALALLLDVQQGLRD
FT                   DLKLLIMSATLDNDRLQQMLPEAPVVISEGRSFPVERRYLPLPTHQRFDDAVAVATAEM
FT                   LRQESGSLLLFLPGVGEIQRVQEQLASRIGSDVLLCPLYGALSLNDQRKAILPAPQGMR
FT                   KVVLATNIAETSLTIEGIRLVVDCAQERVARFDPRTGLTRLITQRISQASMTQRAGRAG
FT                   RLEPGICLHLIAKEQAERATAQSEPEILQSDLSGLLMELLQWGCSDPAQMSWLDQPPTV
FT                   NLLAAKRLLQMLGALDGERLSAQGQKMAALGNDPRLAAMLVSAKSDDEAATAAKIAAIL
FT                   EEPPRMGNSDLGVAFSRNQPAWQQRSQQLLKRLNVRGGEADSSLIAPLLAGAFADRIAR
FT                   RRGQDGRYQLANGMGAMLDADDALSRHEWLIAPLLLQGSASPDARILLALPVDIDELVQ
FT                   RCPQLVQQSDTVEWDDAQGTLKAWRRLQIGQLTVKVQPLAKPSEDELHQAMLNGIRDKG
FT                   LSVLNWTAEAEQLRLRLLCAGKWLPEYDWPAVDDESLLATLETWLLPHMAGVHSLRGLK
FT                   SLDIYQALRGLLDWGMQQRLDSELPAHYTVPTGSRIAIRYHEDNPPALAVRMQEMFGEA
FT                   TNPTIAQGRVPLVLELLSPAQRPLQITRDLGAFWKGAYREVQKEMKGRYPKHVWPDDPA
FT                   NTAPTRRTKKYS"
FT   gene            169053..171587
FT                   /gene="mrcB"
FT                   /locus_tag="Z0160"
FT   CDS_pept        169053..171587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="Z0160"
FT                   /product="peptidoglycan synthetase; penicillin-binding
FT                   protein 1B"
FT                   /function="enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 844 of 844 are 99.76 pct identical to
FT                   residues 1 to 844 of 844 from Escherichia coli K-12 Strain
FT                   MG1655: B0149"
FT                   /db_xref="EnsemblGenomes-Gn:Z0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54453"
FT                   /db_xref="GOA:A0A4Q0C2L3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2L3"
FT                   /protein_id="AAG54453.1"
FT                   /translation="MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEP
FT                   MPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPA
FT                   AVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPL
FT                   GVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGI
FT                   PALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVP
FT                   TVNLGMALGLPAVTDTWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRA
FT                   PLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLH
FT                   LAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPT
FT                   PLNLVPPEDIADMGVDYDGNFVCSGGMRVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSS
FT                   QPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN"
FT   gene            171807..174050
FT                   /gene="fhuA"
FT                   /locus_tag="Z0161"
FT   CDS_pept        171807..174050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="Z0161"
FT                   /product="outer membrane protein receptor for ferrichrome,
FT                   colicin M, and phages T1, T5, and phi80"
FT                   /function="membrane; Cell envelop: Outer membrane
FT                   constituents"
FT                   /note="Residues 1 to 747 of 747 are 99.59 pct identical to
FT                   residues 1 to 747 of 747 from Escherichia coli K-12 Strain
FT                   MG1655: B0150"
FT                   /db_xref="EnsemblGenomes-Gn:Z0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54454"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TVK4"
FT                   /protein_id="AAG54454.1"
FT                   /translation="MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVELKEDTITVT
FT                   AAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAE
FT                   IMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDALDDDGV
FT                   YSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKT
FT                   SQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVNTDFDFNAKDPANSGPYRI
FT                   LNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNY
FT                   LFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNL
FT                   TKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF"
FT   gene            174101..174898
FT                   /gene="fhuC"
FT                   /locus_tag="Z0162"
FT   CDS_pept        174101..174898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="Z0162"
FT                   /product="ATP-binding component of hydroxymate-dependent
FT                   iron transport"
FT                   /function="transport; Transport of small molecules:
FT                   Cations"
FT                   /note="Residues 1 to 265 of 265 are 99.62 pct identical to
FT                   residues 1 to 265 of 265 from Escherichia coli K-12 Strain
FT                   MG1655: B0151"
FT                   /db_xref="EnsemblGenomes-Gn:Z0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54455"
FT                   /db_xref="GOA:A0A4Q0C1E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1E0"
FT                   /protein_id="AAG54455.1"
FT                   /translation="MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAEIMRGETLEMIYGIPMGILPHPAGAAPVSFVY"
FT   gene            174898..175788
FT                   /gene="fhuD"
FT                   /locus_tag="Z0163"
FT   CDS_pept        174898..175788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="Z0163"
FT                   /product="hydroxamate-dependent iron uptake, cytoplasmic
FT                   membrane component"
FT                   /function="transport; Transport of small molecules:
FT                   Cations"
FT                   /note="Residues 1 to 296 of 296 are 99.32 pct identical to
FT                   residues 1 to 296 of 296 from Escherichia coli K-12 Strain
FT                   MG1655: B0152"
FT                   /db_xref="EnsemblGenomes-Gn:Z0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54456"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1C8"
FT                   /protein_id="AAG54456.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPESVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMNPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
FT   gene            175785..177767
FT                   /gene="fhuB"
FT                   /locus_tag="Z0164"
FT   CDS_pept        175785..177767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="Z0164"
FT                   /product="hydroxamate-dependent iron uptake, cytoplasmic
FT                   membrane component"
FT                   /function="transport; Transport of small molecules:
FT                   Cations"
FT                   /note="Residues 1 to 660 of 660 are 99.39 pct identical to
FT                   residues 1 to 660 of 660 from Escherichia coli K-12 Strain
FT                   MG1655: B0153"
FT                   /db_xref="EnsemblGenomes-Gn:Z0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54457"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1G6"
FT                   /protein_id="AAG54457.1"
FT                   /translation="MSKRIALFPALLLALLVIAATALTWMNFSQALPRSQWAQAAWSPD
FT                   IDVIEQMIFHYSLLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGIT
FT                   VTTLWAIPGAMASQFAALAGACVVGLIVFGVAWGKRLSPVTLILAGLVVSLYCGAINQL
FT                   LVIFHHDQLQSMFLWSTGTLTQTDWGGVERLWPQLLGGVMLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALSLAIVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLPRLMLAS
FT                   LIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLRSISAPDMKVNDRV
FT                   AAERQHVLAFALAGGVLLLMAVVVALSFGRDAHGWTWASGALLEDLMPWRWPRIMAALF
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGSIGA
FT                   AVTLLIIMIAAGRGGFSPHRMLLAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTY
FT                   NATDAQVWRTGIVMVILLAITPLCRRWLTILPLGGDTARAVGVALTPTRIALLLLAACL
FT                   TATATMTIGPLSFVGLMAPHIARMMGFRRTMPHIVISALVGGLLLVFADWCGRMVLFPF
FT                   QIPAGLLSTFIGAPYFIYLLRKQSR"
FT   gene            complement(177802..179082)
FT                   /gene="hemL"
FT                   /locus_tag="Z0165"
FT   CDS_pept        complement(177802..179082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="Z0165"
FT                   /product="glutamate-1-semialdehyde aminotransferase
FT                   (aminomutase)"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="Residues 1 to 426 of 426 are 99.29 pct identical to
FT                   residues 1 to 426 of 426 from Escherichia coli K-12 Strain
FT                   MG1655: B0154"
FT                   /db_xref="EnsemblGenomes-Gn:Z0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54458"
FT                   /db_xref="GOA:Q8X4V5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X4V5"
FT                   /protein_id="AAG54458.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPDFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVEPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLLEAAE
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFE
FT                   AGFMSVAHSMEDINNTIDAARRVFAKL"
FT   gene            179307..180728
FT                   /gene="yadQ"
FT                   /locus_tag="Z0166"
FT   CDS_pept        179307..180728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadQ"
FT                   /locus_tag="Z0166"
FT                   /product="putative channel transporter"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 473 of 473 are 99.78 pct identical to
FT                   residues 1 to 473 of 473 from Escherichia coli K-12 Strain
FT                   MG1655: B0155"
FT                   /db_xref="EnsemblGenomes-Gn:Z0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54459"
FT                   /db_xref="GOA:P58244"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58244"
FT                   /protein_id="AAG54459.1"
FT                   /translation="MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTL
FT                   VGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEA
FT                   GGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVL
FT                   DVFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIXV
FT                   IMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLH
FT                   RVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVAR
FT                   VITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLA
FT                   ASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEA
FT                   EQLARSKAASASENT"
FT   gene            180810..181154
FT                   /gene="yadR"
FT                   /locus_tag="Z0167"
FT   CDS_pept        180810..181154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="Z0167"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 114 of 114 are 100.00 pct identical to
FT                   residues 1 to 114 of 114 from Escherichia coli K-12 Strain
FT                   MG1655: B0156"
FT                   /db_xref="EnsemblGenomes-Gn:Z0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54460"
FT                   /db_xref="GOA:P0ACC5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACC5"
FT                   /protein_id="AAG54460.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   gene            complement(181201..181824)
FT                   /gene="yadS"
FT                   /locus_tag="Z0168"
FT   CDS_pept        complement(181201..181824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="Z0168"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 207 of 207 are 99.51 pct identical to
FT                   residues 1 to 207 of 207 from Escherichia coli K-12 Strain
FT                   MG1655: B0157"
FT                   /db_xref="EnsemblGenomes-Gn:Z0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54461"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3A8"
FT                   /protein_id="AAG54461.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRHLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(181862..182662)
FT                   /gene="yadT"
FT                   /locus_tag="Z0169"
FT   CDS_pept        complement(181862..182662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadT"
FT                   /locus_tag="Z0169"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 266 of 266 are 99.62 pct identical to
FT                   residues 1 to 266 of 266 from Escherichia coli K-12 Strain
FT                   MG1655: B0158"
FT                   /db_xref="EnsemblGenomes-Gn:Z0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54462"
FT                   /db_xref="GOA:Q8X8Z0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Z0"
FT                   /protein_id="AAG54462.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATNIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
FT   gene            complement(182655..183353)
FT                   /gene="pfs"
FT                   /locus_tag="Z0170"
FT   CDS_pept        complement(182655..183353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="Z0170"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 232 of 232 are 100.00 pct identical to
FT                   residues 1 to 232 of 232 from Escherichia coli K-12 Strain
FT                   MG1655: B0159"
FT                   /db_xref="EnsemblGenomes-Gn:Z0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54463"
FT                   /db_xref="GOA:P0AF14"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="PDB:3DF9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AF14"
FT                   /protein_id="AAG54463.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV
FT                   ESLVQKLAHG"
FT   gene            183437..184954
FT                   /gene="dgt"
FT                   /locus_tag="Z0171"
FT   CDS_pept        183437..184954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="Z0171"
FT                   /product="deoxyguanosine triphosphate triphosphohydrolase"
FT                   /function="enzyme; Central intermediary metabolism:
FT                   Nucleotide hydrolysis"
FT                   /note="Residues 1 to 505 of 505 are 99.40 pct identical to
FT                   residues 1 to 505 of 505 from Escherichia coli K-12 Strain
FT                   MG1655: B0160"
FT                   /db_xref="EnsemblGenomes-Gn:Z0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54464"
FT                   /db_xref="GOA:Q8X8Y9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Y9"
FT                   /protein_id="AAG54464.1"
FT                   /translation="MAQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTG
FT                   PFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAVLRLR
FT                   DGEEPLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGET
FT                   PETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFTVEQLYHHLHEAWGQHEKGSLFSLVVENAWEKSRSNSLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNVAVKHVFSHPDVEQL
FT                   ELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRSPIESRLFHKLSTRHRLAYVEA
FT                   VSKLPSDSPEFPLWEYYYRCRLLQDYISGMTDLYAWDEYRRLMAVEQ"
FT   gene            185084..186508
FT                   /gene="htrA"
FT                   /locus_tag="Z0173"
FT   CDS_pept        185084..186508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="Z0173"
FT                   /product="periplasmic serine protease Do; heat shock
FT                   protein HtrA"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of proteins, peptides, glyco"
FT                   /note="Residues 1 to 474 of 474 are 100.00 pct identical to
FT                   residues 1 to 474 of 474 from Escherichia coli K-12 Strain
FT                   MG1655: B0161"
FT                   /db_xref="EnsemblGenomes-Gn:Z0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54465"
FT                   /db_xref="GOA:P0C0V1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0V1"
FT                   /protein_id="AAG54465.1"
FT                   /translation="MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPML
FT                   EKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGG
FT                   GQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIA
FT                   LIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYE
FT                   NFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV
FT                   EYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLN
FT                   GKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEG
FT                   AEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVL
FT                   ALNIQRGDSTIYLLMQ"
FT   gene            186645..187820
FT                   /gene="yaeG"
FT                   /locus_tag="Z0174"
FT   CDS_pept        186645..187820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeG"
FT                   /locus_tag="Z0174"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 391 of 391 are 99.48 pct identical to
FT                   residues 1 to 391 of 391 from Escherichia coli K-12 Strain
FT                   MG1655: B0162"
FT                   /db_xref="EnsemblGenomes-Gn:Z0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54466"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8Y8"
FT                   /protein_id="AAG54466.1"
FT                   /translation="MHNGGLMAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSG
FT                   DRERIGELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEP
FT                   ENLRKYGELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLG
FT                   IDLNQPRVVAIVEVDSGQLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPAL
FT                   NSFGRWDVEDHRKRVEQLITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGK
FT                   QRMPESRCYFYQDLMLPVLLDSLRGDWQANELARPLARLKAMDNNGLLRRTLAAWFRHN
FT                   VQPLATSKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEER"
FT   gene            complement(187909..188295)
FT                   /gene="yaeH"
FT                   /locus_tag="Z0175"
FT   CDS_pept        complement(187909..188295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="Z0175"
FT                   /product="putative structural protein"
FT                   /function="putative structure; Not classified"
FT                   /note="Residues 1 to 128 of 128 are 100.00 pct identical to
FT                   residues 1 to 128 of 128 from Escherichia coli K-12 Strain
FT                   MG1655: B0163"
FT                   /db_xref="EnsemblGenomes-Gn:Z0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54467"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62769"
FT                   /protein_id="AAG54467.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
FT   misc_feature    188446..188569
FT                   /note="O-island #5; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(188610..189434)
FT                   /gene="dapD"
FT                   /locus_tag="Z0176"
FT   CDS_pept        complement(188610..189434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="Z0176"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /function="enzyme; Amino acid biosynthesis: Lysine"
FT                   /note="Residues 1 to 274 of 274 are 99.63 pct identical to
FT                   residues 1 to 274 of 274 from Escherichia coli K-12 Strain
FT                   MG1655: B0166"
FT                   /db_xref="EnsemblGenomes-Gn:Z0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54468"
FT                   /db_xref="GOA:Q8X8Y7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="PDB:3BXY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Y7"
FT                   /protein_id="AAG54468.1"
FT                   /translation="MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDI
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(189465..192137)
FT                   /gene="glnD"
FT                   /locus_tag="Z0177"
FT   CDS_pept        complement(189465..192137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="Z0177"
FT                   /product="protein PII; uridylyltransferase acts on
FT                   regulator of glnA"
FT                   /function="enzyme; Amino acid biosynthesis: Glutamine"
FT                   /note="Residues 1 to 890 of 890 are 99.32 pct identical to
FT                   residues 1 to 890 of 890 from Escherichia coli K-12 Strain
FT                   MG1655: B0167"
FT                   /db_xref="EnsemblGenomes-Gn:Z0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54469"
FT                   /db_xref="GOA:Q8X8Y6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Y6"
FT                   /protein_id="AAG54469.1"
FT                   /translation="MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQR
FT                   WLGDAFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLI
FT                   ESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPIDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVRNSAITGIYSTTLRQ
FT                   LRHARRHLQQPLCNIPQARKLFLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVNVWPRLPSTELIFIAALFHDIA
FT                   KGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEEVLHQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLSADRHEVIRFGLEQVLTQSSWQPPQPRRQPAKLRHFTVETEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
FT   gene            complement(192199..192993)
FT                   /gene="map"
FT                   /locus_tag="Z0178"
FT   CDS_pept        complement(192199..192993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="Z0178"
FT                   /product="methionine aminopeptidase"
FT                   /function="enzyme; Macromolecule synthesis, modification:
FT                   Proteins - translation and modification"
FT                   /note="Residues 1 to 264 of 264 are 100.00 pct identical to
FT                   residues 1 to 264 of 264 from Escherichia coli K-12 Strain
FT                   MG1655: B0168"
FT                   /db_xref="EnsemblGenomes-Gn:Z0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54470"
FT                   /db_xref="GOA:P0AE20"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE20"
FT                   /protein_id="AAG54470.1"
FT                   /translation="MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRIC
FT                   NDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDG
FT                   FHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE"
FT   gene            193361..194086
FT                   /gene="rpsB"
FT                   /locus_tag="Z0180"
FT   CDS_pept        193361..194086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="Z0180"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /function="structural component; Macromolecule synthesis,
FT                   modification: Ribosomal proteins - synthesis,
FT                   modificationRiboso"
FT                   /note="Residues 1 to 241 of 241 are 100.00 pct identical to
FT                   residues 1 to 241 of 241 from Escherichia coli K-12 Strain
FT                   MG1655: B0169"
FT                   /db_xref="EnsemblGenomes-Gn:Z0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54471"
FT                   /db_xref="GOA:P0A7V2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7V2"
FT                   /protein_id="AAG54471.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   gene            194344..195195
FT                   /gene="tsf"
FT                   /locus_tag="Z0181"
FT   CDS_pept        194344..195195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="Z0181"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /function="factor; Macromolecule synthesis, modification:
FT                   Proteins - translation and modification"
FT                   /note="Residues 1 to 283 of 283 are 100.00 pct identical to
FT                   residues 1 to 283 of 283 from Escherichia coli K-12 Strain
FT                   MG1655: B0170"
FT                   /db_xref="EnsemblGenomes-Gn:Z0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54472"
FT                   /db_xref="GOA:P0A6P3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6P3"
FT                   /protein_id="AAG54472.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            195342..196067
FT                   /gene="pyrH"
FT                   /locus_tag="Z0182"
FT   CDS_pept        195342..196067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="Z0182"
FT                   /product="uridylate kinase"
FT                   /function="enzyme; Central intermediary metabolism:
FT                   Nucleotide interconversions"
FT                   /note="Residues 1 to 241 of 241 are 100.00 pct identical to
FT                   residues 1 to 241 of 241 from Escherichia coli K-12 Strain
FT                   MG1655: B0171"
FT                   /db_xref="EnsemblGenomes-Gn:Z0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54473"
FT                   /db_xref="GOA:P0A7F1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7F1"
FT                   /protein_id="AAG54473.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            196217..196774
FT                   /gene="frr"
FT                   /locus_tag="Z0183"
FT   CDS_pept        196217..196774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="Z0183"
FT                   /product="ribosome releasing factor"
FT                   /function="factor; Macromolecule synthesis, modification:
FT                   Proteins - translation and modification"
FT                   /note="Residues 1 to 185 of 185 are 100.00 pct identical to
FT                   residues 1 to 185 of 185 from Escherichia coli K-12 Strain
FT                   MG1655: B0172"
FT                   /db_xref="EnsemblGenomes-Gn:Z0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54474"
FT                   /db_xref="GOA:P0A807"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A807"
FT                   /protein_id="AAG54474.1"
FT                   /translation="MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKL
FT                   TDAAIKKIEAALADKEAELMQF"
FT   gene            196866..198062
FT                   /gene="yaeM"
FT                   /locus_tag="Z0184"
FT   CDS_pept        196866..198062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeM"
FT                   /locus_tag="Z0184"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 398 of 398 are 99.74 pct identical to
FT                   residues 1 to 398 of 398 from Escherichia coli K-12 Strain
FT                   MG1655: B0173"
FT                   /db_xref="EnsemblGenomes-Gn:Z0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54475"
FT                   /db_xref="GOA:Q8X8Y1"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Y1"
FT                   /protein_id="AAG54475.1"
FT                   /translation="MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQ
FT                   CLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQP
FT                   IQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANE
FT                   ITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDASAREVARKEVMRLAS"
FT   gene            198248..199009
FT                   /gene="yaeS"
FT                   /locus_tag="Z0185"
FT   CDS_pept        198248..199009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeS"
FT                   /locus_tag="Z0185"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 253 of 253 are 100.00 pct identical to
FT                   residues 1 to 253 of 253 from Escherichia coli K-12 Strain
FT                   MG1655: B0174"
FT                   /db_xref="EnsemblGenomes-Gn:Z0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54476"
FT                   /db_xref="GOA:P60474"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60474"
FT                   /protein_id="AAG54476.1"
FT                   /translation="MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKA
FT                   GAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHN
FT                   VRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQ
FT                   QGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWP
FT                   DFDEQDFEGALNAFANRERRFGGTEPGDETA"
FT   gene            199130..199879
FT                   /gene="cdsA"
FT                   /locus_tag="Z0186"
FT   CDS_pept        199130..199879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="Z0186"
FT                   /product="CDP-diglyceride synthetase"
FT                   /function="enzyme; Fatty acid biosynthesis: Fatty acid and
FT                   phosphatidic acid biosynth"
FT                   /note="Residues 1 to 249 of 249 are 100.00 pct identical to
FT                   residues 1 to 249 of 249 from Escherichia coli K-12 Strain
FT                   MG1655: B0175"
FT                   /db_xref="EnsemblGenomes-Gn:Z0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54477"
FT                   /db_xref="GOA:P0ABG2"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABG2"
FT                   /protein_id="AAG54477.1"
FT                   /translation="MLAAWEWGQLSGFTTRSQRVWLAVLCGLLLALMLFLLPEYHRNIH
FT                   QPLVEISLWASLGWWIVALLLVLFYPGSAAIWRNSKTLRLIFGVLTIVPFFWGMLALRA
FT                   WHYDENHYSGAIWLLYVMILVWGADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLAT
FT                   AAVISWGYGMWANLDVAPVTLLICSIVAALASVLGDLTESMFKREAGIKDSGHLIPGHG
FT                   GILDRIDSLTAAVPVFACLLLLVFRTL"
FT   gene            199891..201243
FT                   /gene="yaeL"
FT                   /locus_tag="Z0187"
FT   CDS_pept        199891..201243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="Z0187"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 450 of 450 are 100.00 pct identical to
FT                   residues 1 to 450 of 450 from Escherichia coli K-12 Strain
FT                   MG1655: B0176"
FT                   /db_xref="EnsemblGenomes-Gn:Z0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54478"
FT                   /db_xref="GOA:P0AEH2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEH2"
FT                   /protein_id="AAG54478.1"
FT                   /translation="MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQI
FT                   EPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGS
FT                   PLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL"
FT   gene            201273..203705
FT                   /gene="yaeT"
FT                   /locus_tag="Z0188"
FT   CDS_pept        201273..203705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="Z0188"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 810 of 810 are 100.00 pct identical to
FT                   residues 1 to 810 of 810 from Escherichia coli K-12 Strain
FT                   MG1655: B0177"
FT                   /db_xref="EnsemblGenomes-Gn:Z0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54479"
FT                   /db_xref="GOA:P0A942"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A942"
FT                   /protein_id="AAG54479.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHS
FT                   AEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGW
FT                   TYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRW
FT                   GYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQD
FT                   GAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQ
FT                   YSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            203826..204311
FT                   /gene="hlpA"
FT                   /locus_tag="Z0190"
FT   CDS_pept        203826..204311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="Z0190"
FT                   /product="histone-like protein, located in outer membrane
FT                   or nucleoid"
FT                   /function="factor; Nucleoid-related functions"
FT                   /note="Residues 1 to 161 of 161 are 100.00 pct identical to
FT                   residues 1 to 161 of 161 from Escherichia coli K-12 Strain
FT                   MG1655: B0178"
FT                   /db_xref="EnsemblGenomes-Gn:Z0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54480"
FT                   /db_xref="GOA:P0AEU9"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEU9"
FT                   /protein_id="AAG54480.1"
FT                   /translation="MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNT
FT                   LENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQD
FT                   RARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK"
FT   gene            204315..205340
FT                   /gene="lpxD"
FT                   /locus_tag="Z0191"
FT   CDS_pept        204315..205340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="Z0191"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase; third step of endotoxin (lipidA)
FT                   synthesis"
FT                   /function="enzyme; Cell exterior constituents: Surface
FT                   polysaccharides and antigens"
FT                   /note="Residues 1 to 341 of 341 are 99.70 pct identical to
FT                   residues 1 to 341 of 341 from Escherichia coli K-12 Strain
FT                   MG1655: B0179"
FT                   /db_xref="EnsemblGenomes-Gn:Z0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54481"
FT                   /db_xref="GOA:P65323"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65323"
FT                   /protein_id="AAG54481.1"
FT                   /translation="MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHE
FT                   IQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQ
FT                   D"
FT   gene            205445..205900
FT                   /gene="fabZ"
FT                   /locus_tag="Z0192"
FT   CDS_pept        205445..205900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="Z0192"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /function="enzyme; Fatty acid biosynthesis: Fatty acid and
FT                   phosphatidic acid biosynth"
FT                   /note="Residues 1 to 151 of 151 are 100.00 pct identical to
FT                   residues 1 to 151 of 151 from Escherichia coli K-12 Strain
FT                   MG1655: B0180"
FT                   /db_xref="EnsemblGenomes-Gn:Z0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54482"
FT                   /db_xref="GOA:P0A6Q8"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Q8"
FT                   /protein_id="AAG54482.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            205904..206692
FT                   /gene="lpxA"
FT                   /locus_tag="Z0193"
FT   CDS_pept        205904..206692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="Z0193"
FT                   /product="UDP-N-acetylglucosamine acetyltransferase; lipid
FT                   A biosynthesis"
FT                   /function="enzyme; Cell exterior constituents: Surface
FT                   polysaccharides and antigens"
FT                   /note="Residues 1 to 262 of 262 are 99.61 pct identical to
FT                   residues 1 to 262 of 262 from Escherichia coli K-12 Strain
FT                   MG1655: B0181"
FT                   /db_xref="EnsemblGenomes-Gn:Z0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54483"
FT                   /db_xref="GOA:Q8X8X8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8X8"
FT                   /protein_id="AAG54483.1"
FT                   /translation="MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLK
FT                   SHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMAAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLI
FT                   YRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR"
FT   gene            206692..207840
FT                   /gene="lpxB"
FT                   /locus_tag="Z0194"
FT   CDS_pept        206692..207840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="Z0194"
FT                   /product="tetraacyldisaccharide-1-P; lipid A biosynthesis,
FT                   penultimate step"
FT                   /function="enzyme; Macromolecules: Lipopolysaccharide"
FT                   /note="Residues 1 to 382 of 382 are 98.69 pct identical to
FT                   residues 1 to 382 of 382 from Escherichia coli K-12 Strain
FT                   MG1655: B0182"
FT                   /db_xref="EnsemblGenomes-Gn:Z0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54484"
FT                   /db_xref="GOA:Q8X8X7"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8X7"
FT                   /protein_id="AAG54484.1"
FT                   /translation="MTEQRPLTIALVAGETSGDILGAGLIRALKERVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTKRFGELKPDVFVGIDAPDFNI
FT                   ILEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDKYNVPCRF
FT                   IGHTMADAMPLDPDKNSARDVLGIPYDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQT
FT                   YPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAAA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAAQAVLELAQ"
FT   gene            207837..208433
FT                   /gene="rnhB"
FT                   /locus_tag="Z0195"
FT   CDS_pept        207837..208433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="Z0195"
FT                   /product="RNAse HII, degrades RNA of DNA-RNA hybrids"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of RNA"
FT                   /note="Residues 1 to 198 of 198 are 99.49 pct identical to
FT                   residues 1 to 198 of 198 from Escherichia coli K-12 Strain
FT                   MG1655: B0183"
FT                   /db_xref="EnsemblGenomes-Gn:Z0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54485"
FT                   /db_xref="GOA:Q8X8X6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8X6"
FT                   /protein_id="AAG54485.1"
FT                   /translation="MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLND
FT                   SKKLSEKRRLALCEEIKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPKLPMPAMAVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAEHGATEHHRRSFGPVKRALGLAS"
FT   gene            208470..211952
FT                   /gene="dnaE"
FT                   /locus_tag="Z0196"
FT   CDS_pept        208470..211952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="Z0196"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /function="enzyme; Macromolecule synthesis, modification:
FT                   DNA - replication, repair, restr./modific'n"
FT                   /note="Residues 1 to 1160 of 1160 are 99.82 pct identical
FT                   to residues 1 to 1160 of 1160 from Escherichia coli K-12
FT                   Strain MG1655: B0184"
FT                   /db_xref="EnsemblGenomes-Gn:Z0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54486"
FT                   /db_xref="GOA:Q8X8X5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8X5"
FT                   /protein_id="AAG54486.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFP
FT                   DRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMSTEDYLVKRAKEGLEERLAFLFPDEEERVKRRPEYDERLETELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQHLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            211965..212924
FT                   /gene="accA"
FT                   /locus_tag="Z0197"
FT   CDS_pept        211965..212924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="Z0197"
FT                   /product="acetylCoA carboxylase, carboxytransferase
FT                   component, alpha subunit"
FT                   /function="enzyme; Fatty acid biosynthesis: Fatty acid and
FT                   phosphatidic acid biosynth"
FT                   /note="Residues 1 to 319 of 319 are 100.00 pct identical to
FT                   residues 1 to 319 of 319 from Escherichia coli K-12 Strain
FT                   MG1655: B0185"
FT                   /db_xref="EnsemblGenomes-Gn:Z0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54487"
FT                   /db_xref="GOA:P0ABD6"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABD6"
FT                   /protein_id="AAG54487.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
FT   gene            213023..215164
FT                   /gene="ldcC"
FT                   /locus_tag="Z0198"
FT   CDS_pept        213023..215164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="Z0198"
FT                   /product="lysine decarboxylase 2, constitutive"
FT                   /function="enzyme; Energy metabolism, carbon: Pyruvate
FT                   dehydrogenase"
FT                   /note="Residues 1 to 713 of 713 are 99.85 pct identical to
FT                   residues 1 to 713 of 713 from Escherichia coli K-12 Strain
FT                   MG1655: B0186"
FT                   /db_xref="EnsemblGenomes-Gn:Z0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54488"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1J4"
FT                   /protein_id="AAG54488.1"
FT                   /translation="MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMALCFFE
FT                   YALGQAEDIAIRMRQYTDEYLDNITPPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPV
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYIVTNGTST
FT                   SNKIVGMYAAPSGSTLLIDRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFT
FT                   RDSIEEKVAATTQAQWPVHAVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGERVAGKVIFETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTT
FT                   SPSYPIVASVETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDGWFFDIWQPPQ
FT                   VDEAECWPVAPGEQWHGFNDADADHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLLRGLTEFKRSYDLNLRIKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRKHDLPGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETI
FT                   ALEQLVGRVSANMILPYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIH
FT                   GAKQDEDGVYRVRVLKMAG"
FT   gene            215194..215610
FT                   /gene="yaeR"
FT                   /locus_tag="Z0199"
FT   CDS_pept        215194..215610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="Z0199"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 138 of 138 are 99.27 pct identical to
FT                   residues 1 to 138 of 138 from Escherichia coli K-12 Strain
FT                   MG1655: B0187"
FT                   /db_xref="EnsemblGenomes-Gn:Z0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54489"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC67"
FT                   /protein_id="AAG54489.1"
FT                   /translation="MLLTNKGDVMLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEV
FT                   YREARDSWKGDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLES
FT                   HNVKCEAIRVDPYTQKRFTFFNDPDGLPLELYEQ"
FT   gene            215675..216970
FT                   /gene="mesJ"
FT                   /locus_tag="Z0200"
FT   CDS_pept        215675..216970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="Z0200"
FT                   /product="cell cycle protein"
FT                   /function="orf; Cell division"
FT                   /note="Residues 1 to 429 of 431 are 97.43 pct identical to
FT                   residues 1 to 429 of 432 from Escherichia coli K-12 Strain
FT                   MG1655: B0188"
FT                   /db_xref="EnsemblGenomes-Gn:Z0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54490"
FT                   /db_xref="GOA:Q8X8W8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8W8"
FT                   /protein_id="AAG54490.1"
FT                   /translation="MTLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGGALR
FT                   AIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFART
FT                   LLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGEL
FT                   AQWALAHGLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAETTARSAALCAEQESL
FT                   LDELLADDLAHCQSPQGTLQIVPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQE
FT                   VALAREDASPCLRLGAFEIRRYQSQLWWIKSVTGQSENIVPWQTWLQPLELPAGQGSVQ
FT                   LNAGGDIRPPRADEAVSVRFKAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFY
FT                   GETLIAAAGGFVTQEGVAEGENGISFVWQRNA"
FT   gene            complement(217023..217283)
FT                   /gene="yaeO"
FT                   /locus_tag="Z0201"
FT   CDS_pept        complement(217023..217283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeO"
FT                   /locus_tag="Z0201"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 86 of 86 are 100.00 pct identical to
FT                   residues 1 to 86 of 86 from Escherichia coli K-12 Strain
FT                   MG1655: B0189"
FT                   /db_xref="EnsemblGenomes-Gn:Z0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54491"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDH0"
FT                   /protein_id="AAG54491.1"
FT                   /translation="MSMNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDL
FT                   VSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES"
FT   gene            217636..218094
FT                   /locus_tag="Z0202"
FT   CDS_pept        217636..218094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0202"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 152 of 152 are 99.34 pct identical to
FT                   residues 1 to 152 of 181 from Escherichia coli K-12 Strain
FT                   MG1655: B0190"
FT                   /db_xref="EnsemblGenomes-Gn:Z0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54492"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KCE7"
FT                   /protein_id="AAG54492.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCAQFANLSVWYLDDEQLAKVSAFADRTMTL"
FT   gene            218178..218588
FT                   /gene="yaeJ"
FT                   /locus_tag="Z0203"
FT   CDS_pept        218178..218588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="Z0203"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 136 of 136 are 94.99 pct identical to
FT                   residues 1 to 140 of 140 from Escherichia coli K-12 Strain
FT                   MG1655: B0191"
FT                   /db_xref="EnsemblGenomes-Gn:Z0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54493"
FT                   /db_xref="GOA:A0A4Q0C2Q7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2Q7"
FT                   /protein_id="AAG54493.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRSGRE"
FT   gene            218602..219312
FT                   /gene="cutF"
FT                   /locus_tag="Z0204"
FT   CDS_pept        218602..219312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutF"
FT                   /locus_tag="Z0204"
FT                   /product="copper homeostasis protein (lipoprotein)"
FT                   /function="putative transport; Protection responses:
FT                   Detoxification"
FT                   /note="Residues 1 to 236 of 236 are 98.72 pct identical to
FT                   residues 1 to 236 of 236 from Escherichia coli K-12 Strain
FT                   MG1655: B0192"
FT                   /db_xref="EnsemblGenomes-Gn:Z0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54494"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1G7"
FT                   /protein_id="AAG54494.1"
FT                   /translation="MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSK
FT                   GEKSYYRAKGDALEMLDREGNPIESQFNYTLEPAQSSLPMTPMTLRGMYFYMADAATFT
FT                   DCATGKRFMVANNAELERGYLAARGHSEKPVLLSVEGHFTLEANPDTGAPTKVLAPDTA
FT                   GKFYPNQDCSSLGQ"
FT   gene            complement(219512..220336)
FT                   /gene="yaeF"
FT                   /locus_tag="Z0205"
FT   CDS_pept        complement(219512..220336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="Z0205"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 274 of 274 are 96.71 pct identical to
FT                   residues 19 to 292 of 292 from Escherichia coli K-12 Strain
FT                   MG1655: B0193"
FT                   /db_xref="EnsemblGenomes-Gn:Z0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54495"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1H9"
FT                   /protein_id="AAG54495.1"
FT                   /translation="MDKPKAYCRLLLPCFLLLSACTVDISQPDSSATAVDAEAKTWAVK
FT                   FQHQSSFTEQSIKEITVPDLKPGDLLFSSSLEVTSFGIRVFSTSSVSHVAIYLGENNVA
FT                   EATGAGVQIVSLKKAMKHSDKLFVLRVPDLTPQQATEITAFANKIKDSGYNYRGIVEFI
FT                   PFMVTRQMCSLNPFSEDFRQQCVSGLAKAQLSSVVEGDKKSWFCSEFVTDAFAKAGHPL
FT                   TLAQSGWISPADLMHMRIGDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTR"
FT   gene            complement(220389..222107)
FT                   /gene="proS"
FT                   /locus_tag="Z0206"
FT   CDS_pept        complement(220389..222107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="Z0206"
FT                   /product="proline tRNA synthetase"
FT                   /function="enzyme; Amino acyl tRNA syn; tRNA modific'n"
FT                   /note="Residues 1 to 572 of 572 are 99.30 pct identical to
FT                   residues 1 to 572 of 572 from Escherichia coli K-12 Strain
FT                   MG1655: B0194"
FT                   /db_xref="EnsemblGenomes-Gn:Z0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54496"
FT                   /db_xref="GOA:Q8X8W2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8W2"
FT                   /protein_id="AAG54496.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVV
FT                   FSDTSDYAANIELAEAIAPKEPRAAATQEMTLVDTPNAKTIAELVEQFNLPIKKTVKTL
FT                   LVKAVEGSSFPLVALLVRGDHELNEVKAEKLPQVASPLTFATEEEIRAVVKAGPGSLGP
FT                   VNMPIPVVIDRTVAAMSDFTAGANIDGKHYFGINWDRDVATPEVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NYDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTIVLGDRNLDNDDIEYKYRRNGEKQLIKTGDIVEYLVKQIKG"
FT   gene            complement(222218..222925)
FT                   /locus_tag="Z0207"
FT   CDS_pept        complement(222218..222925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0207"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 235 of 235 are 99.57 pct identical to
FT                   residues 1 to 235 of 235 from Escherichia coli K-12 Strain
FT                   MG1655: B0195"
FT                   /db_xref="EnsemblGenomes-Gn:Z0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54497"
FT                   /db_xref="GOA:A0A4Q0C1K1"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1K1"
FT                   /protein_id="AAG54497.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKDCVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   SFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
FT   gene            complement(222922..223326)
FT                   /gene="rcsF"
FT                   /locus_tag="Z0208"
FT   CDS_pept        complement(222922..223326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="Z0208"
FT                   /product="regulator in colanic acid synthesis; interacts
FT                   with RcsB"
FT                   /function="regulator; Cell exterior constituents: Surface
FT                   polysaccharides and antigens"
FT                   /note="Residues 1 to 134 of 134 are 99.25 pct identical to
FT                   residues 1 to 134 of 134 from Escherichia coli K-12 Strain
FT                   MG1655: B0196"
FT                   /db_xref="EnsemblGenomes-Gn:Z0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54498"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Y0"
FT                   /protein_id="AAG54498.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQALCIGSALNITAK"
FT   gene            complement(223444..224259)
FT                   /gene="yaeC"
FT                   /locus_tag="Z0209"
FT   CDS_pept        complement(223444..224259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeC"
FT                   /locus_tag="Z0209"
FT                   /product="putative lipoprotein"
FT                   /function="putative membrane; Not classified"
FT                   /note="Residues 1 to 271 of 271 are 99.26 pct identical to
FT                   residues 1 to 271 of 271 from Escherichia coli K-12 Strain
FT                   MG1655: B0197"
FT                   /db_xref="EnsemblGenomes-Gn:Z0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54499"
FT                   /db_xref="GOA:Q8X8V9"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8V9"
FT                   /protein_id="AAG54499.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKNGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(224299..224952)
FT                   /gene="yaeE"
FT                   /locus_tag="Z0210"
FT   CDS_pept        complement(224299..224952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="Z0210"
FT                   /product="putative transport system permease protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 217 of 217 are 99.53 pct identical to
FT                   residues 1 to 217 of 217 from Escherichia coli K-12 Strain
FT                   MG1655: B0198"
FT                   /db_xref="EnsemblGenomes-Gn:Z0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54500"
FT                   /db_xref="GOA:Q8X800"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X800"
FT                   /protein_id="AAG54500.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVVGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
FT   gene            complement(224945..225976)
FT                   /gene="abc"
FT                   /locus_tag="Z0211"
FT   CDS_pept        complement(224945..225976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abc"
FT                   /locus_tag="Z0211"
FT                   /product="ATP-binding component of a transporter"
FT                   /function="transport; Not classified"
FT                   /note="Residues 1 to 343 of 343 are 99.70 pct identical to
FT                   residues 1 to 343 of 343 from Escherichia coli K-12 Strain
FT                   MG1655: B0199"
FT                   /db_xref="EnsemblGenomes-Gn:Z0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54501"
FT                   /db_xref="GOA:P63356"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63356"
FT                   /protein_id="AAG54501.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
FT   gene            226164..226739
FT                   /gene="yaeD"
FT                   /locus_tag="Z0212"
FT   CDS_pept        226164..226739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeD"
FT                   /locus_tag="Z0212"
FT                   /product="putative phosphatase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 191 of 191 are 100.00 pct identical to
FT                   residues 1 to 191 of 191 from Escherichia coli K-12 Strain
FT                   MG1655: B0200"
FT                   /db_xref="EnsemblGenomes-Gn:Z0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54502"
FT                   /db_xref="GOA:P63229"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63229"
FT                   /protein_id="AAG54502.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKM
FT                   GFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFR
FT                   QVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP
FT                   EAENAADWVLNSLADLPQAIKKQQKPAQ"
FT   gene            227103..228644
FT                   /gene="rrsH"
FT                   /locus_tag="Z0213"
FT   rRNA            227103..228644
FT                   /gene="rrsH"
FT                   /locus_tag="Z0213"
FT                   /product="16S ribosomal RNA"
FT                   /function="RNA; Macromolecule synthesis, modification:
FT                   Ribosomal and stable RNAs"
FT   gene            228713..228789
FT                   /gene="ileV"
FT                   /locus_tag="Z0217"
FT   tRNA            228713..228789
FT                   /gene="ileV"
FT                   /locus_tag="Z0217"
FT                   /product="tRNA-Ile"
FT                   /function="RNA; tRNA"
FT                   /note="anticodon: GAT"
FT   gene            228832..228907
FT                   /gene="alaV"
FT                   /locus_tag="Z0218"
FT   tRNA            228832..228907
FT                   /gene="alaV"
FT                   /locus_tag="Z0218"
FT                   /product="tRNA-Ala"
FT                   /function="RNA; tRNA"
FT                   /note="anticodon: TGC"
FT   gene            229091..231993
FT                   /gene="rrlH"
FT                   /locus_tag="Z0219"
FT   rRNA            229091..231993
FT                   /gene="rrlH"
FT                   /locus_tag="Z0219"
FT                   /product="23S ribosomal RNA"
FT                   /function="RNA; Macromolecule synthesis, modification:
FT                   Ribosomal and stable RNAs"
FT   gene            232086..232205
FT                   /gene="rrfH"
FT                   /locus_tag="Z0226"
FT   rRNA            232086..232205
FT                   /gene="rrfH"
FT                   /locus_tag="Z0226"
FT                   /product="5S ribosomal RNA"
FT                   /function="RNA; Macromolecule synthesis, modification:
FT                   Ribosomal and stable RNAs"
FT   gene            232258..232334
FT                   /gene="aspU"
FT                   /locus_tag="Z0228"
FT   tRNA            232258..232334
FT                   /gene="aspU"
FT                   /locus_tag="Z0228"
FT                   /product="tRNA-Asp"
FT                   /function="RNA; tRNA"
FT                   /note="anticodon: GTC"
FT   gene            232497..233300
FT                   /gene="yafB"
FT                   /locus_tag="Z0229"
FT   CDS_pept        232497..233300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafB"
FT                   /locus_tag="Z0229"
FT                   /product="putative aldose reductase"
FT                   /function="putative enzyme; Not classified"
FT                   /EC_number="1.1.1.21"
FT                   /note="Residues 1 to 267 of 267 are 98.50 pct identical to
FT                   residues 1 to 267 of 267 from Escherichia coli K-12 Strain
FT                   MG1655: B0207"
FT                   /db_xref="EnsemblGenomes-Gn:Z0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54503"
FT                   /db_xref="GOA:Q8X7Z7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7Z7"
FT                   /protein_id="AAG54503.1"
FT                   /translation="MAIPAFGLGTFRLKDDVVISSVKTALELGYRAIDTAQIYDNEAAV
FT                   GLAIAESGVPRHELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDE
FT                   VSVEEFMQALLEAKKEGLTREIGISNFTIPLMEKAIAAVGAENIATNQIELSPYLQNRK
FT                   VVAWAKQHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSS
FT                   TKRENLESNLKAQNLQLDAEDKKAIAALDCNDRLVSPEGLAPEWD"
FT   gene            complement(233297..234211)
FT                   /gene="yafC"
FT                   /locus_tag="Z0230"
FT   CDS_pept        complement(233297..234211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="Z0230"
FT                   /product="putative transcriptional regulator LYSR-type"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 304 of 304 are 98.68 pct identical to
FT                   residues 1 to 304 of 304 from Escherichia coli K-12 Strain
FT                   MG1655: B0208"
FT                   /db_xref="EnsemblGenomes-Gn:Z0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54504"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2R6"
FT                   /protein_id="AAG54504.1"
FT                   /translation="MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQSILQEMAAAESEIMETRNTPRGLLRIDAATPVV
FT                   LHFLMPLIKPFRERYPEVTLSLVSSETIINLIERKVDVAIRAGTLTDSSLRARPLFNSY
FT                   RKIIASPDYISRYGKPETIDDLKQHVCLGFTEPASLNTWPVACSDGQLHEVKYGLSSNS
FT                   GETLKQLCLSGNGIACLSDYMIDREIARGELVELMADKVLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEHVKTAPGGAVREA"
FT   gene            234452..235252
FT                   /gene="yafD"
FT                   /locus_tag="Z0232"
FT   CDS_pept        234452..235252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="Z0232"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 266 of 266 are 100.00 pct identical to
FT                   residues 1 to 266 of 266 from Escherichia coli K-12 Strain
FT                   MG1655: B0209"
FT                   /db_xref="EnsemblGenomes-Gn:Z0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54505"
FT                   /db_xref="GOA:P0A8U4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8U4"
FT                   /protein_id="AAG54505.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
FT   misc_feature    235291..235511
FT                   /note="O-island #6; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            235330..236100
FT                   /locus_tag="Z0233"
FT   CDS_pept        235330..236100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0233"
FT                   /product="unknown"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 52 to 256 of 256 are 93.65 pct identical to
FT                   residues 3 to 207 of 207 from Escherichia coli K-12 Strain
FT                   MG1655: B0210"
FT                   /db_xref="EnsemblGenomes-Gn:Z0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54506"
FT                   /db_xref="GOA:A0A4Q0C1I7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1I7"
FT                   /protein_id="AAG54506.1"
FT                   /translation="MTTQSHHDHVEKQFSSQASEYLTSTVHASGRDLQLLAVCLADYPD
FT                   ASVLDMGCGAGHASFVAAQNVSTVVAYDLSAQMLDVVAQAAEVRQLKNITTRQGYAESL
FT                   PFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIVMDVMSPGHPVRDIWLQTV
FT                   EALCDTSHVRNYASGEWLRLINEANLIVDNLITDKLPLEFSSWVARMRTPEALVDAIRI
FT                   YQQSASTEVRTYFALQNDGSFTSDIIMVDAHKAA"
FT   gene            complement(236148..237506)
FT                   /gene="dniR"
FT                   /locus_tag="Z0235"
FT   CDS_pept        complement(236148..237506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dniR"
FT                   /locus_tag="Z0235"
FT                   /product="transcriptional regulator for nitrite reductase
FT                   (cytochrome c552)"
FT                   /function="regulator; Energy metabolism, carbon: Anaerobic
FT                   respiration"
FT                   /note="Residues 1 to 452 of 452 are 99.77 pct identical to
FT                   residues 1 to 452 of 452 from Escherichia coli K-12 Strain
FT                   MG1655: B0211"
FT                   /db_xref="EnsemblGenomes-Gn:Z0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54507"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1H2"
FT                   /protein_id="AAG54507.1"
FT                   /translation="MKAKAILLASVLLVGCQSTGNVQQHAQSLSAAGQGEAAKFTSQAR
FT                   WMDDGTSIAPDGDLWAFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPYMYW
FT                   IAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDAR
FT                   RDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFWSLP
FT                   LPQETKQYVPKMLALSDILKNSKRYGVRLPTTDESRALARVHLSSPVEMAKVADMAGIS
FT                   VSKLKTFNAGVKGSTLGASGPQYVMVPKKHADQLRESLASGEIAAVQSTLVADNTPLNS
FT                   RVYTVRSGDTLSSIASRLGVSTKDLQQWNKLRGSKLKPGQSLTIGAGSSAQRLANNSDS
FT                   ITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVKNNSMPDS"
FT   gene            complement(237578..238333)
FT                   /gene="gloB"
FT                   /locus_tag="Z0236"
FT   CDS_pept        complement(237578..238333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="Z0236"
FT                   /product="probable hydroxyacylglutathione hydrolase"
FT                   /function="putative enzyme; Central intermediary
FT                   metabolism: Pool, multipurpose conversions of intermed.
FT                   met'm"
FT                   /note="Residues 1 to 251 of 251 are 100.00 pct identical to
FT                   residues 1 to 251 of 251 from Escherichia coli K-12 Strain
FT                   MG1655: B0212"
FT                   /db_xref="EnsemblGenomes-Gn:Z0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54508"
FT                   /db_xref="GOA:P0AC85"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AC85"
FT                   /protein_id="AAG54508.1"
FT                   /translation="MNLNSIPAFDDNYIWVLNDEAGRCLIVDPGDAEPVLNAIAANNWQ
FT                   PEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSV
FT                   IATPGHTLGHICYFSKPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCC
FT                   AHEYTLSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDI
FT                   DLINVINEETLLQQPEERFAWLRSKKDRF"
FT   gene            238349..239089
FT                   /gene="yafS"
FT                   /locus_tag="Z0237"
FT   CDS_pept        238349..239089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="Z0237"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 246 of 246 are 98.37 pct identical to
FT                   residues 1 to 246 of 246 from Escherichia coli K-12 Strain
FT                   MG1655: B0213"
FT                   /db_xref="EnsemblGenomes-Gn:Z0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54509"
FT                   /db_xref="GOA:A0A0H3JFE3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFE3"
FT                   /protein_id="AAG54509.1"
FT                   /translation="MKRKVVMKPARVPQTVVAPDRWGDLPWGELYRKALERQLNPWFTK
FT                   MYGFYLLKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADPLHLPFADKSVDVCLLAH
FT                   TLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLM
FT                   RQLDWLSLLNFEVLHASRFHVLPWNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPM
FT                   KQSKNKPRIRQAVGATRQCRKPQA"
FT   gene            complement(239086..239553)
FT                   /gene="rnhA"
FT                   /locus_tag="Z0239"
FT   CDS_pept        complement(239086..239553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="Z0239"
FT                   /product="RNase HI, degrades RNA of DNA-RNA hybrids,
FT                   participates in DNA replication"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of RNA"
FT                   /note="Residues 1 to 155 of 155 are 100.00 pct identical to
FT                   residues 1 to 155 of 155 from Escherichia coli K-12 Strain
FT                   MG1655: B0214"
FT                   /db_xref="EnsemblGenomes-Gn:Z0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54510"
FT                   /db_xref="GOA:P0A7Y6"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7Y6"
FT                   /protein_id="AAG54510.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNN
FT                   RMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLW
FT                   QRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV"
FT   gene            239618..240349
FT                   /gene="dnaQ"
FT                   /locus_tag="Z0241"
FT   CDS_pept        239618..240349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="Z0241"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /function="enzyme; Macromolecule synthesis, modification:
FT                   DNA - replication, repair, restr./modific'n"
FT                   /note="Residues 1 to 243 of 243 are 99.17 pct identical to
FT                   residues 1 to 243 of 243 from Escherichia coli K-12 Strain
FT                   MG1655: B0215"
FT                   /db_xref="EnsemblGenomes-Gn:Z0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54511"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDH2"
FT                   /protein_id="AAG54511.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRLVRQASKLRVVFATDEEL
FT                   AAHEARLDLVQKKGGSCLWRA"
FT   gene            240482..240558
FT                   /gene="aspV"
FT                   /locus_tag="Z0242"
FT   tRNA            240482..240558
FT                   /gene="aspV"
FT                   /locus_tag="Z0242"
FT                   /product="tRNA-Asp"
FT                   /function="RNA; tRNA"
FT                   /note="anticodon: GTC"
FT   gene            240887..241687
FT                   /locus_tag="Z0243"
FT   CDS_pept        240887..241687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0243"
FT                   /product="hypothetical protein"
FT                   /function="putative enzyme; Unknown function"
FT                   /note="Residues 1 to 266 of 266 are 89.47 pct identical to
FT                   residues 1 to 261 of 261 from Escherichia coli K-12 Strain
FT                   MG1655: B0217"
FT                   /db_xref="EnsemblGenomes-Gn:Z0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3F6"
FT                   /protein_id="AAG54512.1"
FT                   /translation="MNSKKLCCICVLFSLLAGCASESSIDEKKKKAQVTQSNINKNTPQ
FT                   QLTDKDLFGNETTLAVSEEDIQAALDGDEFRVPLNSPVILVQSGNRAPETIMQEEMRKY
FT                   YTVSTFSGIPDRQKPLTCNKNKDKNENEDVARAENMNWMQALRFVAAKGHQKAIIVYQD
FT                   MLQTGKYDSALKSTVWSDYKNEKLTDAISLRYLVRFTLVDVATGEWATWSPVNYESRVI
FT                   FPPAGITKTSNKELSNDHVTEAQLFNLKQKTYVSMVKDLVSRFQ"
FT   misc_feature    241549..277463
FT                   /note="O-island #7; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(241872..242168)
FT                   /locus_tag="Z0244"
FT   CDS_pept        complement(241872..242168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0244"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2U039"
FT                   /protein_id="AAG54513.1"
FT                   /translation="MIIINLRLTLLFILATFTYSVQSDEFDDQTTYTQYRYFSTAIPED
FT                   IRRFMFYVDYCFVDLAFDIETDSMTAKNDIINECTPLKERNKTLKEKYKKMKR"
FT   gene            complement(242165..242620)
FT                   /locus_tag="Z0245"
FT   CDS_pept        complement(242165..242620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0245"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Y0"
FT                   /protein_id="AAG54514.1"
FT                   /translation="MRMRKITIILLLTFSCTKGLAFDISMSKECSGVDELEFIDCVKNS
FT                   FIMSTITLKKAEANIKEKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFT
FT                   LTWGARVGRLAFSRLYPCYTELNKIRAMQLNNAYISDFQNPDEISSK"
FT   gene            complement(242617..243213)
FT                   /locus_tag="Z0246"
FT   CDS_pept        complement(242617..243213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0246"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1I8"
FT                   /protein_id="AAG54515.1"
FT                   /translation="MLWTENDAENTSQWNGYPLQIGRFRKDKAMPALISGEKSTALVTP
FT                   PQWRNKAFNGLKDPERNYWAKEQITGSPEENIKAAITYLMMKLSNTKEESTIDQYDSTL
FT                   YSAIVQKGDLADNIRKERKTTIPNLTKNNPGKNLDKIHPGDILYYQKASMKVIITGWKP
FT                   ITIKNVAMNYNGGGDPKYAIKLQFVYTLLTKNRVL"
FT   gene            complement(243292..243513)
FT                   /locus_tag="Z0247"
FT   CDS_pept        complement(243292..243513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0247"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1J5"
FT                   /protein_id="AAG54516.1"
FT                   /translation="MANNILHSSTSDSESKNTSTDSTLFNEKFPFQLRQDFASRITEDE
FT                   SDFFKWKKIRELAFVSNHKEWNKYDLLI"
FT   gene            complement(243534..244013)
FT                   /locus_tag="Z0248"
FT   CDS_pept        complement(243534..244013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0248"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 148 of 159 are 38.92 pct identical to
FT                   residues 1 to 144 of 392 from GenPept 118 :
FT                   gi|606377|gb|AAA58240.1| (U18997) ORF_o392; poor E. coli,
FT                   good phage statistics [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54517"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1I1"
FT                   /protein_id="AAG54517.1"
FT                   /translation="MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFM
FT                   HGLNRDQNVNHHHLTIKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELFYKIK
FT                   LTGAKISDIHVSISHIVVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF"
FT   gene            complement(243979..245478)
FT                   /locus_tag="Z0249"
FT   CDS_pept        complement(243979..245478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0249"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54518"
FT                   /db_xref="GOA:Q8X7X1"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7X1"
FT                   /protein_id="AAG54518.1"
FT                   /translation="MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSD
FT                   PRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLARTRTQ
FT                   GLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPL
FT                   IYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTL
FT                   IYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSV
FT                   AVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLET
FT                   GMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQR
FT                   EKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQINERLEGVL
FT                   SRWLLLKNNTIPTIKKALNFNNIHEYKGVLNGEFNLFNTKW"
FT   gene            complement(245399..248833)
FT                   /locus_tag="Z0250"
FT   CDS_pept        complement(245399..248833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0250"
FT                   /product="putative macrophage toxin"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 105 to 1141 of 1144 are 20.61 pct identical
FT                   to residues 25 to 970 of 973 from GenPept 118 :
FT                   gi|2897626|emb|CAA75338.1| (Y15044) IcmF protein
FT                   [Legionella pneumophila]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54519"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Z2"
FT                   /protein_id="AAG54519.1"
FT                   /translation="MLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIA
FT                   LVWLTVRVMKRLQLLEKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLW
FT                   QLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARGTEQRLYLTPHVGKQAVIFDIDGT
FT                   LCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTADKRHREHLLQTLR
FT                   SRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVTFTRRAHENDDW
FT                   RTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGEN
FT                   MNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQAL
FT                   LAEPNLATESRAWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKA
FT                   FMDVPPPQGEDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTY
FT                   LQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRW
FT                   SEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKL
FT                   PVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGLQSYF
FT                   VKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNI
FT                   RNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDYQL
FT                   LTRLGHEFAPENITLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLR
FT                   LDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFN
FT                   EQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVII
FT                   REDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRN
FT                   YTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTV
FT                   RFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY"
FT   gene            complement(248970..249764)
FT                   /locus_tag="Z0251"
FT   CDS_pept        complement(248970..249764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0251"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54520"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFF5"
FT                   /protein_id="AAG54520.1"
FT                   /translation="MTQPSAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRL
FT                   RRHALWQSITSTPQAESDGRTPLAAVSADMVADYQSRLASADMALWQQVEKSVLLAPYW
FT                   LDGHCLSAQTALRLGYKQVADTIRDEVIRFLERLPQLTGLLFNDRTPFLSEQTKQWLAA
FT                   SPDGKVAPVAQIGEESQAARACFAGQGLEAALRYLDMLPEGDPRDQFHRQYLAAQLTEE
FT                   AGLIQLAQQQYRMLLMIGSQMMVSDWEPSLLTQLEQKFTAEQ"
FT   gene            complement(249761..250381)
FT                   /locus_tag="Z0252"
FT   CDS_pept        complement(249761..250381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0252"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54521"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC29"
FT                   /protein_id="AAG54521.1"
FT                   /translation="MAMDLRDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKL
FT                   GSLAHAQLDIPELQRRGLQLLASESKDFRLLAHLLRTLQHAGDPLLALHLLTLYVEHYW
FT                   TVAAPQNMAHKKRFASQIIKRFETVLKAFHKTLPQRSAILCWVSWRNWRSAGSHITSRN
FT                   WHRLPMIFLPCTSVRLIVRLLLRSPLRRPPVVHHKPPSRLKAA"
FT   gene            complement(250386..251129)
FT                   /locus_tag="Z0253"
FT   CDS_pept        complement(250386..251129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0253"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54522"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDH3"
FT                   /protein_id="AAG54522.1"
FT                   /translation="MSRLRVFRQTGWFIAGLMTGLPATAAPAEASSMAGVAVAVATTTP
FT                   PDATATLQAMQSCRRESAALERLDCYDHLLAPLSPSGFDGALVKAGFVGEAWTRATEQE
FT                   KRREGNTTELLVTQVPGERPTVVITTPAIGHVPPRPVLMFSCVDNITRMQVALMHPLDV
FT                   HDIAVTLNADSRALRSHWFVRENGTLLESSRGLSGIDEIKQLFGAKTLTVDTGADNAAG
FT                   KLTFNIDGLARAIAPLRDACHWAGE"
FT   gene            complement(251126..253897)
FT                   /locus_tag="Z0254"
FT   CDS_pept        complement(251126..253897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0254"
FT                   /product="putative protease"
FT                   /function="putative enzyme; Macromolecule degradation:
FT                   Degradation of proteins, peptides, glyco"
FT                   /note="Residues 132 to 884 of 923 are 40.05 pct identical
FT                   to residues 110 to 838 of 911 from GenPept 118 :
FT                   gi|530207|gb|AAA66338.1| (L35272) heat shock protein
FT                   [Glycine max]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54523"
FT                   /db_xref="GOA:A0A4Q2TXH7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TXH7"
FT                   /protein_id="AAG54523.1"
FT                   /translation="MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQM
FT                   LAMPRSDLRVITRQGDIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLAS
FT                   AEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPD
FT                   ADGKGAGTLTDASDTLLARYAKNMTEDARNGRLAPVLCRDHEIDLMIDILCRRRKNNPV
FT                   VVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGL
FT                   MAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPNAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERY
FT                   LSGRQLPDKAIDVLDTACARVAINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRT
FT                   DTSRMTEVLVQYDETLTALDELEAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADT
FT                   VEDTQPESESESEQDNTGAVPADETDREQPEETAETVSPVQRLAQLTAELDALHNDRLL
FT                   VSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLL
FT                   TARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVS
FT                   RLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGE
FT                   GRLIDCKNIVFFLTSNLGYQVIVEHADDPETMQEALYPVLADFFKPALLARMEVVPYLP
FT                   LSKETLATIIAGKLARLDNVLRSRFGAEVVIEPEVTDEIMSRVTRAENGARMLESVIDG
FT                   DMLPPLSLLLLQKMAANTAIARIRLSAVDGAFTADVEDAQNDESVTKDETVL"
FT   gene            complement(253906..254667)
FT                   /locus_tag="Z0255"
FT   CDS_pept        complement(253906..254667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0255"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54524"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1I5"
FT                   /protein_id="AAG54524.1"
FT                   /translation="MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRY
FT                   KVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
FT   gene            complement(254672..256003)
FT                   /locus_tag="Z0256"
FT   CDS_pept        complement(254672..256003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0256"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 339 to 442 of 443 are 51.92 pct identical
FT                   to residues 1 to 104 of 105 from GenPept 118 :
FT                   gi|3341578|emb|CAA13133.1| (AJ231091) z29f [Vibrio
FT                   cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54525"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2U072"
FT                   /protein_id="AAG54525.1"
FT                   /translation="MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWG
FT                   FTELTLNNELLAQGKIMIDSASGTLPDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLA
FT                   LPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGDARTLTLGQLTPRIMSGAEDMSAY
FT                   ITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIG
FT                   SPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAELLGELMTFTEPSR
FT                   LPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSELLQ
FT                   SATFVLAVAANMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYH
FT                   SGFSYFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG"
FT   gene            complement(256006..256530)
FT                   /locus_tag="Z0257"
FT   CDS_pept        complement(256006..256530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0257"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54526"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1J6"
FT                   /protein_id="AAG54526.1"
FT                   /translation="MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSE
FT                   ITVTLLTEPDTNTNAEGESAAVDVQLVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDH
FT                   QDFNLLPDTIKTLPPIKLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVR
FT                   QSSIEMKKEDE"
FT   gene            complement(256527..257828)
FT                   /locus_tag="Z0258"
FT   CDS_pept        complement(256527..257828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0258"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54527"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U8"
FT                   /protein_id="AAG54527.1"
FT                   /translation="MIITEQNMPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHA
FT                   PECHWSVQDRQQSIPAQAFTVILHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEI
FT                   QIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLA
FT                   DTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIY
FT                   ASPGDHNDDISAAEMAQRHLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGL
FT                   LDLQQQRNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNV
FT                   RHHEEANRAAIVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEE
FT                   LASDRQQGFEMLFNEVYAQVYDRVLREKQREPEA"
FT   gene            complement(257832..258914)
FT                   /locus_tag="Z0259"
FT   CDS_pept        complement(257832..258914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0259"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54528"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1N7"
FT                   /protein_id="AAG54528.1"
FT                   /translation="MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAEL
FT                   LHRLAKGEKGTPELSLRDDPAQETLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMG
FT                   LQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSHRLTQFVWHIWRKYRYHISFRNGG
FT                   VDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEIICGLVSHCFDLSE
FT                   VTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSIT
FT                   SLTRKQFLSFLPSGENFLPLTTFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLG
FT                   WTSFLGTPEERPSVTIRVRS"
FT   gene            complement(258878..260728)
FT                   /locus_tag="Z0260"
FT   CDS_pept        complement(258878..260728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0260"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54529"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1M4"
FT                   /protein_id="AAG54529.1"
FT                   /translation="MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERL
FT                   LEGVAFLTGNLRQKIEDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLI
FT                   PRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGV
FT                   INITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGADLTVGEQHIRLP
FT                   EFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEFF
FT                   TLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQH
FT                   YDVFSVNSVVSQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRT
FT                   KTSLFHRGFDHTLAFIHADGSYPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTG
FT                   KNAAVASFRNITRPTQPLWPVIDGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAI
FT                   HHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTV
FT                   LSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI"
FT   gene            complement(260732..261145)
FT                   /locus_tag="Z0261"
FT   CDS_pept        complement(260732..261145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0261"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54530"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C200"
FT                   /protein_id="AAG54530.1"
FT                   /translation="MILDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILN
FT                   TRSGSCRGAPELGIDEPEGAENFRESMSRAIEQCIERYEPRISHAEVQAVVSSASSPLD
FT                   MTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD"
FT   gene            complement(261236..262627)
FT                   /locus_tag="Z0262"
FT   CDS_pept        complement(261236..262627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0262"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 3 to 463 of 463 are 41.37 pct identical to
FT                   residues 1 to 464 of 495 from GenPept 118 :
FT                   gi|2708666|gb|AAB92576.1| (AF037441) putative 54.5 kDa
FT                   protein [Edwardsiella ictaluri]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54531"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C269"
FT                   /protein_id="AAG54531.1"
FT                   /translation="MSLQEEELVSSHAGQPEQESSLLDQIMAQTRIQPGSEGYDVARQG
FT                   VTAFIASILQSTASAEPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKT
FT                   MVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVL
FT                   GAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGP
FT                   AYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNTA
FT                   WMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREF
FT                   ELAEEGFITLTMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAH
FT                   YIKVLQREQLGSWKERSDLERELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEG
FT                   EPGWY"
FT   gene            complement(262678..262902)
FT                   /locus_tag="Z0263"
FT   CDS_pept        complement(262678..262902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0263"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDH4"
FT                   /protein_id="AAG54532.1"
FT                   /translation="MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTL
FT                   DRRISDLLDEIIHFCEFQQSASHWQRVLH"
FT   gene            complement(262937..263437)
FT                   /locus_tag="Z0264"
FT   CDS_pept        complement(262937..263437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0264"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 166 of 166 are 99.39 pct identical to
FT                   residues 1 to 166 of 166 from GenPept 118 :
FT                   gi|2920642|gb|AAC32477.1| (AF044503) unknown [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54533"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3H4"
FT                   /protein_id="AAG54533.1"
FT                   /translation="MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNT
FT                   QETSSLDERQAVSVNKHNFGAVMAEAAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDF
FT                   SPDSVARQVPEVNKLLELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQV
FT                   SNK"
FT   gene            263864..264007
FT                   /locus_tag="Z0265"
FT   CDS_pept        263864..264007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0265"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54534"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3V3"
FT                   /protein_id="AAG54534.1"
FT                   /translation="MIQLWPFYGGNTDFEQLGMAIQIYIIKLLLNKRFNDFKNSFYDNR
FT                   KF"
FT   gene            264134..264652
FT                   /locus_tag="Z0266"
FT   CDS_pept        264134..264652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0266"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 172 of 172 are 100.00 pct identical to
FT                   residues 1 to 172 of 172 from GenPept 118 :
FT                   gi|2920641|gb|AAC32476.1| (AF044503) hcp [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54535"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1J2"
FT                   /protein_id="AAG54535.1"
FT                   /translation="MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFL
FT                   HNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVE
FT                   GKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGA
FT                   DDWRAPLEA"
FT   gene            264862..267003
FT                   /locus_tag="Z0267"
FT   CDS_pept        264862..267003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0267"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function (Rhs Element Associated)"
FT                   /note="Residues 1 to 713 of 713 are 98.73 pct identical to
FT                   residues 1 to 713 of 713 from GenPept 118 :
FT                   gi|2920640|gb|AAC32475.1| (AF044503) VgrG protein
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54536"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A109YQR5"
FT                   /protein_id="AAG54536.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLALSLVSQQF
FT                   LSLEFQQILDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIASILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVLYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTT
FT                   LDNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQILNIGVNQIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
FT   gene            267079..271293
FT                   /locus_tag="Z0268"
FT   CDS_pept        267079..271293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0268"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function (Rhs Element Associated)"
FT                   /note="Residues 1 to 1264 of 1404 are 93.31 pct identical
FT                   to residues 1 to 1270 of 1420 from GenPept 118 :
FT                   gi|2920634|gb|AAC32471.1| (AF044501) core protein
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54537"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2U013"
FT                   /protein_id="AAG54537.1"
FT                   /translation="MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITY
FT                   ANPVNPVLGAKVLPGETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRL
FT                   QIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESFWLARGGVAEQHSSQPLSALWQVLP
FT                   EDVRLSPHMYLATNSLQGPWWILNWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAF
FT                   HRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLV
FT                   FPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGT
FT                   QVRGFAYDAEHAGRMVAHHYAGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTIT
FT                   DSLNRREVLYTEGEGGLKRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMA
FT                   SGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPDGLRSSREYDEKGRLAAETSRSGETTRY
FT                   SYDDPASELPTGIQDATGSTKQMAWSRYGQLLTFTDCSGYTTRYEYDRYGQQIAVHREE
FT                   GISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVST
FT                   TQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKL
FT                   TQSEDEGLVTLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGY
FT                   DDKGRLTGERQTVENPETGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLA
FT                   GMKLGGTPLVEYMRDRLHRETARSFGGEAYELATAWNTSGQLRSRHLNLPQLDRDYDWN
FT                   DNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPELHPDS
FT                   TLTAWPDNRIAEDAHYVYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHYDSQHRLVFH
FT                   TRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTV
FT                   QTQQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGR
FT                   LERELRQGSVSEESQQWLAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPLALISP
FT                   EGETAWQGEYDEWGNLLGETSAQHLQQSLRLPGQQYDEESGLYYNRNRYYDPLQGRYIT
FT                   QDPIGLEGGWNLYQYPLNPIEHIDPLGLALDLNYYSPSDPIYKGSLNVREFPTGFTVGG
FT                   HGSPTSMSDDRIKKGSDLTIKQLASDIRANPKYHEGMPVVLFSCETGKGKNSFAQKLAN
FT                   ELDATVIAPDEIIWIWPDGNYAIMGQTARITIGGKDNGVFELVPDEKQPGDFHKFTPTG
FT                   SK"
FT   gene            271296..271907
FT                   /locus_tag="Z0269"
FT   CDS_pept        271296..271907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0269"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function (Rhs Element Associated)"
FT                   /note="Residues 76 to 184 of 203 are 31.62 pct identical to
FT                   residues 15 to 129 of 327 from GenPept 118 :
FT                   gi|1786864|gb|AAC73745.1| (AE000169) orf, hypothetical
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54538"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDF7"
FT                   /protein_id="AAG54538.1"
FT                   /translation="MKVFTFLLIIMVCLYNFGVRAAMDNSKHSDEAEKLLAELSARKGE
FT                   GEGEGEGEGEGEGEGEPKSTVSVFYLQPEEVNTLSHQAKRGDGEAGFRLFLYYKLSNYD
FT                   EEKSSQWLKIAANNGHATAQYRLYVELQEQGETKEANEWLQKIKLAASNNDSSAIWFLV
FT                   NCYKNQGNKKEALQWAYKLKASKQPLDADRLIEELTKEQK"
FT   gene            272653..273789
FT                   /locus_tag="Z0271"
FT   CDS_pept        272653..273789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0271"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function (Rhs Element Associated)"
FT                   /note="Residues 1 to 378 of 378 are 97.61 pct identical to
FT                   residues 1 to 378 of 378 from GenPept 118 :
FT                   gi|1789896|gb|AAC76509.1| (AE000424) putative receptor
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54539"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TVC3"
FT                   /protein_id="AAG54539.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHLDFLRQYGDFENAIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAPPELLNILD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCEVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPKMTV
FT                   RYYISSADLTAGKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
FT   gene            273792..275552
FT                   /locus_tag="Z0272"
FT   CDS_pept        273792..275552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0272"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function (Rhs Element Associated)"
FT                   /note="Residues 4 to 586 of 586 are 89.89 pct identical to
FT                   residues 99 to 682 of 682 from GenPept 118 :
FT                   gi|1787728|gb|AAC74538.1| (AE000242) rhsE protein in rhs
FT                   element [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54540"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TV77"
FT                   /protein_id="AAG54540.1"
FT                   /translation="MPWLHRETARSFGGAGSTAGYEQVTAYTLTGQLQSRHLNLPQLDC
FT                   DYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPE
FT                   LHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLTEKTDRIPEGVIRMHDERTHHYHYDNQH
FT                   RLVFYTRIQYGEPLVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEVTWYGWDGD
FT                   RLTTVQTGTTRIQTVYRPGSFTPLIRIETENGEREKAQRRSLAEKLQQEGSEDGHGVVF
FT                   PAELVRMLDRLEEEIRADRVSSESRAWLAQCGLTVEQLEKQVEPEYTPARTLHLYHCDH
FT                   RGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQHDEESGLYYNRHRY
FT                   YDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGVPGL
FT                   IVANSITNSAYQFGYDMDAIVGGAHNGAADAMRYCYLMCRMTKTFGSTIADVIGKNHEA
FT                   AGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNIGQLFGLDGIKADNPIKA
FT                   KQGSSDASNY"
FT   gene            complement(275640..275777)
FT                   /locus_tag="Z0273"
FT   CDS_pept        complement(275640..275777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0273"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function (Rhs Element Associated)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54541"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3V2"
FT                   /protein_id="AAG54541.1"
FT                   /translation="MRLVIINHYTYKMTIPSTNFLVINYFINNIFSERYISTLFGVLCP
FT                   "
FT   gene            275754..276017
FT                   /locus_tag="Z0274"
FT   CDS_pept        275754..276017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0274"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function (Rhs Element Associated)"
FT                   /note="Residues 1 to 87 of 87 are 98.85 pct identical to
FT                   residues 74 to 160 of 160 from GenPept 118 :
FT                   gi|1787729|gb|AAC74539.1| (AE000242) orf, hypothetical
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1L0"
FT                   /protein_id="AAG54542.1"
FT                   /translation="MVNNYKTHCGVVDINLNFFNDILYSVRLKNISKLENMEFCATKQR
FT                   VYFSDKNKKASYKIINYGDYYDVDYYDNNLKNEVFDWIGKWS"
FT   gene            276198..277370
FT                   /locus_tag="Z0275"
FT   CDS_pept        276198..277370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0275"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function (Rhs Element Associated)"
FT                   /note="Residues 1 to 246 of 390 are 98.37 pct identical to
FT                   residues 1 to 246 of 248 from GenPept 118 :
FT                   gi|1787731|gb|AAC74540.1| (AE000243) orf, hypothetical
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54543"
FT                   /db_xref="GOA:Q8X7R5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7R5"
FT                   /protein_id="AAG54543.1"
FT                   /translation="MSIQSLLDYISVIPDIRQQGKVKHKLSDILFLTVCAVIAGADEWQ
FT                   EIEDFGHERLEWLKKYGDFDNGIPVDDTIARVVSNIDSLAFEKIFIEWMQECHEITDGE
FT                   IIAIDGKTIRGSFDKGKRKGAIHMVSAFSNENGVVLGQVKTEAKSNEITAIPELLNLLD
FT                   LKKNLITIDAMGCQKDIASKIKDKKADYLLAVKGNQGKLHHAFEEKFPVNVFSNYKGDS
FT                   FSTQEISHGRKETRLHIVSNVTPEFCDFEFEWKGLKKLCVALSFRQKKEDKSAEGVSIR
FT                   YYISSKDMDAKEFAHAIRAHWLIEHSLHWVLDVKMNEDASRIRRGNAAEIISGIKKMAL
FT                   NLLRDCKDIKGGVKRKRKKVALNTCYIEEVLASCSELGFRTDKMKNLTQI"
FT   gene            complement(277488..278258)
FT                   /gene="yafV"
FT                   /locus_tag="Z0276"
FT   CDS_pept        complement(277488..278258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="Z0276"
FT                   /product="putative EC 3.5. amidase-type enzyme"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 255 of 256 are 98.82 pct identical to
FT                   residues 1 to 255 of 256 from Escherichia coli K-12 Strain
FT                   MG1655: B0219"
FT                   /db_xref="EnsemblGenomes-Gn:Z0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54544"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C209"
FT                   /protein_id="AAG54544.1"
FT                   /translation="MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFT
FT                   SGFAMEAAASSLAQDDVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHF
FT                   YDKRHLFRMADEHLHYKAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLAIYVA
FT                   NWPAPRSLHWQALLTARAIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADA
FT                   HQATRIDAELSMVALREYREKFPAWRDADEFRLR"
FT   gene            278412..278885
FT                   /gene="ykfE"
FT                   /locus_tag="Z0277"
FT   CDS_pept        278412..278885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfE"
FT                   /locus_tag="Z0277"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 157 of 157 are 100.00 pct identical to
FT                   residues 1 to 157 of 157 from Escherichia coli K-12 Strain
FT                   MG1655: B0220"
FT                   /db_xref="EnsemblGenomes-Gn:Z0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54545"
FT                   /db_xref="GOA:P0AD60"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD60"
FT                   /protein_id="AAG54545.1"
FT                   /translation="MGRISSGGMMFKAITTVAALVIATSAMAQDDLTISSLAKGETTKA
FT                   AFNQMVQGHKLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSN
FT                   QMTGLFSTIDEKTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK"
FT   gene            complement(278928..281408)
FT                   /gene="yafH"
FT                   /locus_tag="Z0278"
FT   CDS_pept        complement(278928..281408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafH"
FT                   /locus_tag="Z0278"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /function="putative enzyme; Not classified"
FT                   /EC_number="1.3.99.-"
FT                   /note="Residues 1 to 826 of 826 are 99.63 pct identical to
FT                   residues 1 to 826 of 826 from Escherichia coli K-12 Strain
FT                   MG1655: B0221"
FT                   /db_xref="EnsemblGenomes-Gn:Z0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54546"
FT                   /db_xref="GOA:Q8X7R2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7R2"
FT                   /protein_id="AAG54546.1"
FT                   /translation="MVRPPTSKGLFVMMILSILATVVLLGALFYHRVSLFISSLILLAW
FT                   TAALGVAGLWSAWVLVPLAIILVPFNFAPMRKSMISAPVFRGFRKVMPPMSRTEKEAID
FT                   AGTTWWEGDLFQGKPDWKKLHNYPQPRLTAEEQAFLDGPVEEACRMANDFQITHELADL
FT                   PPELWAYLKEHRFFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPG
FT                   ELLQHYGTDEQKDHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGIVCMGEWQGQQVL
FT                   GMRLTWNKRYITLAPIATVLGLAFKLSDPEKLLGGAEDLGITCALIPTTTPGVEIGRRH
FT                   FPLNVPFQNGPTLGKDVFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVK
FT                   SVALATGAYAHIRRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAV
FT                   LSAIVKYHCTHRGQQSIIDAMDITGGKGIMLGQSNFLARAYQGAPIAITVEGANILTRS
FT                   MMIFGQGAIRCHPYVLEEMEAAKNNDVNVFDKLLFKHIGHVGSNKVRSFWLGLTRGLTS
FT                   STPTGDATKRYYQHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDILSQLYLASA
FT                   VLKRYDDEGRNEADLPLVHWGVQDALYQAEQAMDDLLQNFPNRVVAGLLNVVIFPTGRH
FT                   YLAPSDKLDHKVAKILQVPNATRSRIGRGQYLTPSEHNPVGLLEEALVDVIAADPIHQR
FT                   ICKELGKNLPFTRLDELAHNALAKGLIDKDEAAILVKAEESRLRSINVDDFDPEELATK
FT                   PVKLPEKVRKVEAA"
FT   gene            281612..282190
FT                   /gene="gmhA"
FT                   /locus_tag="Z0280"
FT   CDS_pept        281612..282190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="Z0280"
FT                   /product="phosphoheptose isomerase"
FT                   /function="enzyme; Cell exterior constituents: Surface
FT                   polysaccharides and antigens"
FT                   /note="Residues 1 to 192 of 192 are 100.00 pct identical to
FT                   residues 1 to 192 of 192 from Escherichia coli K-12 Strain
FT                   MG1655: B0222"
FT                   /db_xref="EnsemblGenomes-Gn:Z0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54547"
FT                   /db_xref="GOA:P63225"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63225"
FT                   /protein_id="AAG54547.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRY
FT                   VEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   gene            282295..283062
FT                   /gene="yafJ"
FT                   /locus_tag="Z0281"
FT   CDS_pept        282295..283062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="Z0281"
FT                   /product="putative amidotransferase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 255 of 255 are 99.21 pct identical to
FT                   residues 1 to 255 of 255 from Escherichia coli K-12 Strain
FT                   MG1655: B0223"
FT                   /db_xref="EnsemblGenomes-Gn:Z0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54548"
FT                   /db_xref="GOA:A0A4Q0C1K2"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1K2"
FT                   /protein_id="AAG54548.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGKTDSEKAFCWLLYKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
FT   gene            complement(283033..283773)
FT                   /gene="yafK"
FT                   /locus_tag="Z0282"
FT   CDS_pept        complement(283033..283773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="Z0282"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 246 of 246 are 100.00 pct identical to
FT                   residues 1 to 246 of 246 from Escherichia coli K-12 Strain
FT                   MG1655: B0224"
FT                   /db_xref="EnsemblGenomes-Gn:Z0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54549"
FT                   /db_xref="GOA:P0AAA0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA0"
FT                   /protein_id="AAG54549.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYV
FT                   VSKPLSHEVVQPQLASNYTLPEAK"
FT   gene            complement(283929..284132)
FT                   /locus_tag="Z0284"
FT   CDS_pept        complement(283929..284132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0284"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 67 of 67 are 100.00 pct identical to
FT                   residues 26 to 92 of 92 from Escherichia coli K-12 Strain
FT                   MG1655: B0225"
FT                   /db_xref="EnsemblGenomes-Gn:Z0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54550"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q7"
FT                   /protein_id="AAG54550.1"
FT                   /translation="MNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWIL
FT                   IYKLTDKLLRFERTGTHAALFG"
FT   gene            complement(284208..284468)
FT                   /gene="dinJ"
FT                   /locus_tag="Z0285"
FT   CDS_pept        complement(284208..284468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="Z0285"
FT                   /product="damage-inducible protein J"
FT                   /function="phenotype; Not classified"
FT                   /note="Residues 1 to 86 of 86 are 97.67 pct identical to
FT                   residues 1 to 86 of 86 from Escherichia coli K-12 Strain
FT                   MG1655: B0226"
FT                   /db_xref="EnsemblGenomes-Gn:Z0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54551"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1L6"
FT                   /protein_id="AAG54551.1"
FT                   /translation="MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREK
FT                   ALPFDLREPNQLTIQSIKNSEAGVDVHKAKDADDLFDKLGV"
FT   gene            284678..285427
FT                   /gene="yafL"
FT                   /locus_tag="Z0287"
FT   CDS_pept        284678..285427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafL"
FT                   /locus_tag="Z0287"
FT                   /product="putative lipoprotein"
FT                   /function="putative membrane; Not classified"
FT                   /note="Residues 1 to 249 of 249 are 98.39 pct identical to
FT                   residues 1 to 249 of 249 from Escherichia coli K-12 Strain
FT                   MG1655: B0227"
FT                   /db_xref="EnsemblGenomes-Gn:Z0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54552"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCA1"
FT                   /protein_id="AAG54552.1"
FT                   /translation="MSLPSIPSFVLSGLLLICLPFSSFASATTSHISFSYAARQRMQNR
FT                   ARLLKQYQTHLKKQVSYIVEGNAESRRALRQHNREQIKQHPEWFPAPLKASDRRWQALA
FT                   ENNHFLSSDHLHNITEVAIHRLEQQLGKPYVWGGTRPDKGFDCSGLVFYAYNKILEAKL
FT                   PRTANEMYHYHRATIVANNDLRRGDLLFFHIHSREIADHMGVYLGDGQFIESPRTGETI
FT                   RVSRLAEPFWQDHFLGARRILTEETIL"
FT   gene            285603..285899
FT                   /gene="yafM"
FT                   /locus_tag="Z0288"
FT   CDS_pept        285603..285899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="Z0288"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 98 of 98 are 93.87 pct identical to
FT                   residues 1 to 98 of 165 from Escherichia coli K-12 Strain
FT                   MG1655: B0228"
FT                   /db_xref="EnsemblGenomes-Gn:Z0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54553"
FT                   /db_xref="GOA:A0A2Z5XFJ4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5XFJ4"
FT                   /protein_id="AAG54553.1"
FT                   /translation="MSEYRRYYIKGGTWFFTVNLRNRRSHLLTAQFQMLRNAIINVKRD
FT                   RPFEINAWVVLPEHMHCIWTLPESDDDFSSRWREIKKQFTHACGLKNIWQPRF"
FT   gene            complement(286245..287984)
FT                   /gene="fhiA"
FT                   /locus_tag="Z0290"
FT   CDS_pept        complement(286245..287984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhiA"
FT                   /locus_tag="Z0290"
FT                   /product="flagellar biosynthesis"
FT                   /function="putative enzyme; Cell exterior constituents:
FT                   Surface structures"
FT                   /note="Residues 1 to 578 of 579 are 98.96 pct identical to
FT                   residues 1 to 578 of 579 from Escherichia coli K-12 Strain
FT                   MG1655: B0229"
FT                   /db_xref="EnsemblGenomes-Gn:Z0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54554"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1P3"
FT                   /protein_id="AAG54554.1"
FT                   /translation="MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKQPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSS
FT                   MAPRLAEDLSAALNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNVVNQAQQGGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALS"
FT   gene            287929..288714
FT                   /gene="mbhA"
FT                   /locus_tag="Z0291"
FT   CDS_pept        287929..288714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="Z0291"
FT                   /product="putative motility protein"
FT                   /function="putative structure; Not classified"
FT                   /note="Residues 1 to 261 of 261 are 99.23 pct identical to
FT                   residues 1 to 261 of 261 from Escherichia coli K-12 Strain
FT                   MG1655: B0230"
FT                   /db_xref="EnsemblGenomes-Gn:Z0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54555"
FT                   /db_xref="GOA:A0A0H3JBT7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBT7"
FT                   /protein_id="AAG54555.1"
FT                   /translation="MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHP
FT                   PKPATVAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHMEANLEMEIV
FT                   PQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKN
FT                   NIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSAGNRRIEIMV
FT                   LTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR"
FT   gene            288785..289840
FT                   /gene="dinP"
FT                   /locus_tag="Z0292"
FT   CDS_pept        288785..289840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="Z0292"
FT                   /product="damage-inducible protein P; putative tRNA
FT                   synthetase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 351 of 351 are 98.86 pct identical to
FT                   residues 1 to 351 of 351 from Escherichia coli K-12 Strain
FT                   MG1655: B0231"
FT                   /db_xref="EnsemblGenomes-Gn:Z0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54556"
FT                   /db_xref="GOA:Q8X7Q1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7Q1"
FT                   /protein_id="AAG54556.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDE
FT                   AYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVTPVKFLAKIASDMNKPNGQFV
FT                   ITPAEVSAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVILLKRFGKFGRIL
FT                   WERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDL
FT                   LIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLD
FT                   PQMERQLVLGL"
FT   gene            289892..290185
FT                   /gene="yafN"
FT                   /locus_tag="Z0293"
FT   CDS_pept        289892..290185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafN"
FT                   /locus_tag="Z0293"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 97 of 97 are 98.96 pct identical to
FT                   residues 1 to 97 of 97 from Escherichia coli K-12 Strain
FT                   MG1655: B0232"
FT                   /db_xref="EnsemblGenomes-Gn:Z0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54557"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C288"
FT                   /protein_id="AAG54557.1"
FT                   /translation="MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASA
FT                   FEALMDMLAEQEEKKPIKARFRPSAARLEEITRRAEKYLNDMTDDDFNDFKE"
FT   gene            290188..290586
FT                   /gene="yafO"
FT                   /locus_tag="Z0294"
FT   CDS_pept        290188..290586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafO"
FT                   /locus_tag="Z0294"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 132 of 132 are 98.48 pct identical to
FT                   residues 1 to 132 of 132 from Escherichia coli K-12 Strain
FT                   MG1655: B0233"
FT                   /db_xref="EnsemblGenomes-Gn:Z0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54558"
FT                   /db_xref="InterPro:IPR020353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDH6"
FT                   /protein_id="AAG54558.1"
FT                   /translation="MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYD
FT                   DSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRTNDESHLVYCQGAFDEQAWLLIAIL
FT                   KPEPHKLARDNNQMHKIGKMAEAFRMRF"
FT   gene            290596..291048
FT                   /gene="yafP"
FT                   /locus_tag="Z0295"
FT   CDS_pept        290596..291048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="Z0295"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 150 of 150 are 95.99 pct identical to
FT                   residues 1 to 150 of 150 from Escherichia coli K-12 Strain
FT                   MG1655: B0234"
FT                   /db_xref="EnsemblGenomes-Gn:Z0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54559"
FT                   /db_xref="GOA:A0A4Q0C3J2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3J2"
FT                   /protein_id="AAG54559.1"
FT                   /translation="MNNIQIRNYQPGDFQQLCAIFIRAVMMTASQHYSPQQIAAWAQID
FT                   ESRWKEKLAKSQVRVAVINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPWIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFSMRYKPQH"
FT   gene            291355..291621
FT                   /locus_tag="Z0296"
FT   CDS_pept        291355..291621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0296"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 88 of 88 are 98.86 pct identical to
FT                   residues 1 to 88 of 88 from Escherichia coli K-12 Strain
FT                   MG1655: B0235"
FT                   /db_xref="EnsemblGenomes-Gn:Z0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54560"
FT                   /db_xref="GOA:Q8X7P0"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7P0"
FT                   /protein_id="AAG54560.1"
FT                   /translation="MEWYMGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQR
FT                   VVGMPDLHPGRGYPIGAAFFSVGRFYPTRRRGNGAGNRNGPLL"
FT   gene            291590..292090
FT                   /gene="prfH"
FT                   /locus_tag="Z0297"
FT   CDS_pept        291590..292090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="Z0297"
FT                   /product="probable peptide chain release factor"
FT                   /function="factor; Macromolecule synthesis, modification:
FT                   Proteins - translation and modification"
FT                   /note="Residues 1 to 166 of 166 are 96.98 pct identical to
FT                   residues 1 to 166 of 166 from Escherichia coli K-12 Strain
FT                   MG1655: B0236"
FT                   /db_xref="EnsemblGenomes-Gn:Z0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54561"
FT                   /db_xref="GOA:A0A384LBB6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LBB6"
FT                   /protein_id="AAG54561.1"
FT                   /translation="MLETETGRYSDTLRSALISLDGDNAWALSESWCGTIQWICLSPYR
FT                   PHHGRKNWFLGIGRFTADEQEQSDAIRYETLRPSGPGGQHVNKTDSAVRATHLATGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAVLKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
FT   gene            complement(292147..293604)
FT                   /gene="pepD"
FT                   /locus_tag="Z0298"
FT   CDS_pept        complement(292147..293604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="Z0298"
FT                   /product="aminoacyl-histidine dipeptidase (peptidase D)"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of proteins, peptides, glyco"
FT                   /note="Residues 1 to 485 of 485 are 99.58 pct identical to
FT                   residues 1 to 485 of 485 from Escherichia coli K-12 Strain
FT                   MG1655: B0237"
FT                   /db_xref="EnsemblGenomes-Gn:Z0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54562"
FT                   /db_xref="GOA:A0A4Q0C2W9"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2W9"
FT                   /protein_id="AAG54562.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEYIVGWAKEKGF
FT                   HVERDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNNDTVHDFTKDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADENVVHGPLEVLLTMTEEAGMDGAFGLQSNWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLHLDREAVPAGFETFKLTLKGLKGGHSGGEIHV
FT                   GLGNANKLLVRFLAGHAEELDLRLIDFNGGTLRNAIPREAFATIAVAADKVDALKSLVN
FT                   TYQEILKNELAEKEKNLALLLDSVANDKAALIAKSRDTFIRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMTDNNVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKEIPAK"
FT   gene            293865..294323
FT                   /gene="gpt"
FT                   /locus_tag="Z0299"
FT   CDS_pept        293865..294323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="Z0299"
FT                   /product="guanine-hypoxanthine phosphoribosyltransferase"
FT                   /function="enzyme; Central intermediary metabolism: Salvage
FT                   of nucleosides and nucleotides"
FT                   /note="Residues 1 to 152 of 152 are 100.00 pct identical to
FT                   residues 1 to 152 of 152 from Escherichia coli K-12 Strain
FT                   MG1655: B0238"
FT                   /db_xref="EnsemblGenomes-Gn:Z0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54563"
FT                   /db_xref="GOA:P0A9M6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9M6"
FT                   /protein_id="AAG54563.1"
FT                   /translation="MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR"
FT   gene            294415..295659
FT                   /gene="yafA"
FT                   /locus_tag="Z0300"
FT   CDS_pept        294415..295659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafA"
FT                   /locus_tag="Z0300"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 414 of 414 are 99.03 pct identical to
FT                   residues 1 to 414 of 414 from Escherichia coli K-12 Strain
FT                   MG1655: B0239"
FT                   /db_xref="EnsemblGenomes-Gn:Z0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54564"
FT                   /db_xref="GOA:Q8X7N7"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7N7"
FT                   /protein_id="AAG54564.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSCLLHQRVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGXQEITDWIEKRLC"
FT   gene            295717..296118
FT                   /gene="crl"
FT                   /locus_tag="Z0301"
FT   CDS_pept        295717..296118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="Z0301"
FT                   /product="transcriptional regulator of cryptic csgA gene
FT                   for curli surface fibers"
FT                   /function="regulator; Cell exterior constituents: Surface
FT                   structures"
FT                   /note="Residues 1 to 133 of 133 are 98.49 pct identical to
FT                   residues 1 to 133 of 133 from Escherichia coli K-12 Strain
FT                   MG1655: B0240"
FT                   /db_xref="EnsemblGenomes-Gn:Z0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54565"
FT                   /db_xref="GOA:Q8X7N6"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7N6"
FT                   /protein_id="AAG54565.1"
FT                   /translation="MTLPSGHPKSRLIKKFTVLGPYIREGKCEDNRFFFDCLAVCVNVK
FT                   PAPEVREFWGWWMELEAQESRFTYSYQFGLFDKAGDWKSVPVKDTEVVERLEHTLREFH
FT                   EKLRELLTTLNLKLEPADDFRDEPVKLTA"
FT   gene            complement(296157..297212)
FT                   /gene="phoE"
FT                   /locus_tag="Z0302"
FT   CDS_pept        complement(296157..297212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="Z0302"
FT                   /product="outer membrane pore protein E (E,Ic,NmpAB)"
FT                   /function="membrane; Cell envelop: Outer membrane
FT                   constituents"
FT                   /note="Residues 1 to 351 of 351 are 99.71 pct identical to
FT                   residues 1 to 351 of 351 from Escherichia coli K-12 Strain
FT                   MG1655: B0241"
FT                   /db_xref="EnsemblGenomes-Gn:Z0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54566"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Q3"
FT                   /protein_id="AAG54566.1"
FT                   /translation="MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNDSKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DIVAVGMTYQF"
FT   gene            297500..298603
FT                   /gene="proB"
FT                   /locus_tag="Z0303"
FT   CDS_pept        297500..298603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="Z0303"
FT                   /product="gamma-glutamate kinase"
FT                   /function="enzyme; Amino acid biosynthesis: Proline"
FT                   /note="Residues 1 to 367 of 367 are 100.00 pct identical to
FT                   residues 1 to 367 of 367 from Escherichia coli K-12 Strain
FT                   MG1655: B0242"
FT                   /db_xref="EnsemblGenomes-Gn:Z0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54567"
FT                   /db_xref="GOA:P0A7B7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7B7"
FT                   /protein_id="AAG54567.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQEIDAILGYEYGPVAVHRDDMITR"
FT   gene            298615..299868
FT                   /gene="proA"
FT                   /locus_tag="Z0304"
FT   CDS_pept        298615..299868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="Z0304"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /function="enzyme; Amino acid biosynthesis: Proline"
FT                   /note="Residues 1 to 417 of 417 are 98.80 pct identical to
FT                   residues 1 to 417 of 417 from Escherichia coli K-12 Strain
FT                   MG1655: B0243"
FT                   /db_xref="EnsemblGenomes-Gn:Z0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54568"
FT                   /db_xref="GOA:Q8X7N4"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7N4"
FT                   /protein_id="AAG54568.1"
FT                   /translation="MLEQMGIAAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNA
FT                   NAQDVADARANGLSEAMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGGVLDSGLR
FT                   LERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVVVIQDAL
FT                   KSCGLPAGAVQAIDNPDRALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIYVDESAEIAEALKVIVNAKTQRPSTCNTVETLLVNKNIAYSFLPALSKQMAESG
FT                   VTLHADASALAQLQTGPAKVVAVKAEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQH
FT                   SDAILTRDMRNAQRFVNEVDSSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGL
FT                   EALTTYKWIGIGDYTIRA"
FT   gene            299983..300058
FT                   /gene="thrW"
FT                   /locus_tag="Z0305"
FT   tRNA            299983..300058
FT                   /gene="thrW"
FT                   /locus_tag="Z0305"
FT                   /product="tRNA-Thr"
FT                   /function="RNA; tRNA"
FT                   /note="anticodon: CGT"
FT   misc_feature    300060..323540
FT                   /note="O-island #8; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   misc_feature    300060..310645
FT                   /note="Cryptic prophage CP-933H; includes one copy of the
FT                   47bp direct repeat that flanks the prophage"
FT   gene            complement(300073..301047)
FT                   /gene="intH"
FT                   /locus_tag="Z0307"
FT   CDS_pept        complement(300073..301047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intH"
FT                   /locus_tag="Z0307"
FT                   /product="putative integrase for prophage CP-933H"
FT                   /function="putative enzyme; Integration, recombination
FT                   (Phage or Prophage Related)"
FT                   /note="Residues 19 to 324 of 324 are 97.71 pct identical to
FT                   residues 82 to 387 of 387 from GenPept 118 :
FT                   gi|2465477|gb|AAB72135.1| (U82619) integrase [Shigella
FT                   flexneri bacteriophage V]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54569"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1RTJ9"
FT                   /protein_id="AAG54569.1"
FT                   /translation="MHKHAAANVAQRNRLNGKQIGFWLQHFAGMQLRDITESKIYSAMQ
FT                   KMTNRRHEENWKLRAEACRKKGKPVPEYTPKPASVATKATHLSFIKALLRAAEREWKML
FT                   DKAPIIKVPQPKNKRLRWLEPHEAQRLIDECPEPLKSVVEFALATGLRRSNIINLEWQQ
FT                   IDMQRRVAWINPEESKSNRAIGVALNDTACRVLKKQIGNHHRWVFVYKESCTKPDGTKA
FT                   PTVRKMRYDANTAWKAALRRAGIDDFRFHDLRHTWASWLVQAGVPLSVLQEMGGWESIE
FT                   MVRRYAHLAPNHLTEHARQIDSILNPSVPNLSQSKNKEGTNDV"
FT   gene            complement(301423..301812)
FT                   /locus_tag="Z0308"
FT   CDS_pept        complement(301423..301812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0308"
FT                   /product="unknown protein from prophage CP-933H"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 2 to 110 of 129 are 36.93 pct identical to
FT                   residues 3 to 96 of 224 from GenPept 118 :
FT                   gi|2314514|gb|AAD08389.1| (AE000635) H. pylori predicted
FT                   coding region HP1334 [Helicobacter pylori 26695]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TV51"
FT                   /protein_id="AAG54570.1"
FT                   /translation="MKKAAILIDAGFFMQRVHATHRKHFAEHELTAQCIMKVIWSMVLS
FT                   HLNGKRQSQERREPLELYRIYFYDCPPLDIQTRLPLPEPGNKTPGRKNFKLEKSYILRT
FT                   ELHEELRKTRKTPIVFILKLIGATH"
FT   gene            complement(301940..302653)
FT                   /locus_tag="Z0309"
FT   CDS_pept        complement(301940..302653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0309"
FT                   /product="putative cI repressor protein for prophage
FT                   CP-933H"
FT                   /function="putative regulator; Regulation (Phage or
FT                   Prophage Related)"
FT                   /note="Residues 1 to 237 of 237 are 99.15 pct identical to
FT                   residues 1 to 237 of 237 from GenPept 118 :
FT                   gi|6901592|gb|AAF31095.1|AF069529_8 (AF069529) prophage
FT                   repressor CI [Bacteriophage HK97]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54571"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TZM3"
FT                   /protein_id="AAG54571.1"
FT                   /translation="MSAKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
FT                   SGVGALFNGINALNAYNAALLAKILNVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
FT                   PVFSHVQAGMFSPELRTFTKGDAEKWVSTTKKASGSAFWLEVEGNSMTAPTGSKPSFPD
FT                   GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV
FT                   VGKVIASQWPEETFG"
FT   gene            303073..303366
FT                   /locus_tag="Z0310"
FT   CDS_pept        303073..303366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0310"
FT                   /product="putative cII antiterminator protein for prophage
FT                   CP-933H"
FT                   /function="putative regulator; Regulation (Phage or
FT                   Prophage Related)"
FT                   /note="Residues 1 to 97 of 97 are 100.00 pct identical to
FT                   residues 1 to 97 of 97 from GenPept 118 :
FT                   gi|215149|gb|AAA96583.1| (J02459) cII (antitermination;119)
FT                   [bacteriophage lambda]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54572"
FT                   /db_xref="InterPro:IPR007933"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TV36"
FT                   /protein_id="AAG54572.1"
FT                   /translation="MVRANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKR
FT                   DWIPKFSMLLAVLEWGVVDDDMARLARQVAAILTNKKRPAATERSEQIQMEF"
FT   gene            303399..304007
FT                   /locus_tag="Z0311"
FT   CDS_pept        303399..304007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0311"
FT                   /product="partial O replication protein for prophage
FT                   CP-933H"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 1 to 163 of 202 are 88.95 pct identical to
FT                   residues 1 to 156 of 299 from GenPept 118 :
FT                   gi|4539475|emb|CAB39984.1| (AJ237660) O protein
FT                   [Bacteriophage 21]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54573"
FT                   /db_xref="GOA:A0A0H3JFJ8"
FT                   /db_xref="InterPro:IPR006497"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFJ8"
FT                   /protein_id="AAG54573.1"
FT                   /translation="MTNTAKILNFGRGNFAGQERNVADLDDGYARLSNMLLEAYSGADL
FT                   TKRQFKVLLAILRKTYGWNKPMDRITDSQLSEITKLPVKRCNEAKLELVRMNIIKQQGG
FT                   MFGPNKNISEWCIPQNEGKSPKTRDKTSLKLGDCYPSNWGIAIPQNRGTQKTLLQKKKE
FT                   KIIRPRILANPLTSQKTIFLWLNRMLQFRAAASGEQQKT"
FT   gene            303947..304321
FT                   /locus_tag="Z0312"
FT   CDS_pept        303947..304321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0312"
FT                   /product="partial O replication protein for prophage
FT                   CP-933H"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 1 to 124 of 124 are 99.19 pct identical to
FT                   residues 176 to 299 of 299 from GenPept 118 :
FT                   gi|4539475|emb|CAB39984.1| (AJ237660) O protein
FT                   [Bacteriophage 21]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5F0"
FT                   /protein_id="AAG54574.1"
FT                   /translation="MVKPDAAIQSGSKWGTAEDLTAAEWMFDMVKTIAPSARKPNFAGW
FT                   ANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGV
FT                   TASKPKLDLTNTDWIYGVDL"
FT   gene            304318..304629
FT                   /locus_tag="Z0313"
FT   CDS_pept        304318..304629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0313"
FT                   /product="partial replication protein P for prophage
FT                   CP-933H"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TXD6"
FT                   /protein_id="AAG54575.1"
FT                   /translation="MKNIAAQMVNFDREQMRRIANIDNQDMTISVWVFPDTDISDVSRE
FT                   LIAAIKQGYLTVKAAGVWAGGIETPSVETPSEGSKFFGFDMDNEFISGFDVGAWGVLL"
FT   gene            304629..305339
FT                   /locus_tag="Z0314"
FT   CDS_pept        304629..305339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0314"
FT                   /product="unknown protein from prophage CP-933H"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 91 to 178 of 236 are 60.43 pct identical to
FT                   residues 34 to 122 of 172 from GenPept 118 :
FT                   gi|1788697|gb|AAC75414.1| (AE000324) putative RNA
FT                   polymerase beta [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54576"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3V0"
FT                   /protein_id="AAG54576.1"
FT                   /translation="MAKNDFKAFATDRNANVMSQEEWEALPALISGFTAGKASSAQVNK
FT                   VIRQASFIAAALAQFVSDKTQRDVLDNGDLPGFVELLGSGFAVEYLSRKNPFGDIKSDG
FT                   TVKTALQNLGLGEAAKRDVGTGENQIPDMASFASGNGWMKLPNGKILQYGRGAVTPTLS
FT                   TQTMRITFSIPFPKKADCAMLTHSGDGGAPLGAGRGFVMTAEGPTLTGFNSAYRTSSTS
FT                   DTVSMNYSWWAVGE"
FT   gene            305351..305803
FT                   /locus_tag="Z0315"
FT   CDS_pept        305351..305803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0315"
FT                   /product="unknown protein from prophage CP-933H"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 7 to 150 of 150 are 68.05 pct identical to
FT                   residues 3 to 146 of 146 from GenPept 118 :
FT                   gi|1788696|gb|AAC75413.1| (AE000324) orf, hypothetical
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54577"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M1"
FT                   /protein_id="AAG54577.1"
FT                   /translation="MIYMDEYVYSARHNAFFPVDMIDKYKSEGWDLSDAKEVNQNIISE
FT                   FMAEPPQGKIRIAGDDGLPAWADIPPPTHEELIEITESERQLLINQANEYMNSKQWPGK
FT                   AAIGRLKGDELTQYNLWLDYLDALELVDTSGAPDIEWPTPPAVQAR"
FT   gene            complement(305775..306368)
FT                   /locus_tag="Z0316"
FT   CDS_pept        complement(305775..306368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0316"
FT                   /product="unknown protein from prophage CP-933H"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 2 to 197 of 197 are 65.49 pct identical to
FT                   residues 3 to 200 of 200 from GenPept 118 :
FT                   gi|1787402|gb|AAC74240.1| (AE000214) orf, hypothetical
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54578"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TZX2"
FT                   /protein_id="AAG54578.1"
FT                   /translation="MKPVFDENGLATVPGDMRCFYYDAETSEYTGWSDEYINTGVSMPA
FT                   CSTGIDPGENIPGRVAVFTGKGWSHEEDHRNETVYSIENGAAVTVDYIGAIKDGYVTIS
FT                   PLTPYDKWDGEKWVTDTEAQHSAAVDAAEAQRQSLIDAAMASISLIQLKLQAGRKLTQA
FT                   ETTRLNAVLDYIDAVTATDTSTAPDVIWPELPEA"
FT   gene            complement(306368..306865)
FT                   /locus_tag="Z0317"
FT   CDS_pept        complement(306368..306865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0317"
FT                   /product="putative tail fiber protein from prophage
FT                   CP-933H"
FT                   /function="putative structure; Structural component (Phage
FT                   or Prophage Related)"
FT                   /note="Residues 1 to 164 of 165 are 45.21 pct identical to
FT                   residues 1 to 178 of 179 from GenPept 118 :
FT                   gi|1787403|gb|AAC74241.1| (AE000214) putative tail fiber
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54579"
FT                   /db_xref="GOA:Q8X3U9"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3U9"
FT                   /protein_id="AAG54579.1"
FT                   /translation="MMPFARYFCIFINVGLGEGAPAIGVPFFWPSAAMPNTVIDSWSCM
FT                   VFLKFNGAKFSATDYPVLAKVFPSLVLPEARGDFIRIWDDGRGADGGRELLSWQAATNF
FT                   SQFAGNIGEGAGHAINFHDGIAGNQPGFSRFNFTSNSVGDGVNFVAVRPRNIAFNFLVR
FT                   AK"
FT   gene            306856..307446
FT                   /gene="pinH"
FT                   /locus_tag="Z0318"
FT   CDS_pept        306856..307446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pinH"
FT                   /locus_tag="Z0318"
FT                   /product="DNA invertase from prophage CP-933H"
FT                   /function="putative enzyme; Other or unknown (Phage or
FT                   Prophage Related)"
FT                   /note="Residues 13 to 196 of 196 are 96.73 pct identical to
FT                   residues 1 to 184 of 184 from GenPept 118 :
FT                   gi|1787404|gb|AAC74242.1| (AE000214) inversion of adjacent
FT                   DNA; at locus of e14 element [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54580"
FT                   /db_xref="GOA:Q8X7L1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7L1"
FT                   /protein_id="AAG54580.1"
FT                   /translation="MASFLLLSGRSTMLIGYVRVSTNDQNTDLQRNALNCAGCELIFED
FT                   KISGTKSERPGLKKLLRTLSAGDTLVVWKLDRLGRSMRHLVILVEELRERGVNFRSLTD
FT                   AIDTSTPMGRFFFHVMGALAEMERELIVERTKAGLEAARAQGRIGGRRPKLTPEQWAQA
FT                   GRLIAAGIPRQKVAIIYDVGVSTLYKKFPAGDK"
FT   gene            complement(307504..308277)
FT                   /locus_tag="Z0319"
FT   CDS_pept        complement(307504..308277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0319"
FT                   /product="unknown protein from prophage CP-933H"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 7 to 255 of 257 are 32.03 pct identical to
FT                   residues 6 to 245 of 247 from GenPept 118 :
FT                   gi|6458891|gb|AAF10726.1|AE001964_10 (AE001964)
FT                   hypothetical protein [Deinococcus radiodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54581"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TV85"
FT                   /protein_id="AAG54581.1"
FT                   /translation="MDITEFPSGVIEHLGWYVYRLIDPRDGSTFYVGKGKGNRVFAHMR
FT                   GEVAAADDDDLLSNKLKQIREIRLAGLEVIHVIHRHGMTDEKTAYEVEAALIDAYPGLT
FT                   NIMNGAGSNEFGAAHVKELIATYQPETITFHHKALMISVNRSAKDSELYDAVRFSWRIN
FT                   VSRASKAEVILATVRGIVRGVFIADKWLKSTREHFPTMKYWDEDPDFEATQSSRYGFEG
FT                   REAPPEIANLYLGKKIPDELRKKGAMSPVRYSPNF"
FT   gene            309101..309844
FT                   /locus_tag="Z0321"
FT   CDS_pept        309101..309844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0321"
FT                   /product="putative AraC-type regulatory protein encoded in
FT                   prophage CP-933H"
FT                   /function="putative regulator; Other or unknown (Phage or
FT                   Prophage Related)"
FT                   /note="Residues 1 to 247 of 247 are 34.41 pct identical to
FT                   residues 1 to 242 of 253 from GenPept 118 :
FT                   gi|1787776|gb|AAC74572.1| (AE000247) putative ARAC-type
FT                   regulatory protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54582"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TV41"
FT                   /protein_id="AAG54582.1"
FT                   /translation="MATTCSVILILESFDVYFGKESVFLERGSSVLVDSSSRDFFLTYP
FT                   ERVIVADFGAEFISRYLKANNLRDISDCREYPSYLKINFADFSLIKGLISWANHCAEYI
FT                   EIFDESIAFTCLSAFSSEKQFGVFLFGCLKSTGAKVKTIIHTDLSAPWRLKDISSRLYL
FT                   SESLLKRKLKEEGVSFSKIILDERMQMAEYLLSTRCYPISKVAKVCGYASVSYFTYVFR
FT                   RYFGVSPSQYSQRSSESKILTHQGI"
FT   gene            complement(309886..310251)
FT                   /locus_tag="Z0322"
FT   CDS_pept        complement(309886..310251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0322"
FT                   /product="unknown protein encoded by IS2"
FT                   /function="orf; Unknown function (Insertion Sequence
FT                   Associated)"
FT                   /note="Residues 1 to 117 of 121 are 70.94 pct identical to
FT                   residues 134 to 250 of 263 from GenPept 118 :
FT                   gi|6358776|gb|AAF07358.1|AC011665_17 (AC011665)
FT                   transposase-like protein (TnpF) [Arabidopsis thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54583"
FT                   /db_xref="GOA:Q8X7K8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K8"
FT                   /protein_id="AAG54583.1"
FT                   /translation="MQDVMLGAIEKRFGDKVPEQSIQWLTDNGSAYRAHETRQFARELN
FT                   LEPCTTAISSPQSNGIAERFVKTMKEDYIAFMPKPNVRTALHNLAVAIEHYNENHPHSA
FT                   LGYRSPREYRRQRVTLT"
FT   misc_feature    310646..323540
FT                   /note="Cryptic prophage CP-933I; includes one copy of the
FT                   16bp direct repeat that flanks the CP-933H/CP-933I complex"
FT   gene            310756..311988
FT                   /locus_tag="Z0324"
FT   CDS_pept        310756..311988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0324"
FT                   /product="integrase protein for prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 20 to 403 of 410 are 60.93 pct identical to
FT                   residues 12 to 395 of 403 from GenPept 118 :
FT                   gi|5880470|gb|AAD54663.1|AF097520_1 (AF097520) Sai
FT                   integrase [Shigella flexneri]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54584"
FT                   /db_xref="GOA:Q8X7K7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K7"
FT                   /protein_id="AAG54584.1"
FT                   /translation="MCIGLCICSCSVWIPIHMPLNDMQIRRAKPEAKAYTFGDGLGLSL
FT                   LIEPNGSKSWRFRYRYAGKPKMISLGVYPTITLADARSRRDEARKLVAEGKNPSEVRKE
FT                   QKLAMQTESENAFEKIAREWHQLKSAKWSAGYASDIMEAFKNDIFPYVGTRPVGEIKPL
FT                   ELLNVLRKIEKRGALEKMRKVRQRCSEVFRYAIATGRAEYNPAADLSSALEVHQSNHFP
FT                   FLKADEIPDFLRALEGYSGSKLVQIATKLLMITGVRTIELRAALWQEFDLDNAIWEIPA
FT                   ERMKMRRPHLVPLSSQAVDLLNELKIMTGNYRYVFPGRNDPNRPMSEASINQAIKRIGY
FT                   GGKVTGHGFRHTLSTILHEQGFESAWIEIQLAHVDKNSIRGTYNHAQYFSGRKSMMDWY
FT                   SNLIFERLKRS"
FT   gene            311992..312408
FT                   /locus_tag="Z0325"
FT   CDS_pept        311992..312408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0325"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C325"
FT                   /protein_id="AAG54585.1"
FT                   /translation="MSQPLSEILTWDDEQWEVFVHDWLIVCKSDDYPWSERLGGAGDKG
FT                   RDVVGYKSDPNVEGYSWDNYQCKLYKKSLGFSDVVVEFGKLIYFTLNGDYPIPQKYFFV
FT                   APYDLSTTFSNLLKNKNELKKAVLDSWDSAISKK"
FT   gene            312381..312998
FT                   /locus_tag="Z0326"
FT   CDS_pept        312381..312998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0326"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54586"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TV27"
FT                   /protein_id="AAG54586.1"
FT                   /translation="MGFSNFKKITKKIDIPLDDEIKKYIEDFDFSIFYSLPLSLILNDI
FT                   ANTHLYFKYFNELYVVRIPPNEIPTYNSKKESVYVNALLQAYSEHGNKTYSSFLELDDP
FT                   YRRHFNNSRNDFYFASSLEVFVREVFKDDVFKALKCYISSSIEPVFYEDHNYAFIRCNA
FT                   VLKQAVLTPIAHSVLSKICEANDKKGICHHLVNDGEVIWTVR"
FT   gene            312998..313456
FT                   /locus_tag="Z0327"
FT   CDS_pept        312998..313456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0327"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1S7"
FT                   /protein_id="AAG54587.1"
FT                   /translation="MVRIYNSSLEVACRMAKVLVAIYPSSLSLERLICFDFILVNLKDF
FT                   LPEEISLHPPIPRRDAQLALKREIVLESLALLQGYELASKIYTHRGFVYKASEKTYAFT
FT                   NSLHNEYVAQMEHNINLVVKLYSDIPDEQLQSIIKNKIGKYDMEFNYE"
FT   gene            313449..314081
FT                   /locus_tag="Z0328"
FT   CDS_pept        313449..314081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0328"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54588"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1W5"
FT                   /protein_id="AAG54588.1"
FT                   /translation="MNDNFFTFRKIKVTGFNKLDAIIEFGSKLTILYGGSDSGKTYIYY
FT                   LIRYLLGSEKLKNKDIDHAQGYDLAYLEFNFQGRVMTIERSLQDSAHYRLYDSSIENVS
FT                   EANLLMVFSKSASSKKSFSSYFYGRLNFKEAKVRTNLSNTLHKFNLNNVFEFFCIDELR
FT                   VLTEKSLILSDIPSEETKRKSEFKFLLTQRDDTNSLAEKPNKKARYF"
FT   gene            314112..314702
FT                   /locus_tag="Z0330"
FT   CDS_pept        314112..314702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0330"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1W0"
FT                   /protein_id="AAG54589.1"
FT                   /translation="MKAQLIYPEYDQVIVSRELEKVEQDIESSKDILKGIVDALDDKKQ
FT                   LLKELSDELYSISDREKYLSLLIERFSLLKDQYFIDLQRIDVVSQANFYLNNFADIYCE
FT                   FCNTPQKKENEISYDDCFLSCNAEKLKIKSQLKGLIESIGSNVREHELIMLRKNDVNEI
FT                   YQSEKSDFKTLEDKNIKQYIHLLNHFMNIKTIF"
FT   gene            314702..315268
FT                   /locus_tag="Z0331"
FT   CDS_pept        314702..315268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0331"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C283"
FT                   /protein_id="AAG54590.1"
FT                   /translation="MDHTKHSILSSLQDKEDDVDELKYSAEDFDSLTVADLYDIEIAMQ
FT                   DFLNDINFENSKDNKVRFDEDTYDFNINGKRRGMFGKGTRAVMHAIFTICFAEFLSRKG
FT                   NPFIGFVVLDSPLVTHFDKDRGGSLSDVNSVSLSDSFYHALIKRDYNFQIVILENKGPT
FT                   FQIKINDANKIHNLNKNGSSGFYPV"
FT   gene            complement(315678..315950)
FT                   /locus_tag="Z0332"
FT   CDS_pept        complement(315678..315950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0332"
FT                   /product="putative activator encoded in prophage CP-933I"
FT                   /function="putative regulator; Regulation (Phage or
FT                   Prophage Related)"
FT                   /note="Residues 3 to 67 of 90 are 41.53 pct identical to
FT                   residues 2 to 66 of 70 from GenPept 118 :
FT                   gi|3641396|gb|AAC36459.1| (U91484) positive levansucrase
FT                   regulator LsrS [Rahnella aquatilis]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54591"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDI3"
FT                   /protein_id="AAG54591.1"
FT                   /translation="MALKCPECGTTAHARTSAYEAPSVKRSWYQCQNLECSYTFTALES
FT                   VDTIIMKPRRNEQESEKAQMPEKQQQTLNRYGSASKLSSRQQIPV"
FT   gene            complement(315956..316507)
FT                   /gene="psuI"
FT                   /locus_tag="Z0333"
FT   CDS_pept        complement(315956..316507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psuI"
FT                   /locus_tag="Z0333"
FT                   /product="putative polarity suppression protein encoded in
FT                   CP-933I"
FT                   /function="putative regulator; Regulation (Phage or
FT                   Prophage Related)"
FT                   /note="Residues 9 to 174 of 183 are 30.11 pct identical to
FT                   residues 8 to 180 of 190 from GenPept 118 :
FT                   gi|6318609|gb|AAF06966.1|AF157599_5 (AF157599) P4 psu-like
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54592"
FT                   /db_xref="InterPro:IPR010006"
FT                   /db_xref="InterPro:IPR038395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3Q7"
FT                   /protein_id="AAG54592.1"
FT                   /translation="MMARVTPDQALISFRNARILWAGHSESRKAVEQQIESLLTAMEKP
FT                   ADYARQLELQREHLDVLKWQINCAARECIYSQHQLMEACTEDALSNFMQANGAALTSAL
FT                   APFLKGRGGVDVASRILRNALVRQLAITPPEIAGDYRMILDESGVMPDPMMVRDCQSSY
FT                   TPAQQLRFQQRLDYINGMQE"
FT   gene            complement(316504..317256)
FT                   /gene="sidI"
FT                   /locus_tag="Z0334"
FT   CDS_pept        complement(316504..317256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidI"
FT                   /locus_tag="Z0334"
FT                   /product="putative capsid morphogenesis protein encoded in
FT                   CP-933I"
FT                   /function="putative factor; DNA packaging, phage assembly
FT                   (Phage or Prophage Related)"
FT                   /note="Residues 15 to 249 of 250 are 22.12 pct identical to
FT                   residues 5 to 235 of 244 from GenPept 118 :
FT                   gi|15164|emb|CAA35904.1| (X51522) sid gene product (AA
FT                   1-244) [Bacteriophage P4]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1R9"
FT                   /protein_id="AAG54593.1"
FT                   /translation="MTIPEQNNNPIVEISIPVSTQQALEKVNATKSAWLEARRQQKAAA
FT                   DNIATIRQRRAEMEATTNALNEEWRTLFRESQGVVSKEMKKLRTEIALGRETLEDFDEL
FT                   LAAQESENALLPQEAAELAGKYIHAHDTLVGIRAKQIWEDFMQSHGKALIQTLSLLKST
FT                   MGREASAVVGVVHSVNDPDTLLKDFIHKHITRPALTNDAMPEQDPVFKLAGVAPDYAAR
FT                   LDFSNKLSPAAMHKMKVRQERAEKEKAV"
FT   gene            317659..317829
FT                   /locus_tag="Z0335"
FT   CDS_pept        317659..317829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0335"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54594"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3U7"
FT                   /protein_id="AAG54594.1"
FT                   /translation="MFLPGNNIFASGHGVAFHTDFYKTRSVRFFMDSFGYILRFKVMLF
FT                   NIKVFMQAQCL"
FT   gene            318190..318450
FT                   /locus_tag="Z0336"
FT   CDS_pept        318190..318450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0336"
FT                   /product="putative regulatory protein encoded in prophage
FT                   CP-933I"
FT                   /function="putative regulator; Regulation (Phage or
FT                   Prophage Related)"
FT                   /note="Residues 5 to 86 of 86 are 63.85 pct identical to
FT                   residues 6 to 88 of 88 from GenPept 118 :
FT                   gi|15163|emb|CAA35903.1| (X51522) ORF88 product (AA 1-88)
FT                   (put. DNA-binding protein) [Bacteriophage P4]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54595"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C335"
FT                   /protein_id="AAG54595.1"
FT                   /translation="MRNISVSAPAPAAPLFPVSNHHERFLRLPEVMHLCGLSRSTVYDL
FT                   ISRDAFPKQIPLGGKNVAWAQSEVSAWMADRISARGRGCDA"
FT   gene            318447..319004
FT                   /locus_tag="Z0337"
FT   CDS_pept        318447..319004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0337"
FT                   /product="putative regulator encoded in prophage CP-933I"
FT                   /function="putative regulator; Other or unknown (Phage or
FT                   Prophage Related)"
FT                   /note="Residues 70 to 184 of 185 are 67.82 pct identical to
FT                   residues 21 to 135 of 137 from GenPept 118 :
FT                   gi|215688|gb|AAA92519.1| (M11913) ash gene product
FT                   [Bacteriophage P4]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54596"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1S8"
FT                   /protein_id="AAG54596.1"
FT                   /translation="MMIPAYIKYLYSGLLTVVISRYSFSAVAKSAAGIGVPYNLLATID
FT                   APCVFFYVVAQAQPFSGLWCLCLHHGSIEIMVVRAGQPSGWPVSNKAGYANPVRAATSE
FT                   IGVSGGSNNRYLLEAAIMATILTPSHPQYVFVFAAIRRADTHPRICMLRTVSCDERSAR
FT                   RLLVRDYVLSLSARLPAGEVTL"
FT   gene            319222..319545
FT                   /locus_tag="Z0338"
FT   CDS_pept        319222..319545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0338"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 10 to 107 of 107 are 71.42 pct identical to
FT                   residues 9 to 106 of 106 from GenPept 118 :
FT                   gi|15159|emb|CAA35899.1| (X51522) ORF106 (AA 1-106)
FT                   [Bacteriophage P4]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54597"
FT                   /db_xref="GOA:A0A4Q0C1X3"
FT                   /db_xref="InterPro:IPR035317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1X3"
FT                   /protein_id="AAG54597.1"
FT                   /translation="MICCESLLALRAALYRRAVACAWLALSNHQERYSGLTLAELEDAI
FT                   ARELEGFYLRQHGQQRGLEIACALLSDLMESGPLKACPVLSLLGMTVMDELCSRHLNKP
FT                   ALH"
FT   gene            319502..321892
FT                   /locus_tag="Z0339"
FT   CDS_pept        319502..321892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0339"
FT                   /product="alpha replication protein of prophage CP-933I"
FT                   /function="putative enzyme; Replication (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 23 to 792 of 796 are 72.63 pct identical to
FT                   residues 3 to 773 of 777 from GenPept 118 :
FT                   gi|15158|emb|CAA35898.1| (X51522) alpha gene product (AA
FT                   1-777) [Bacteriophage P4]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54598"
FT                   /db_xref="GOA:Q8X7I5"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I5"
FT                   /protein_id="AAG54598.1"
FT                   /translation="MNFVPVTSTNQRCTKEGRTMSGMKVSQAEKAARGHWSRILPALGV
FT                   NVLKNRHQPCPVCAGKDRFRFDDQEGRGTWFCNQCGAGDGLALVSKVLDVGISEAADRI
FT                   NGIIGNLLPVSQGMLESGSPEKEDGRKAAAVLAARLFDKSRQTTGNAYLTSKGFPALPC
FT                   RELTAMHKVGGVAFRAGDLVVPLYADGELVNLQLINANGGKCFLKGGQVKNAFYLVEGT
FT                   AKAAKRLWIAEGYATALTINYLTGDAVMVAFSSVNFLSLASIACSEYPTHQIIIAADRD
FT                   LNGAGQTRGAAVTGACNCTMALPPVFGDWNDAFTQNGEEATRHAIHEVIKPAVASPFDT
FT                   MSEAEFTALSVSEKAQRVVDHYKNSLAVDPNGQLLSRYEAGAWKVIYYADFARDVAALF
FT                   QRLDAPFSSAKIASLVETLKLIVPQQQNPARQLIGFRNGVLDTRTGLFSPHDKKHWLRT
FT                   LCEVDYTQPVDGESLETHAPAFWRWLDRAAGFNPEKRDIILAALFMVLANRYDWQLFLE
FT                   VTGPGGSGKSILAEIATMLAGEDNATSATIEMLESPRERAALIGFSLIRLPDQEKWSGD
FT                   GAGLKAITGGDAVSVDPKYQNAYSTHIPAVILAVNNNPMRFTDRSGGVSRRRVILHFPD
FT                   QIAPEERDTQLKEKIASELAVIVRQLMQRFSDPMSARTLLQSQQNSDEALTIKRDADSA
FT                   FDFCGYLEVLPDTTGMFMGNANIVPRQPRTYLYHAYLVYMEANGYKNTLSLTMFGKGLP
FT                   LMLKEYGLQYEKRRTNQGMQTNLALREESNADWLPKCDEFAAK"
FT   gene            complement(322025..322981)
FT                   /locus_tag="Z0340"
FT   CDS_pept        complement(322025..322981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0340"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="Residues 45 to 250 of 318 are 21.58 pct identical to
FT                   residues 67 to 290 of 336 from GenPept 118 :
FT                   gi|1651686|dbj|BAA16614.1| (D90899) hypothetical protein
FT                   [Synechocystis sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C292"
FT                   /protein_id="AAG54599.1"
FT                   /translation="MTSYSNFSNQIKETINNKFDHEIHDWDIIKNSITTLINKNIHGAG
FT                   RNIVDFIDLGNWDFISNFSFDDSTRRLELEWHPNDKFHIYIESVVFVEFNDTIYAFLKG
FT                   YYHNQLSLNRIYNTKCSSCSFENSGSYMVDVYRTVKRVNETIQTPNINCYTTCILTRPA
FT                   NGHVTSTGFSRNLMDAINISLAEHKIASLHNEVMSIEEYDRDSLQEKGNTARRYLEYIL
FT                   MLVNIRIMHLNNVQYQEQMLGSLVSVIEALDYEPLMKNDVEITKDILNACSHHGGVRIE
FT                   KKDVIFSLEVIENLIKAIKKTDINKLQLDGMFKSIQK"
FT   gene            complement(323074..323112)
FT                   /locus_tag="Z0341"
FT   CDS_pept        complement(323074..323112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0341"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /function="orf; Other or unknown (Phage or Prophage
FT                   Related)"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54600"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3M5"
FT                   /protein_id="AAG54600.1"
FT                   /translation="MGAILFSDNGML"
FT   gene            complement(323657..324556)
FT                   /locus_tag="Z0342"
FT   CDS_pept        complement(323657..324556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0342"
FT                   /product="putative LysR-like transcriptional regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 188 to 299 of 299 are 98.21 pct identical
FT                   to residues 25 to 136 of 136 from GenPept 118 :
FT                   gi|1786476|gb|AAC73385.1| (AE000136) putative
FT                   transcriptional regulator LYSR-type [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54601"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2G1"
FT                   /protein_id="AAG54601.1"
FT                   /translation="MKIDLNLLPIFIAVAEESNFSKAAARLGVTRSAVSQGIRRLEDAF
FT                   GTMLVMRTTRSVNLTEAGERLHKSLSLPLSGIEAAFEEMVSDHVPRGLLRIAVTSIAEE
FT                   FLSGPLIASFAAANPAVTLDIVVTDEEFDIVAAGYDAGVRLGEVIEKDMIAVPLTGRQR
FT                   EMVVASPSYLAANSTPVHPRELVNHKCIGWRQSPEVAPYRWPFEENGRAFDLAIEPQIT
FT                   TNDLRLMLRLALAGGGITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRNIA
FT                   PKLRALIDHVKEWRQQLA"
FT   misc_feature    323996..330128
FT                   /note="O-island #9; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            324655..325377
FT                   /locus_tag="Z0343"
FT   CDS_pept        324655..325377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0343"
FT                   /product="putative oxidoreductase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 3 to 239 of 240 are 55.88 pct identical to
FT                   residues 25 to 262 of 263 from GenPept 118 :
FT                   gi|6137024|emb|CAB59579.1| (AL132662) putative
FT                   oxidoreductase [Streptomyces coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54602"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDI4"
FT                   /protein_id="AAG54602.1"
FT                   /translation="MDKVILITGASSGIGEGIARELGMTGAKVLLGARRVERIEAIATE
FT                   ICRAGGIAKARELDVTDRQSMADFVQAALDSWGRVDVLINNAGVMPLSPLAAGKQDEWA
FT                   LTIDVNIKGVLWGIGAVLPVMEAQGSGQIINLGSIGALSVVPTGAVYCASKFAVRAISD
FT                   GLRQESSKIRVTCVNPGVVESELASTITHVETMKAMDAYRSVALQPADIARAVRHIIES
FT                   PESVDTTEITIRPTASAN"
FT   gene            325544..325822
FT                   /locus_tag="Z0344"
FT   CDS_pept        325544..325822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0344"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54603"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3R5"
FT                   /protein_id="AAG54603.1"
FT                   /translation="MSLYIKLILSIVREISVNTICSLIVVVALSLLSFSSVAKTITAVG
FT                   STINSTEKEISLQAEKQGKSYKILGAFFKNRVYMIAKLTPVSKNDAS"
FT   gene            326097..326246
FT                   /locus_tag="Z0345"
FT   CDS_pept        326097..326246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0345"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54604"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3M4"
FT                   /protein_id="AAG54604.1"
FT                   /translation="MITNQTEMVKSSNSYLIRFLTPLNSLKRMHILNISEMNSLLPLLI
FT                   EMEG"
FT   gene            complement(326525..327409)
FT                   /locus_tag="Z0346"
FT   CDS_pept        complement(326525..327409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0346"
FT                   /product="putative LysR-like transcriptional regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 3 to 293 of 294 are 40.27 pct identical to
FT                   residues 2 to 294 of 299 from GenPept 118 :
FT                   gi|1787589|gb|AAC74410.1| (AE000231) putative
FT                   transcriptional regulator LYSR-type [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54605"
FT                   /db_xref="GOA:Q8X6J9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6J9"
FT                   /protein_id="AAG54605.1"
FT                   /translation="MAKRENYNELYLFMQVVREGSFTAAAKRLGLAQSGVSRSVRELEE
FT                   RLGVQLLVRTTRKLSLTQAGEQLYQKTASGFEMLDLGLATLAHYRETPSGTVRINASQH
FT                   AIDKCLLPKLAVFKQRYPDIQLELINESRFVDIIEERFDAGVRLGPEVSQGMVAVRITP
FT                   DMEMAIVGTPEHFRRYGFPQTPADLKAHPCIAYQFADGSVYQWELNQDDKKITHQPEGQ
FT                   WAFSDSYMEAEAARLGLGLAYVPVELVADDLEHGKLIRVLQRYSLRMEGLFLYYPHRNV
FT                   SPALRMVIDTLKI"
FT   gene            327673..328731
FT                   /locus_tag="Z0347"
FT   CDS_pept        327673..328731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0347"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 10 to 351 of 352 are 58.30 pct identical to
FT                   residues 51 to 371 of 371 from GenPept 118 :
FT                   gi|45369|emb|CAA78447.1| (Z14064) ORF2 [Pseudomonas
FT                   aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54606"
FT                   /db_xref="GOA:A0A4Q0C4P6"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C4P6"
FT                   /protein_id="AAG54606.1"
FT                   /translation="MSYADSTNPNAPVSMTDKWDKTFAESQKVDHRKVSFPNRYGITLV
FT                   GDLYLPKDRGDRKLAAIAVSGPFGAVKEQSSGLYAQTLAERGFVTLAFDPSYTGESGGY
FT                   PRNVASPDINTEDFSAAVDFLGLQKEVDRNRIGLLGICGWGGMALNDAAMDTRVKAVAT
FT                   SVMYDMSRAMGHGVGDGEDRYSTADRRAVLQYLNEQRWKDAQSGTFAHGGHDINVDSNG
FT                   KVSAGERILPETLPANPHPVLKEFFDYYRMPRGFHERSVNSTGAWTATMPLSFMNMPLL
FT                   SYASEITIPTLIVTGEKAHSRYFAEDAYKAVGSKDKELVVVPGANHVDLYDNVAGKIPF
FT                   AKFEQFFQTKLK"
FT   gene            328807..330000
FT                   /locus_tag="Z0348"
FT   CDS_pept        328807..330000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0348"
FT                   /product="putative transcriptional regulator"
FT                   /function="putative regulator; Unknown function"
FT                   /note="Residues 1 to 396 of 397 are 60.40 pct identical to
FT                   residues 6 to 401 of 402 from GenPept 118 :
FT                   gi|45368|emb|CAA78446.1| (Z14064) OpdE [Pseudomonas
FT                   aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54607"
FT                   /db_xref="GOA:A0A0H3JCD0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCD0"
FT                   /protein_id="AAG54607.1"
FT                   /translation="MSTLSQTPSPHHQHAYWGGIFAMTLCVFVLIASEFMPVSLLTPIA
FT                   RDLGVTEGLAGRGIAISGALAVLTSLTLSTLAGKMNRKFLLLGMTVLMAVSGLIIALAT
FT                   SYLMYMVGRAMIGVAIGGFWSMSAATAIRLVPQHQVTRALAIFNAGNALATVVAAPLGS
FT                   YLGATVGWRGAFLCLVPMAVVAFIWQCISLPSMDANKSHTSCGAVFRLFSRRMVVVGMI
FT                   ACGLFFMGQFALFTYVRPFLESVTRVNSLGLSLILLIIGVAGFIGTLVVSIFLNRKCYP
FT                   TLMAIPGLMAVIAIGLMLTGHHVWMVSLLLGLWGMLATAAPTGWWTWIARTLPDNAEAG
FT                   GGLMVAVIQLSIALGSTAGGIVFDRLGWQSTFAMSSVLLLCAGVLTFVTARQKAGAL"
FT   gene            complement(330179..331135)
FT                   /gene="yagQ"
FT                   /locus_tag="Z0349"
FT   CDS_pept        complement(330179..331135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagQ"
FT                   /locus_tag="Z0349"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 318 of 318 are 98.42 pct identical to
FT                   residues 1 to 318 of 318 from Escherichia coli K-12 Strain
FT                   MG1655: B0283"
FT                   /db_xref="EnsemblGenomes-Gn:Z0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54608"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TW96"
FT                   /protein_id="AAG54608.1"
FT                   /translation="MSYPLFDKDEHWHKPEQAFLTDDHRTILRFAVEALMSGKGAGLVT
FT                   LVEIRGGAARPLGAQMVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGCDREIRYGEGS
FT                   PWFDIVLPCGGGITLTLHKLRSAQPLLAVLNRLEQRKPAGLRYDPQAQSLVCLPTQTRT
FT                   GWNLNGFEVGFRPCVRLMIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTA
FT                   VILLCHDLNRELPVLQAAREAKPFYLGALGSYRTHTLRLQKLHELGWSREETAQIRAPV
FT                   GIFPKARNAHTLALSVLAEVASVRLHQEEDSCLPPSS"
FT   gene            complement(331145..333343)
FT                   /gene="yagR"
FT                   /locus_tag="Z0350"
FT   CDS_pept        complement(331145..333343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagR"
FT                   /locus_tag="Z0350"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 732 of 732 are 98.63 pct identical to
FT                   residues 1 to 732 of 732 from Escherichia coli K-12 Strain
FT                   MG1655: B0284"
FT                   /db_xref="EnsemblGenomes-Gn:Z0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54609"
FT                   /db_xref="GOA:Q8X6J4"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6J4"
FT                   /protein_id="AAG54609.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEES
FT                   PNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLPVITASNAGALSKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVSQPPEDTPDKNVG
FT                   DFDGAFSSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQIDPADPTRRFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEPNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACVKLREMIASAVGFDPEQSQFADGKITNGTRSAILHEATAGGRLTAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
FT   gene            complement(333340..334296)
FT                   /gene="yagS"
FT                   /locus_tag="Z0351"
FT   CDS_pept        complement(333340..334296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagS"
FT                   /locus_tag="Z0351"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 318 of 318 are 99.05 pct identical to
FT                   residues 1 to 318 of 318 from Escherichia coli K-12 Strain
FT                   MG1655: B0285"
FT                   /db_xref="EnsemblGenomes-Gn:Z0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54610"
FT                   /db_xref="GOA:Q8X6J0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6J0"
FT                   /protein_id="AAG54610.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLVAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYTFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDALFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
FT   gene            complement(334293..334982)
FT                   /gene="yagT"
FT                   /locus_tag="Z0352"
FT   CDS_pept        complement(334293..334982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagT"
FT                   /locus_tag="Z0352"
FT                   /product="putative xanthine dehydrogenase"
FT                   /function="putative enzyme; Not classified"
FT                   /EC_number="1.1.1.20"
FT                   /note="Residues 1 to 229 of 229 are 98.25 pct identical to
FT                   residues 1 to 229 of 229 from Escherichia coli K-12 Strain
FT                   MG1655: B0286"
FT                   /db_xref="EnsemblGenomes-Gn:Z0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54611"
FT                   /db_xref="GOA:Q8X6I9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I9"
FT                   /protein_id="AAG54611.1"
FT                   /translation="MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAAAAVVYPHS
FT                   TLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDALRENLHLIGTKKGCDHGQC
FT                   GACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTS
FT                   GQICSSVAVLKEIQDGIPSHVTVDLVSPPERTADEIRERMSGNICRCGAYANILAAIED
FT                   AAGEIKS"
FT   gene            335400..336014
FT                   /gene="yagU"
FT                   /locus_tag="Z0353"
FT   CDS_pept        335400..336014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="Z0353"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 204 of 204 are 100.00 pct identical to
FT                   residues 1 to 204 of 204 from Escherichia coli K-12 Strain
FT                   MG1655: B0287"
FT                   /db_xref="EnsemblGenomes-Gn:Z0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54612"
FT                   /db_xref="GOA:P0AAA2"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA2"
FT                   /protein_id="AAG54612.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
FT   gene            complement(336262..336591)
FT                   /gene="ykgJ"
FT                   /locus_tag="Z0354"
FT   CDS_pept        complement(336262..336591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgJ"
FT                   /locus_tag="Z0354"
FT                   /product="putative ferredoxin"
FT                   /function="putative carrier; Not classified"
FT                   /note="Residues 1 to 109 of 109 are 100.00 pct identical to
FT                   residues 1 to 109 of 109 from Escherichia coli K-12 Strain
FT                   MG1655: B0288"
FT                   /db_xref="EnsemblGenomes-Gn:Z0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54613"
FT                   /db_xref="GOA:P0AAM0"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAM0"
FT                   /protein_id="AAG54613.1"
FT                   /translation="MSNLNPCMTCGACCAFFRVSFYWAEADDAGGTIPARLTEQISPFH
FT                   RCMSGTNQKNPRCIALAGTPGKNACCTIYKNRSSTCREFAMSGENGVVNEACNRARAKY
FT                   GLTPL"
FT   gene            complement(336904..337659)
FT                   /gene="yagV"
FT                   /locus_tag="Z0356"
FT   CDS_pept        complement(336904..337659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagV"
FT                   /locus_tag="Z0356"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 251 of 251 are 97.21 pct identical to
FT                   residues 1 to 251 of 251 from Escherichia coli K-12 Strain
FT                   MG1655: B0289"
FT                   /db_xref="EnsemblGenomes-Gn:Z0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54614"
FT                   /db_xref="GOA:Q8X6I6"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I6"
FT                   /protein_id="AAG54614.1"
FT                   /translation="MITAGLAKSALQEKFMFRRRGVTLTKALLTAVCMLAAPLTQAISV
FT                   GNLTFSLPSETDFVSKRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQL
FT                   ALQAGESEYFKFYYHGPQDNRERYYRVSFREVPTRNLTKRSPTGGEVSTEPVVVMDTIL
FT                   VVRPRQVQFKWSFDQVTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPEDVVHQPEL
FT                   RQPGNHYLVYNDKFIKISDSCPAKPPSAD"
FT   gene            complement(337583..339226)
FT                   /gene="yagW"
FT                   /locus_tag="Z0357"
FT   CDS_pept        complement(337583..339226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagW"
FT                   /locus_tag="Z0357"
FT                   /product="putative receptor"
FT                   /function="putative factor; Not classified"
FT                   /note="Residues 1 to 547 of 547 are 99.08 pct identical to
FT                   residues 1 to 547 of 547 from Escherichia coli K-12 Strain
FT                   MG1655: B0290"
FT                   /db_xref="EnsemblGenomes-Gn:Z0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54615"
FT                   /db_xref="GOA:Q8X4N4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X4N4"
FT                   /protein_id="AAG54615.1"
FT                   /translation="MRVNLLIAMIIFALIWPVTALRAAVSKTTWADAPAREFVFVENNS
FT                   DDNFFVTPGGALDPRLTGANRWTGLKYNGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWL
FT                   ENSPVSSPLTGLRCINWYAGCNMTTSLILPQTTDTSGFYGATVTSGGAKWMHGMLSDAF
FT                   YQYLQQMPVGSSFTMTINACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLIN
FT                   THSLAEVFINSDGVPTLGEGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPA
FT                   IANSSLASAVGAYDMQFSLNGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVN
FT                   QGISDINTKDLFNFRFQNTTSPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREG
FT                   YVGSGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPAT
FT                   LSFITRNGATKTYDAGCDDSWRDMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAI
FT                   SLRTVDDNGWFGEVSASGEIHVQATWRNIN"
FT   gene            complement(339216..341741)
FT                   /gene="yagX"
FT                   /locus_tag="Z0358"
FT   CDS_pept        complement(339216..341741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagX"
FT                   /locus_tag="Z0358"
FT                   /product="putative enzyme"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 841 of 841 are 99.52 pct identical to
FT                   residues 1 to 841 of 841 from Escherichia coli K-12 Strain
FT                   MG1655: B0291"
FT                   /db_xref="EnsemblGenomes-Gn:Z0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54616"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I4"
FT                   /protein_id="AAG54616.1"
FT                   /translation="MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQA
FT                   FSQALQDGMSVPLYIHLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSE
FT                   QTRQQLMALANAPFNEALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQ
FT                   SSVNTLSSNLSYNFGIYNNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQ
FT                   DSELYKAMYERDFAGHRFAGGTLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSS
FT                   QSATPVIAFLPAAGEVHLTRDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRV
FT                   ISKRTQRVNKLFSRGRGVGAPLAWQVWGGSFHMDRWSENGKKTRPAKESWLAGASTSGS
FT                   LSTLSWAATGYGYDNQAVGETRLTLPLGGAINVNLQNMLASDSSWSSIGSISATLPGGF
FT                   SSLWVNQEKTRIGNQLRRSDADNRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTA
FT                   DYYQNVYSGTFGSLGLRAGIQRYNNGDSNANTGKYIALDLSLPLGNWFSAGMTHQNGYT
FT                   MANLSARKQFDEGTIRTVGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAA
FT                   DGYVNTNLTANGSVGWQGKNIAASGRTDGNAGVIFNTGLEDDGQISAKINGRIFPLNGK
FT                   RNYLPLSPYGRYEVELQNSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGR
FT                   IRAEDGTLLANARINNHIGRTRTDENGEFVMDVDKKYPTIDFRYSGNKTCEVALELNQA
FT                   RGAVWVGDVVCSGLSSWAAVTQTGEENES"
FT   gene            complement(341767..342435)
FT                   /gene="yagY"
FT                   /locus_tag="Z0359"
FT   CDS_pept        complement(341767..342435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagY"
FT                   /locus_tag="Z0359"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 222 of 222 are 98.64 pct identical to
FT                   residues 1 to 222 of 222 from Escherichia coli K-12 Strain
FT                   MG1655: B0292"
FT                   /db_xref="EnsemblGenomes-Gn:Z0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54617"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I2"
FT                   /protein_id="AAG54617.1"
FT                   /translation="MKKHLLLLALLLSGISPAQALDVGDISSFMNSDSSTLSKTIKNST
FT                   DSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEK
FT                   ERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGTLTNTG
FT                   NATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
FT                   "
FT   gene            complement(342493..343080)
FT                   /gene="yagZ"
FT                   /locus_tag="Z0360"
FT   CDS_pept        complement(342493..343080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagZ"
FT                   /locus_tag="Z0360"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 195 of 195 are 100.00 pct identical to
FT                   residues 1 to 195 of 195 from Escherichia coli K-12 Strain
FT                   MG1655: B0293"
FT                   /db_xref="EnsemblGenomes-Gn:Z0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54618"
FT                   /db_xref="GOA:P0AAA4"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA4"
FT                   /protein_id="AAG54618.1"
FT                   /translation="MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKL
FT                   VVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGST
FT                   LNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGT
FT                   TNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS"
FT   gene            complement(343155..343745)
FT                   /gene="ykgK"
FT                   /locus_tag="Z0361"
FT   CDS_pept        complement(343155..343745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgK"
FT                   /locus_tag="Z0361"
FT                   /product="putative regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 1 to 196 of 196 are 96.42 pct identical to
FT                   residues 1 to 196 of 196 from Escherichia coli K-12 Strain
FT                   MG1655: B0294"
FT                   /db_xref="EnsemblGenomes-Gn:Z0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54619"
FT                   /db_xref="GOA:Q8X6I1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I1"
FT                   /protein_id="AAG54619.1"
FT                   /translation="MTWQNDYSRDYEVENHMECQNRSDKYIWSPHDAYFYKGLSELIVD
FT                   IDRLIYLSLEKIRKDFVFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANY
FT                   WYYNSNIRGVVYAGLSRDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPK
FT                   SIARIENCSVKTVYTHRRNAEAKLYSKLYKLVQ"
FT   gene            complement(344151..344375)
FT                   /locus_tag="Z0362"
FT   CDS_pept        complement(344151..344375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0362"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3M2"
FT                   /protein_id="AAG54620.1"
FT                   /translation="MQCPGKEAIVPVTTGSLRLTSLNLALRGLTGQMTYLHLFNFSSLI
FT                   GMNTHNHFVRHVNPLKHLTDWQIIFNYDS"
FT   gene            344522..344713
FT                   /gene="ykgL"
FT                   /locus_tag="Z0363"
FT   CDS_pept        344522..344713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgL"
FT                   /locus_tag="Z0363"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 60 of 63 are 85.00 pct identical to
FT                   residues 1 to 60 of 75 from Escherichia coli K-12 Strain
FT                   MG1655: B0295"
FT                   /db_xref="EnsemblGenomes-Gn:Z0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1V5"
FT                   /protein_id="AAG54621.1"
FT                   /translation="MQAASQREETEWRVQSKRGLMPAYRGEAGQQVNINIMEYSERNVR
FT                   QLTLNEQEDTSPGKLMLV"
FT   gene            complement(344923..345186)
FT                   /gene="ykgM"
FT                   /locus_tag="Z0364"
FT   CDS_pept        complement(344923..345186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="Z0364"
FT                   /product="putative ribosomal protein"
FT                   /function="putative structure; Not classified"
FT                   /note="Residues 1 to 87 of 87 are 100.00 pct identical to
FT                   residues 1 to 87 of 87 from Escherichia coli K-12 Strain
FT                   MG1655: B0296"
FT                   /db_xref="EnsemblGenomes-Gn:Z0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54622"
FT                   /db_xref="GOA:P0A7N3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7N3"
FT                   /protein_id="AAG54622.1"
FT                   /translation="MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
FT   misc_feature    345358..347818
FT                   /note="O-island #10; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            345429..345830
FT                   /locus_tag="Z0365"
FT   CDS_pept        345429..345830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0365"
FT                   /product="unknown protein encoded in ISEc8"
FT                   /function="orf; Unknown function (Insertion Sequence
FT                   Associated)"
FT                   /note="Residues 1 to 133 of 133 are 100.00 pct identical to
FT                   residues 1 to 133 of 133 from GenPept 118 :
FT                   gi|3414881|gb|AAC31492.1| (AF071034) L0013 [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54623"
FT                   /db_xref="GOA:Q7DB88"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB88"
FT                   /protein_id="AAG54623.1"
FT                   /translation="MGTKVSDMQKNVTPGRRKGCPNYPPEFKQQLVAASCEPGISISKL
FT                   ALENGINANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPETLSISC
FT                   EVTFRHGTLRFNGNVSEKLLTLLIQELKR"
FT   gene            345827..346174
FT                   /locus_tag="Z0366"
FT   CDS_pept        345827..346174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0366"
FT                   /product="unknown protein encoded in ISEc8"
FT                   /function="orf; Unknown function (Insertion Sequence
FT                   Associated)"
FT                   /note="Residues 1 to 115 of 115 are 100.00 pct identical to
FT                   residues 1 to 115 of 115 from GenPept 118 :
FT                   gi|3661485|gb|AAC61716.1| (AF081284) Hp4 [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54624"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0BZK4"
FT                   /protein_id="AAG54624.1"
FT                   /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFI
FT                   FRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQ
FT                   PKRLLTSLTML"
FT   gene            346224..347762
FT                   /locus_tag="Z0367"
FT   CDS_pept        346224..347762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0367"
FT                   /product="unknown protein encoded in ISEc8"
FT                   /function="orf; Unknown function (Insertion Sequence
FT                   Associated)"
FT                   /note="Residues 1 to 512 of 512 are 100.00 pct identical to
FT                   residues 1 to 512 of 512 from GenPept 118 :
FT                   gi|3414883|gb|AAC31494.1| (AF071034) L0015 [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54625"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2I2"
FT                   /protein_id="AAG54625.1"
FT                   /translation="MNDISSDDIFLLKQRLAEQEALIHALQEKLSNREREIDHLQAQLD
FT                   KLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDTLTGRVYDPAVQRPLRQTRTRKPFPE
FT                   SLPRDEKRLLPAAPCCPNCGGSLSYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAI
FT                   VQAPAPSRPIERGIAGPGLLARVLTSKYAEHTPLYRQSEIYGRQGVELRRSLLSGWVDA
FT                   CCRLLSPLEEALHGYVMTDGKLHADDTPVQVLLPGNKKTKTGRLWAYVRDDRNAGSALA
FT                   PAVWFAYSPDRKGIHPQTHLACFSGVLQADAYAGFNELYRNGGITEAACWAHARRKIHD
FT                   VHVRIPSALTEEALEQIGQLYAIEADIRGMPAEQRLAERQRKTKPLLKSLESWLREKMK
FT                   TLSRHSELAKAFAYALNQWPALTYYANDGWVEIDNNIAENALRAVSLGRKNFLFFGSDH
FT                   GGERGALLYSLIGTCKLNDVDPESYLRHVLGVIADWPVNRVSELLPWRIALPAE"
FT   gene            complement(348575..349717)
FT                   /locus_tag="Z0369"
FT   CDS_pept        complement(348575..349717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0369"
FT                   /product="putative oxidoreductase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 380 of 380 are 40.52 pct identical to
FT                   residues 1 to 372 of 372 from GenPept 118 :
FT                   gi|2634855|emb|CAB14352.1| (Z99116) similar to
FT                   NADH-dependent flavin oxidoreductase [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54626"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDI6"
FT                   /protein_id="AAG54626.1"
FT                   /translation="MTNKHPSLFSPFMLTEKIKLRNRIVMAPMTTWSANPDGTISEQEL
FT                   EFYKRRSQNVGLVITGCTYVTPSGIGFTHEFAAYDDRFINSLEKLAAAAKSGGAPAILQ
FT                   IFHAGNKAIPELVPNNDVISASASSVKSGDFMKRVVQSREMTENEIQETIRAFGDVTKR
FT                   AIKAGFDGIELHGAHGFLLQNFFSPLFNQRNDRWGGDLEGRMRFPLAVLQEVKNVVYEY
FT                   ATKPFAIGYRISPEESATGGLRIEDTYKLLDRLISSGISYIHTSLVSINDSYPVESPNG
FT                   PRTIELILNHIAGRVPVIAAGKIRTPSQAQEAISTGLPLVAIGKGLVINPEWVTLAESG
FT                   RGHEIQTTLNPQLVPELTIPDKLWDQIQASKGTGWFPLMD"
FT   misc_feature    348667..353435
FT                   /note="O-island #11; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(349953..350873)
FT                   /locus_tag="Z0370"
FT   CDS_pept        complement(349953..350873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0370"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 13 to 306 of 306 are 40.93 pct identical to
FT                   residues 22 to 310 of 310 from GenPept 118 :
FT                   gi|1787587|gb|AAC74409.1| (AE000230) orf, hypothetical
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54627"
FT                   /db_xref="GOA:A0A4Q0C3T1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3T1"
FT                   /protein_id="AAG54627.1"
FT                   /translation="MKTVSIKHTYWDIAADIYFPDDFNSEKKYPAIISAHPIGSCKEQT
FT                   SGSVYGAALAKAGFIVIAFDASFQGSSGGEPRYLEDPTMRVKDFSIVVDYLTSLPYVDA
FT                   GRIGVLGICGGGGYAINAAMTERRIKAIGTVTGANYGRLMREGFTAFNPIGALEAMAQQ
FT                   RTDEANGAKLRVDDLLPSSPDAALEAGLTEIDLFEATEYYRSPRGYAPNGVNRSLFSHQ
FT                   TVAVGWDAFHLAEVLLTQPIMVVVGDRVGAFGAYRDGCEIIGRAASKHKELVVVEGYSH
FT                   YDLYDKPEPVKQALDKLIPFYKTHL"
FT   gene            350967..351956
FT                   /locus_tag="Z0371"
FT   CDS_pept        350967..351956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0371"
FT                   /product="putative LysR-like transcriptional regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 30 to 320 of 329 are 38.48 pct identical to
FT                   residues 5 to 288 of 302 from GenPept 118 :
FT                   gi|1787128|gb|AAC73986.1| (AE000192) putative
FT                   transcriptional regulator LYSR-type [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54628"
FT                   /db_xref="GOA:Q8X6H0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6H0"
FT                   /protein_id="AAG54628.1"
FT                   /translation="MTCIGYHQWSNIYHSVKLRFTMMKIEPSILPSLAWFALIVRAGSF
FT                   SRAVSEMGITLAALSQNLKSLEERLNTKLIYRTTRNISLTEEGQRLYEVLVSALGQIDD
FT                   ALKDVGDTQLEPTGLLRINSSRVAARMLVEPHIGEFLTRYPKTKIELIMDDGLSNIIAD
FT                   GCDVGIRLEQGLDEHMTAVPVSPLIKLVTVASPDYLKEHGIPETPQELSNHNCLRLRHK
FT                   SSGALSAWEFSKVVGGNEEFEIEVSGKYISNDDESMIRMALNGTGIIQHLDFAIAEHIN
FT                   AGKLQPILEDWAVSFPGFYIYVSSRVRMPSKVRAFIDFMVEKRVKLEN"
FT   gene            complement(352244..352600)
FT                   /locus_tag="Z0372"
FT   CDS_pept        complement(352244..352600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0372"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C363"
FT                   /protein_id="AAG54629.1"
FT                   /translation="MNKNLILAFALFSLPVFAEEDLGPGKYVCDIRISSLDTATQILSK
FT                   SATVLDNGNNFIVQMPNGDQLYSPDLENVDDGIKQKATIGGVTFIRRPTFNDRFIVEDG
FT                   NTGFFYKMRNCEKK"
FT   gene            352631..352759
FT                   /locus_tag="Z0373"
FT   CDS_pept        352631..352759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0373"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3M0"
FT                   /protein_id="AAG54630.1"
FT                   /translation="MLHKKHVNEKSDWLMSNAINPRMAYFSLAAVLNLIEYGQDSD"
FT   gene            complement(352793..353368)
FT                   /locus_tag="Z0374"
FT   CDS_pept        complement(352793..353368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0374"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 3 to 187 of 191 are 59.78 pct identical to
FT                   residues 5 to 192 of 286 from GenPept 118 :
FT                   gi|4981536|gb|AAD36074.1|AE001762_1 (AE001762)
FT                   oxidoreductase, aldo/keto reductase family [Thermotoga
FT                   maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54631"
FT                   /db_xref="GOA:A0A384L4G3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4G3"
FT                   /protein_id="AAG54631.1"
FT                   /translation="MQKVKLNNGIEMPLLGFGVFQMTDAAECERAVIDAINTGYRLIDT
FT                   AASYQNEPQVGNALKQSGIARNELFVTTKLWLQDTSYEGAKAQFERSLNRLQLDYVDLY
FT                   LIHQPYGDVHGAWRAMEELQQAGKIRAIGVSNFHPDRLADLIAFNNVVPAVNQVEVNPF
FT                   NQQLHAVPWMQSRGIQPEAWAPFAVTGR"
FT   gene            353934..358187
FT                   /gene="eaeH"
FT                   /locus_tag="Z0375"
FT   CDS_pept        353934..358187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eaeH"
FT                   /locus_tag="Z0375"
FT                   /product="putative adhesin"
FT                   /function="putative factor; Not classified"
FT                   /note="Residues 64 to 1384 of 1417 are 32.54 pct identical
FT                   to residues 158 to 1460 of 2383 from GenPept 118 :
FT                   gi|1788288|gb|AAC75042.1| (AE000289) putative factor
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54632"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TW79"
FT                   /protein_id="AAG54632.1"
FT                   /translation="MSRYKTGHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDIEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLLTLSAGHKQGKSGENDTRFGLEVNYRIGEPLAKQLDTDSIRERRVLAG
FT                   SRYDLVERNNNIVLEYRKSEVIRIALPERIEGKGGQTLSLGLVVSKATHGLKNVQWEAP
FT                   SLLAEGGKITGQGSQWQVTLPAYRPGKDNYYAISAVAYDNKGNTSKRVQTEVVITGAGM
FT                   SADRTALTLDGQSRIQMLANGNEQKPLVLSLRDAEGQPVTGMKDQIKTELTFKPAGNIV
FT                   TRSLKATKSQAKPTLGEFTETEAGVYQSVFTTGTQSGEATITVSVDGMSKTVTAELRAT
FT                   MMDVANSTLSANEPSGDVVADGQQAYTLTLTAVDSEGNPVTGEASRLRFVPQDTNGVTV
FT                   GAISEIKPGVYSAAVSSTRAGNVVVRAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNP
FT                   DKPVVGGTVTAIWTVKDAYDNPVTSLTPEAPSLAGAAAEGSTASGWTNNGDGTWTAQIT
FT                   LGSTAGELEVMPKLNGQNAAANAAKVTVVADALSSNQSKVSVAEDHVKAGESTTVTLVA
FT                   KDAHGNAISGLALSASLTGTASEGATVSSWTEKGNGSYVATLTTGGKTGELRVMPLFNG
FT                   QPAATEAAQLTVIAGEMSSANSTLVADNKAPTVKTTTELTFTVKDAYGNPVTGLKPDAP
FT                   VFSGAASTGSERPSAGNWTEKGNGVYVSTLTLGSAAGQLSVMPRVNGQNAVAQPLVLNV
FT                   AGDASKAEIRDMTVKVNNQLANGQSANQITLTVVDTYGNPLQGQEVTLTLPQGVTSKTG
FT                   NTVTTNAAGKADIELMSTVAGEHNISASVNGAQKTVTVKFNADASTGQANLQVDAAAQK
FT                   VANGKDAFTLTANVEDKNGNPVPGSLVTFNLPRGVKPLTGDNVWVKANDEGKAELQVVS
FT                   VTAGTYEITASAGNSQPSNTQTITFVADKATATVSGIEVIGNYALADGNAKQTYKVTVT
FT                   DANNNLLKDSEVTLTASPANLVLTPNGTAKTNEQGQAIFTATTTVAAKYTLTAKVSQAD
FT                   GQESTKTAESKFVADDTNAVLTASSDVTSLVADGISTAKLEVTLMSANNPVGGNMWVDI
FT                   KTPEGVTEKDYQFLPSKNDHFVSGKITRTFSTSKPGVYTFTFNALTYGGYEMKPVTVTI
FT                   TAVDADTAKGEEAMN"
FT   misc_feature    354810..358504
FT                   /note="O-island #12; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(358308..359198)
FT                   /gene="ykgA"
FT                   /locus_tag="Z0376"
FT   CDS_pept        complement(358308..359198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgA"
FT                   /locus_tag="Z0376"
FT                   /product="putative AraC-like transcriptional regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 1 to 231 of 296 are 94.80 pct identical to
FT                   residues 1 to 229 of 239 from GenPept 118 :
FT                   gi|1657500|gb|AAB18028.1| (U73857) similar to E. coli rob
FT                   gene [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54633"
FT                   /db_xref="GOA:A0A0H3JDL3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDL3"
FT                   /protein_id="AAG54633.1"
FT                   /translation="MRYDKELTENVMIRQKILQQLLEWIECNLEHPISIEDIAQKSGYS
FT                   RRNIQLLFRNFMHVPLGEYIRKRRLCRAAILVRLTAKSMLDIAISLHFDSQQSFSREFK
FT                   KLFGCSPRVYRHRDYWDLANIFPSFLIRQQQKTECRLVNFPETPIFGNSFKYDIEVSNK
FT                   SPDEEVKLRRHHLARCMKNFKTDTYFVSTFEPSTKSVDLLTVETFAGTVCKQTDSEMPK
FT                   EWTINRGLYASFRYEGEWEHYPEWARNLYLMELPARGLARVNGSDIERFYYNEDFVEKD
FT                   SNDVVCEIFIPVRPV"
FT   gene            359399..360283
FT                   /locus_tag="Z0377"
FT   CDS_pept        359399..360283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0377"
FT                   /product="putative dehydrogenase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 11 to 291 of 294 are 46.61 pct identical to
FT                   residues 8 to 285 of 286 from GenPept 118 :
FT                   gi|4981536|gb|AAD36074.1|AE001762_1 (AE001762)
FT                   oxidoreductase, aldo/keto reductase family [Thermotoga
FT                   maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54634"
FT                   /db_xref="GOA:Q8X6G0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6G0"
FT                   /protein_id="AAG54634.1"
FT                   /translation="MEGLTVEFSVLSNNLKMPMMGFGVFQVTDKNVCKQSVLNAIRTGY
FT                   RLIDTAAVYGNEDAVGEAVREAISEGLCTREELFITSKLWVQDMLNQDTAAAGIEASLK
FT                   KSGLEYFDLYLLHQAMRDYFSAWRALEDAYEEGKLKAIGVSNFYPHVLANFCETVRVKP
FT                   MVNQVELHPYFAQPEALATMKYYNVQPEAWAPLGGGRHKPFENNLLQSIADAHQKSISQ
FT                   VILRWNIQRGVVVIPKSTHQQRIEENFAIWDFSLTEKEMAQISSLDLGYVGESVKHFNP
FT                   EFVRGCLAVKIHD"
FT   misc_feature    359430..360154
FT                   /locus_tag="Z0377"
FT                   /note="O-island #13; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(360443..361036)
FT                   /gene="ykgB"
FT                   /locus_tag="Z0378"
FT   CDS_pept        complement(360443..361036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="Z0378"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 197 of 197 are 98.47 pct identical to
FT                   residues 4 to 200 of 200 from Escherichia coli K-12 Strain
FT                   MG1655: B0301"
FT                   /db_xref="EnsemblGenomes-Gn:Z0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54635"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Z6"
FT                   /protein_id="AAG54635.1"
FT                   /translation="MEKYLHLLSRGDKIGLALIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQSANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQGSNESSSTLKTEY"
FT   gene            361019..361288
FT                   /locus_tag="Z0379"
FT   CDS_pept        361019..361288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0379"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 89 of 89 are 97.75 pct identical to
FT                   residues 1 to 89 of 89 from Escherichia coli K-12 Strain
FT                   MG1655: B0302"
FT                   /db_xref="EnsemblGenomes-Gn:Z0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC83"
FT                   /protein_id="AAG54636.1"
FT                   /translation="MQVFFHCEYPYLYNTAVAVELLSIRIDVTFQDEALYFLAISAMAS
FT                   SRTVGDADTDETLICFRIILSSALVENAITPDNSVANKTDFLNI"
FT   gene            complement(361048..361299)
FT                   /gene="ykgI"
FT                   /locus_tag="Z0380"
FT   CDS_pept        complement(361048..361299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="Z0380"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 83 of 83 are 98.79 pct identical to
FT                   residues 1 to 83 of 83 from Escherichia coli K-12 Strain
FT                   MG1655: B0303"
FT                   /db_xref="EnsemblGenomes-Gn:Z0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54637"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBV0"
FT                   /protein_id="AAG54637.1"
FT                   /translation="MMVFYMFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASP
FT                   TVLEDAIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
FT   gene            complement(361393..362745)
FT                   /gene="ykgC"
FT                   /locus_tag="Z0381"
FT   CDS_pept        complement(361393..362745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="Z0381"
FT                   /product="putative oxidoreductase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 450 of 450 are 99.33 pct identical to
FT                   residues 1 to 450 of 450 from Escherichia coli K-12 Strain
FT                   MG1655: B0304"
FT                   /db_xref="EnsemblGenomes-Gn:Z0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54638"
FT                   /db_xref="GOA:A0A0H3JDL5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDL5"
FT                   /protein_id="AAG54638.1"
FT                   /translation="MNAFRQEIIMNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSN
FT                   AMYGGTCINIGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVI
FT                   NGQAEFINNHSLRVHRPEGNLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNL
FT                   KELPGHLGILGGGYIGVEFASMFANFGSKVTILEAASLFLPREERDIADNIATILRDQG
FT                   VDIILNAHVERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERG
FT                   AIVVDKRLHTTADNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGKRSTDDRKNVPYS
FT                   VFMTPPLSRVGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRIL
FT                   GASLLCVDSHEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
FT   gene            362944..363798
FT                   /gene="ykgD"
FT                   /locus_tag="Z0382"
FT   CDS_pept        362944..363798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgD"
FT                   /locus_tag="Z0382"
FT                   /product="putative ARAC-type regulatory protein"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 1 to 284 of 284 are 99.29 pct identical to
FT                   residues 1 to 284 of 284 from Escherichia coli K-12 Strain
FT                   MG1655: B0305"
FT                   /db_xref="EnsemblGenomes-Gn:Z0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54639"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDI7"
FT                   /protein_id="AAG54639.1"
FT                   /translation="MDALSRLLMLNAPQGTIDKNCVLGSDWQLPHGAGELSVIRWHALT
FT                   QGAAKLEMPTGEIFTLRPGNVVLLPQNSAHRLSHVDNESTCIVCGTLRLQHSARYFLTS
FT                   LPETLFLAPVNHSVEYNWLREAIPFLQQESRSAMPGVDALCSQICATFFTLAVREWIAQ
FT                   VNTEKNILSLLLHPRLGAVIQQMLEMPGHAWSVESLASIAHMSRASFAQLFRDVSGTTP
FT                   LAVLTKLRLQIAAQMFSREMLPVVVIAESVGYASESSFHKAFVREFGCTPGEYRERVRQ
FT                   LAP"
FT   gene            364325..365044
FT                   /gene="ykgE"
FT                   /locus_tag="Z0384"
FT   CDS_pept        364325..365044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="Z0384"
FT                   /product="putative dehydrogenase subunit"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 239 of 239 are 99.58 pct identical to
FT                   residues 1 to 239 of 239 from Escherichia coli K-12 Strain
FT                   MG1655: B0306"
FT                   /db_xref="EnsemblGenomes-Gn:Z0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54640"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3U3"
FT                   /protein_id="AAG54640.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
FT   gene            365055..366482
FT                   /gene="ykgF"
FT                   /locus_tag="Z0385"
FT   CDS_pept        365055..366482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="Z0385"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 475 of 475 are 99.57 pct identical to
FT                   residues 1 to 475 of 475 from Escherichia coli K-12 Strain
FT                   MG1655: B0307"
FT                   /db_xref="EnsemblGenomes-Gn:Z0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54641"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1V8"
FT                   /protein_id="AAG54641.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GLWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
FT   gene            366322..367170
FT                   /gene="ykgG"
FT                   /locus_tag="Z0386"
FT   CDS_pept        366322..367170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="Z0386"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 282 of 282 are 98.58 pct identical to
FT                   residues 1 to 282 of 282 from Escherichia coli K-12 Strain
FT                   MG1655: B0308"
FT                   /db_xref="EnsemblGenomes-Gn:Z0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54642"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBV1"
FT                   /protein_id="AAG54642.1"
FT                   /translation="MLMRQAGLSMAAKHHSNLARLATGWKHAIFLKLTERVSVVGLRNI
FT                   RRRRKRMDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQRCDAFIQF
FT                   ASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQQECNAVVW
FT                   DPAKGAKNISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESSLFILRKST
FT                   LLPRVAQLAERLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVKAVYLIIED
FT                   C"
FT   gene            complement(367125..367337)
FT                   /locus_tag="Z0387"
FT   CDS_pept        complement(367125..367337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0387"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 70 of 70 are 95.71 pct identical to
FT                   residues 1 to 70 of 70 from Escherichia coli K-12 Strain
FT                   MG1655: B0309"
FT                   /db_xref="EnsemblGenomes-Gn:Z0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6E3"
FT                   /protein_id="AAG54643.1"
FT                   /translation="MDACLFHCKYPGISNARIFTEEEHNHDGTGLSQVVLNAIFNLVCL
FT                   LQVYVQTSYLSQQSSIIRYTAFTGP"
FT   gene            complement(367665..368081)
FT                   /locus_tag="Z0388"
FT   CDS_pept        complement(367665..368081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0388"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 138 of 138 are 94.20 pct identical to
FT                   residues 1 to 138 of 222 from Escherichia coli K-12 Strain
FT                   MG1655: B0310"
FT                   /db_xref="EnsemblGenomes-Gn:Z0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1W2"
FT                   /protein_id="AAG54644.1"
FT                   /translation="MSEQIKQDIDLIEILFYLKKKILVILFIIAICMAMVLLFLYINKD
FT                   NIKVSYSLKINQTTPGILVNCDSNNNFACQTTMTEDVIQRITTFFHTSPDVKNREIKLE
FT                   WSGDKRDLPTAEAEISRVQASIIKWYASEYHNGR"
FT   misc_feature    368190..373468
FT                   /note="O-island #14; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(368263..368505)
FT                   /locus_tag="Z0389"
FT   CDS_pept        complement(368263..368505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0389"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 27 to 80 of 80 are 37.03 pct identical to
FT                   residues 412 to 465 of 465 from GenPept 118 :
FT                   gi|1657569|gb|AAB18097.1| (U73857) hypothetical protein
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54645"
FT                   /db_xref="GOA:Q8X6D9"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6D9"
FT                   /protein_id="AAG54645.1"
FT                   /translation="MYLCKTSLSGMLRDPQLLMLWLRLGDESVNASIDGAAFRVGAGVQ
FT                   ADITKNMGAYASLDYTKGDDIENPLQGVVGINVTW"
FT   gene            complement(368429..369538)
FT                   /locus_tag="Z0390"
FT   CDS_pept        complement(368429..369538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0390"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 23 to 365 of 369 are 24.16 pct identical to
FT                   residues 1115 to 1443 of 1557 from GenPept 118 :
FT                   gi|5929966|gb|AAD56660.1|AF180944_1 (AF180944) HmwA
FT                   [Haemophilus influenzae]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54646"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6D7"
FT                   /protein_id="AAG54646.1"
FT                   /translation="MENFFMKNSKAFYRSALATAIVMALSAPAFAADNAVSTDSVTLNK
FT                   DKTTLDQDVVISNTADKQITAVTINAADEDLNVAFAGHDITAESTADKKFVEGVKVSGN
FT                   KNVVINATDSTITAQGEGTYVRTAMVIDSTGDVVVNGGNFVAKNEKGSATGISLEGAKG
FT                   NNVTLNGTTINAQGNKSSSNASTAIFAQKGSLLNSFEGDATDNITLAGSNIINGRIETI
FT                   VTAGNKTGIHTVNLNIKDGSVIGAANNKQTIYASASAQGTGSATQNLNLSVADSTIYSD
FT                   VLALSESENSAATTTNVNMNVARSYWEGNAYTFNSGDKAGSNLDINLSDSSVWKGKVSG
FT                   AGNASVSLQNESVWNVTGSSTVDALAPSG"
FT   gene            complement(369565..370326)
FT                   /locus_tag="Z0391"
FT   CDS_pept        complement(369565..370326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0391"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54647"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C204"
FT                   /protein_id="AAG54647.1"
FT                   /translation="MRFVLFCPSGIVPAQFAALSTGSVGNVTCIGTEEELRNKLRHRPQ
FT                   SVVISAGRPAECAEMWFRFYRDHSFVVVLCVAPFFLPPDVSISGVLKNLRLLKPGMSVE
FT                   HVISIANSSGGLSGLKHAENLPVMDSYSVFMKEVNNRTKTIVMSERFPEKQKKVLSLLL
FT                   AGHSWEYSAQFLKTGIRQIWLAEQSLKKRWGIPDSMSLREALLLSSNKFHGDGNALEKT
FT                   NAMTLRENGNTNRYSVVVNAGTQVLSLHKYK"
FT   gene            complement(370480..370956)
FT                   /locus_tag="Z0392"
FT   CDS_pept        complement(370480..370956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0392"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54648"
FT                   /db_xref="GOA:Q8X6D4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6D4"
FT                   /protein_id="AAG54648.1"
FT                   /translation="MLTASRYQNQIIRWLLRPLPGDMSDFWLLTARELSVLKILMQGMS
FT                   FSEIARYEQRSSKTLHAIATRALMKLGLGTLSDFRLLYTGCGDSRVKRNIRLHARYVGQ
FT                   HSAHRLTQYVQNMVSGILYPEKVAVGESINSDAISGKVLPGQRKNISKKRPGLL"
FT   gene            complement(371156..371311)
FT                   /locus_tag="Z0393"
FT   CDS_pept        complement(371156..371311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0393"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54649"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3L7"
FT                   /protein_id="AAG54649.1"
FT                   /translation="MSGFVAMAWTSLNEEASGYYQCLSVYQAGTGVSHPSGQVYRAGVQ
FT                   QRHYRG"
FT   gene            complement(371604..371762)
FT                   /locus_tag="Z0394"
FT   CDS_pept        complement(371604..371762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0394"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 49 of 52 are 77.55 pct identical to
FT                   residues 137 to 185 of 198 from GenPept 118 :
FT                   gi|1790768|gb|AAC77269.1| (AE000502) recombinase involved
FT                   in phase variation; regulator for fimA [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54650"
FT                   /protein_id="AAG54650.1"
FT                   /translation="MLRHACGFALADNGVDTRLLQDYLGHRNIQHTVRYTASNAARFKG
FT                   VWKKKPR"
FT   gene            complement(371783..372166)
FT                   /locus_tag="Z0395"
FT   CDS_pept        complement(371783..372166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0395"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 3 to 116 of 127 are 49.12 pct identical to
FT                   residues 10 to 122 of 200 from GenPept 118 :
FT                   gi|1790767|gb|AAC77268.1| (AE000502) recombinase involved
FT                   in phase variation; regulator for fimA [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54651"
FT                   /db_xref="GOA:Q8X6C8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6C8"
FT                   /protein_id="AAG54651.1"
FT                   /translation="MTRKYLTQDEVYRLMDAAQSMSFPERNRCLIMMAFIHGFRASELL
FT                   DLRLSDIDASGKQLNIRRIKNGFSTTHPLLPDEYNLIKLWLKQRKLIENGVEGDWLFLS
FT                   RKRRPISRQHFFLSFVRLEDVQD"
FT   gene            372972..373223
FT                   /locus_tag="Z0397"
FT   CDS_pept        372972..373223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0397"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3L5"
FT                   /protein_id="AAG54652.1"
FT                   /translation="MLTVSGSEQVTIARNTSGVILKLSGISPAVYQCIHSTFISEIERV
FT                   SLEFAGEVVTMKHESYPYVLYNDSVPIPGTVTLNLIGS"
FT   gene            complement(373225..374913)
FT                   /gene="betA"
FT                   /locus_tag="Z0398"
FT   CDS_pept        complement(373225..374913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="Z0398"
FT                   /product="choline dehydrogenase, a flavoprotein"
FT                   /function="enzyme; Osmotic adaptation"
FT                   /note="Residues 1 to 556 of 562 are 98.56 pct identical to
FT                   residues 1 to 556 of 556 from Escherichia coli K-12 Strain
FT                   MG1655: B0311"
FT                   /db_xref="EnsemblGenomes-Gn:Z0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54653"
FT                   /db_xref="GOA:Q8X6C6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6C6"
FT                   /protein_id="AAG54653.1"
FT                   /translation="MQFDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRT
FT                   QMPAALAFPLQGKRYNWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDL
FT                   DNWAKEPGLENWSYLDCLPYYRKAETRDVGENDYHGGDGPVSVTTSKPGVNPLFEAMIE
FT                   AGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRTHAMT
FT                   DHIIFDCKRAVGVEWLEGDSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEF
FT                   DIPLVHDLPGVGENLQDHLEMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGVGAS
FT                   NHFEAGGFIRSREEFAWPNIQYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRI
FT                   KSRDPHQHPAILFNYMSHEQDWQEFRDAIRITREIMHQPALDQYRGREISPGTECQTDE
FT                   QLDEFVRNHAETAFHPCGTCKMGYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLN
FT                   ATTIMIGEKMADMIRGKEALPRSTAGYFVANGMPVRAKKMSRDLN"
FT   gene            complement(374927..376399)
FT                   /gene="betB"
FT                   /locus_tag="Z0399"
FT   CDS_pept        complement(374927..376399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="Z0399"
FT                   /product="NAD+-dependent betaine aldehyde dehydrogenase"
FT                   /function="enzyme; Osmotic adaptation"
FT                   /note="Residues 1 to 490 of 490 are 98.97 pct identical to
FT                   residues 1 to 490 of 490 from Escherichia coli K-12 Strain
FT                   MG1655: B0312"
FT                   /db_xref="EnsemblGenomes-Gn:Z0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54654"
FT                   /db_xref="GOA:Q7AH91"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AH91"
FT                   /protein_id="AAG54654.1"
FT                   /translation="MSRMAEQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGRED
FT                   VDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLETLDTGKAYSETSTV
FT                   DIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEHPGI
FT                   AKVSFTGGVASGKKVMANSAASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFS
FT                   SGQVCTNGTRVFVPAKCNAAFEQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRY
FT                   IAKGKEEGARVLCGGDVLKGDGLDNGAWVAPTVFTDCSDEMTIVREEIFGPVMSILTYE
FT                   SEDEVIRRANDTDYGLAAGIVTADLNRAHRVIHQLEAGICWINTWGESPAEMPVGGYKH
FT                   SGIGRENGVMTLQSYTQVKSIQVEMAKFQSIF"
FT   gene            complement(376413..377000)
FT                   /gene="betI"
FT                   /locus_tag="Z0400"
FT   CDS_pept        complement(376413..377000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="Z0400"
FT                   /product="probably transcriptional repressor of bet genes"
FT                   /function="putative regulator; Osmotic adaptation"
FT                   /note="Residues 1 to 195 of 195 are 97.94 pct identical to
FT                   residues 1 to 195 of 195 from Escherichia coli K-12 Strain
FT                   MG1655: B0313"
FT                   /db_xref="EnsemblGenomes-Gn:Z0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54655"
FT                   /db_xref="GOA:Q8X6C3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6C3"
FT                   /protein_id="AAG54655.1"
FT                   /translation="MPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGI
FT                   ISHYFRDKNGLLEATMRDITSQLRDAVLNRLHALPQGSAEQRLQAIVGGNFDETQVSSA
FT                   AMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPRHQAQEAGYGLAALIDG
FT                   LWLRAALSGKPLDKPLAHSLTRHFITQHLPTD"
FT   gene            377129..379162
FT                   /gene="betT"
FT                   /locus_tag="Z0401"
FT   CDS_pept        377129..379162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="Z0401"
FT                   /product="high-affinity choline transport"
FT                   /function="transport; Transport of small molecules: Other"
FT                   /note="Residues 1 to 677 of 677 are 100.00 pct identical to
FT                   residues 1 to 677 of 677 from Escherichia coli K-12 Strain
FT                   MG1655: B0314"
FT                   /db_xref="EnsemblGenomes-Gn:Z0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54656"
FT                   /db_xref="GOA:P0ABD0"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABD0"
FT                   /protein_id="AAG54656.1"
FT                   /translation="MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGR
FT                   TLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAG
FT                   IGIDLMFFSVAEPVTQYMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGY
FT                   FSYRYNLPLTIRSALYPIFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLS
FT                   VLFDIPDSMAAKAALIALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDT
FT                   SFLLNALVLNVGDYVNRFMGMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLAR
FT                   ISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSL
FT                   LAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAI
FT                   GLLTLGMLMTNGISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPR
FT                   PLGLQDRLSWKKRLSRLMNYPGTRYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPP
FT                   EEGQQLGHLDLLVHMGEEQNFVYQIWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQG
FT                   NDLMDYSKEQVITDILDQYERHLNFIHLHREAPGHSVMFPDA"
FT   misc_feature    379203..383845
FT                   /note="O-island #15; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            379670..383719
FT                   /locus_tag="Z0402"
FT   CDS_pept        379670..383719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0402"
FT                   /product="putative beta-barrel outer membrane protein"
FT                   /function="putative membrane; Extracellular functions:
FT                   Secreted proteins"
FT                   /note="Residues 874 to 1349 of 1349 are 55.13 pct identical
FT                   to residues 5 to 466 of 466 from GenPept 118 :
FT                   gi|1787787|gb|AAC74582.1| (AE000248) putative ATP-binding
FT                   component of a transport system and adhesin protein
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54657"
FT                   /db_xref="GOA:Q8X6C1"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6C1"
FT                   /protein_id="AAG54657.1"
FT                   /translation="MAFNALLFMQSWFYLDVLLEIVMNKIYRLKWNRSRNCWSVCSELG
FT                   SRVKGKKSRAVLISAISLYSSLVFADDVIVNQDKTIDFGKENQSIDYRITVTDNANLVI
FT                   NATDTSRPRLTLASGGGLDITGGKVTINGPLNFLLKGTGFLNVSNAGSELYADDLYESN
FT                   SGMRHDRGYFNVSNGGKIHVKGTSRLTYLQGNVSGEGSQVNSETFFMGVYGSYGGNQYL
FT                   SVNNGGEVNARKQISLGYYDQVSDTTLAVSEGGKISAPTISLSTNSELALGAQEGSAAK
FT                   AAGIIDAEKIEFVWAKTSEKKITLNHTDKDATISADIVSGSEGLGYINALNGTTYLTGD
FT                   NSAFSGKVKIEQNGALGITQNIGTAEINNRGKLHLKADDSMTFANKISGNGTISIDSGT
FT                   VELTGNNYAFSGYIDVASGAVAVISEDKNIGRAELDVDGKLQINANKDWVFDNDLEGRG
FT                   IVEINMGNHEFSFDEFAYTDWFQGSLAFQNTTFNLEKNAEFLQKGGITAGQGSLVTVGK
FT                   GAHSISTLGFSGGTVDFGALTAGAQMTEGTVNVSKTLDLRGEGVIQVSDSDVVRSVSRD
FT                   IDSALSLTEVDDGNSTIKLVDAQGAEVLGDAGNLQLQDKNGQILSSSAQRDIQQNGQKA
FT                   AVGTYDYRLTSGVNNDGLYIGYGLTQLDLHATDSDALVLSSNGKSENAADLSAKITGSG
FT                   DLAFSSQKGQTVSLSNKDNDYTGVTDLRSGTLLLNNDNVLGNTHELRLAAETELDMNGH
FT                   SQTVGTLNGSADSLLSLNGGSLTVTNGGTSTGSLTGSGELNIQGGTLDIAGDNSNLTAN
FT                   VNIANSANVLVSHAQGLGSANVENNGTLALNNSAEKRAAASVNYALGGNLTNNGTLMTG
FT                   MSGQQAGNVLVVKGNYHGNNGQLVMNTVLNGDDSVTDKLVVEGDTSGTTAVTVNNAGGT
FT                   GAKTLNGIELIHVDGKSEGEFVQAGRIVAGAYDYTLARGQGANSGNWYLTSGSDSPELQ
FT                   PEPDPMPNPEPNPNPEPNPNPTPTPGPDLNVDNDLRPEAGSYIANLAAANTMFTTRLHE
FT                   RLGNTYYTDMVTGEQKQTTMWMRHEGGHNKWRDGSGQLKTQSNRYVLQLGGDVAQWSQN
FT                   GSDRWHVGVMAGYGNSDSKTISSRTGYRAKASVNGYSTGLYATWYADDESRNGAYLDSW
FT                   AQYSWFDNTVKGDDLQSESYKSKGFTASLEAGYKHKLAEFNGSQGTRNEWYVQPQAQVT
FT                   WMGVKADKHRESNGTLVHSNGDGNVQTRLGVKTWLKSHHKMDDGKSREFQPFVEVNWLH
FT                   NSKDFSTSMDGVSVTQDGARNIAEIKTGVEGQLNANLNVWGNVGVQVADRGYNDTSAMV
FT                   GIKWQF"
FT   gene            383852..384949
FT                   /gene="yahA"
FT                   /locus_tag="Z0403"
FT   CDS_pept        383852..384949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahA"
FT                   /locus_tag="Z0403"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 4 to 365 of 365 are 93.09 pct identical to
FT                   residues 1 to 362 of 362 from Escherichia coli K-12 Strain
FT                   MG1655: B0315"
FT                   /db_xref="EnsemblGenomes-Gn:Z0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54658"
FT                   /db_xref="GOA:Q8X6B9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B9"
FT                   /protein_id="AAG54658.1"
FT                   /translation="MCSMASHDLSVFLEEFGATVNLTLPGIVSEKERLLLKLLMEGMSV
FT                   TEISQYRNRSAKTISHQKKQLYEKLGIQSDITFWRDIFFQYHPQVISGTGNKNNFYIPD
FT                   NRCHHIVTPEAISLALENHEFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFI
FT                   PLAESSGLIVIMTRQLMKQTADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLV
FT                   KKLGNDKIKLVLELTERNPIPVTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFP
FT                   VDFIKIDKSFVQMAGVDEISGHIVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHF
FT                   LQGYLYSPPVPGNKFISEWVMKAGG"
FT   gene            complement(384991..385251)
FT                   /locus_tag="Z0404"
FT   CDS_pept        complement(384991..385251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0404"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 86 of 86 are 96.51 pct identical to
FT                   residues 225 to 310 of 310 from Escherichia coli K-12
FT                   Strain MG1655: B0316"
FT                   /db_xref="EnsemblGenomes-Gn:Z0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCE7"
FT                   /protein_id="AAG54659.1"
FT                   /translation="MPDFNTKCQCQILGEGIVFLPDYMVREAMAQSLLVTRQIHNPRQD
FT                   SRMLLATQHSATGQVTQWIKKQFAPNGILTGIYQDLLHREN"
FT   gene            complement(385212..385922)
FT                   /locus_tag="Z0405"
FT   CDS_pept        complement(385212..385922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0405"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 188 of 236 are 98.93 pct identical to
FT                   residues 1 to 188 of 310 from Escherichia coli K-12 Strain
FT                   MG1655: B0316"
FT                   /db_xref="EnsemblGenomes-Gn:Z0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54660"
FT                   /db_xref="GOA:A0A0H3JFS0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFS0"
FT                   /protein_id="AAG54660.1"
FT                   /translation="MNSIFTEENLLAFTTAARFGSFSKAAEELGLTTSAISYTIKRMET
FT                   GLDVVLFTRSTRSIELTESGRYFFRKATDLLNDFHAIKRSIDTISQGIEARVRICINQL
FT                   LYTPKHTARLLQVLKKQFPTCQITVTTEVYNGVWDAIINNQANIAIGAPDTLLDGGGID
FT                   YTEIGAIRWAFAIAPDHPLAFVPEPSPKANCVSTLILWWRTPRIRLIKKWAGCCTGRSQ
FT                   FWCQISTPNVSARF"
FT   gene            complement(386014..386316)
FT                   /locus_tag="Z0406"
FT   CDS_pept        complement(386014..386316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0406"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 100 of 100 are 98.00 pct identical to
FT                   residues 66 to 165 of 165 from Escherichia coli K-12 Strain
FT                   MG1655: B0317"
FT                   /db_xref="EnsemblGenomes-Gn:Z0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54661"
FT                   /db_xref="GOA:A0A384KZ86"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZ86"
FT                   /protein_id="AAG54661.1"
FT                   /translation="MVWAFFAALAAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWL
FT                   LSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRDGY"
FT   gene            386779..387384
FT                   /gene="yahD"
FT                   /locus_tag="Z0407"
FT   CDS_pept        386779..387384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="Z0407"
FT                   /product="putative transcription factor"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 1 to 201 of 201 are 99.50 pct identical to
FT                   residues 1 to 201 of 201 from Escherichia coli K-12 Strain
FT                   MG1655: B0318"
FT                   /db_xref="EnsemblGenomes-Gn:Z0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54662"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Y2"
FT                   /protein_id="AAG54662.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNGDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
FT   gene            387424..388287
FT                   /gene="yahE"
FT                   /locus_tag="Z0408"
FT   CDS_pept        387424..388287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="Z0408"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 287 of 287 are 97.90 pct identical to
FT                   residues 1 to 287 of 287 from Escherichia coli K-12 Strain
FT                   MG1655: B0319"
FT                   /db_xref="EnsemblGenomes-Gn:Z0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54663"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C218"
FT                   /protein_id="AAG54663.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   RLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVIDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLALILFISGHPAGKYKEEFYLGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
FT   gene            388277..389824
FT                   /gene="yahF"
FT                   /locus_tag="Z0409"
FT   CDS_pept        388277..389824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="Z0409"
FT                   /product="putative oxidoreductase subunit"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 515 of 515 are 98.64 pct identical to
FT                   residues 1 to 515 of 515 from Escherichia coli K-12 Strain
FT                   MG1655: B0320"
FT                   /db_xref="EnsemblGenomes-Gn:Z0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54664"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C214"
FT                   /protein_id="AAG54664.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRGETPVDEQGLQFARGTKEAALKAVMLSGVKQEHLDLHTLNQPLITDVRARLKPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHSDVYSNIQPDPEFRLKDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
FT   gene            389824..391242
FT                   /gene="yahG"
FT                   /locus_tag="Z0410"
FT   CDS_pept        389824..391242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="Z0410"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 472 of 472 are 99.15 pct identical to
FT                   residues 1 to 472 of 472 from Escherichia coli K-12 Strain
FT                   MG1655: B0321"
FT                   /db_xref="EnsemblGenomes-Gn:Z0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54665"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2D8"
FT                   /protein_id="AAG54665.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQFDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVAQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAVDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
FT   misc_feature    391614..391707
FT                   /note="O-island #16; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            391757..392707
FT                   /gene="yahI"
FT                   /locus_tag="Z0412"
FT   CDS_pept        391757..392707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="Z0412"
FT                   /product="putative kinase"
FT                   /function="putative enzyme; Not classified"
FT                   /EC_number="2.7.2.2"
FT                   /note="Residues 1 to 316 of 316 are 98.41 pct identical to
FT                   residues 1 to 316 of 316 from Escherichia coli K-12 Strain
FT                   MG1655: B0323"
FT                   /db_xref="EnsemblGenomes-Gn:Z0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54666"
FT                   /db_xref="GOA:A0A4V1RTJ1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1RTJ1"
FT                   /protein_id="AAG54666.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSESQRDELQKANPDWRFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPEKQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
FT   gene            392717..394099
FT                   /gene="yahJ"
FT                   /locus_tag="Z0413"
FT   CDS_pept        392717..394099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="Z0413"
FT                   /product="putative deaminase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 460 of 460 are 97.82 pct identical to
FT                   residues 1 to 460 of 460 from Escherichia coli K-12 Strain
FT                   MG1655: B0324"
FT                   /db_xref="EnsemblGenomes-Gn:Z0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54667"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3V8"
FT                   /protein_id="AAG54667.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGTSVPLAHAAVSGTTNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQNGKIVALRENKQHPDATLP
FT                   HYDAGDKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   SGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELAHRMAAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
FT   misc_feature    394161..399418
FT                   /note="O-island #17; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            394398..394808
FT                   /locus_tag="Z0414"
FT   CDS_pept        394398..394808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0414"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 19 to 113 of 136 are 35.41 pct identical to
FT                   residues 57 to 152 of 190 from GenPept 118 :
FT                   gi|3449253|emb|CAA20397.1| (AL031317) SC6G4.19c, unknown,
FT                   len: 190 aa; contains Pro-Ser- r ich domain at N-terminus
FT                   [Streptomyces coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54668"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1X6"
FT                   /protein_id="AAG54668.1"
FT                   /translation="MTIKEKFSQKYPHASFCTFGDSAALADHLATLIATGVKTASCGSL
FT                   AGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTAELARKEGEGDLSLEY
FT                   WRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
FT   gene            395059..396045
FT                   /locus_tag="Z0415"
FT   CDS_pept        395059..396045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0415"
FT                   /product="putative periplasmic binding protein, probable
FT                   substrate ribose"
FT                   /function="putative factor; Transport of small molecules:
FT                   Carbohydrates, organic acids, alcohols"
FT                   /note="Residues 16 to 324 of 328 are 27.38 pct identical to
FT                   residues 15 to 335 of 340 from GenPept 118 :
FT                   gi|1787795|gb|AAC74589.1| (AE000249) putative LACI-type
FT                   transcriptional regulator [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54669"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C390"
FT                   /protein_id="AAG54669.1"
FT                   /translation="MMNKRFVINMVSSLLLGAALISAPLQAAEKVVVNISKVDGMPWFN
FT                   RMGEGVVEAGKAFGVNASQVGPSSTDAPQQVKIIEDLIARKVNAITIVPNDANVLEPVF
FT                   KKARDAGIVVLTNESPGQPSANWDIEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLT
FT                   VPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDVSRRTTLDLMKTYPDLKAVVSFG
FT                   SNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPASAGYALAAVA
FT                   STLLKGEEIKPGLEMQNLGKADVDMDKRIIRFHKVLLVNKDNIDSLY"
FT   gene            396094..396354
FT                   /locus_tag="Z0416"
FT   CDS_pept        396094..396354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0416"
FT                   /product="putative ATP-binding component of transport
FT                   system"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 5 to 86 of 86 are 53.65 pct identical to
FT                   residues 13 to 93 of 104 from GenPept 118 :
FT                   gi|5459215|emb|CAB48888.1| (AL096837) putative ABC
FT                   transporter ATP-binding protein [Streptomyces coelicolor
FT                   A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54670"
FT                   /db_xref="GOA:A0A0H3JCF2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCF2"
FT                   /protein_id="AAG54670.1"
FT                   /translation="METFLSLRHINKTFHATRALRDVSLDFMSGEVHCLAGQNGCGKST
FT                   LIKIMSGVYRPDEGAEITLGGKNWSKLTPAASVAQGIQVIY"
FT   gene            396400..397578
FT                   /locus_tag="Z0417"
FT   CDS_pept        396400..397578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0417"
FT                   /product="putative ATP-binding component of transport
FT                   system, probably ribose specific"
FT                   /function="putative transport; Transport of small
FT                   molecules: Carbohydrates, organic acids, alcohols"
FT                   /note="Residues 13 to 392 of 392 are 36.64 pct identical to
FT                   residues 114 to 491 of 493 from GenPept 118 :
FT                   gi|2636119|emb|CAB15611.1| (Z99122) ribose ABC transporter
FT                   (ATP-binding protein) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54671"
FT                   /db_xref="GOA:A0A384L2N5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2N5"
FT                   /protein_id="AAG54671.1"
FT                   /translation="MNHYHHGLFVNRRRLREVAQAAMTSINVTLPLDTLVSELSIARCQ
FT                   LVAICRALAQDARLIVMDEPTASLTHQEVQGLLQVVHQLRERGICVVFVSHRLEEVMEV
FT                   SDRISVLKDGELVGTFPAAEMTTKQLGFLMTGQEFEYQVRELWQGKSSTPVLEVRNLSR
FT                   HGEYLNINLRVEAGEVVSIVGLLGAGRTELCLSLFGMTRPDAGEILINGQLVTLHSNQD
FT                   AIRHGIGYVSEDRMSRGLVMAQSIEDNIISTVFHKVKDRFGFLSETKVRDLVDRLIKAL
FT                   TIKVSDPHLPVNTLSGGNAQRVSIAKWLAIGPRLLILDSPTVGVDIANKAGIYGIISDL
FT                   AAHGIAVLMICDEIEEAWYQSHRILVMQKGQITHSFLPDSSSQARIAEVVNG"
FT   gene            397571..398542
FT                   /locus_tag="Z0418"
FT   CDS_pept        397571..398542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0418"
FT                   /product="putative permease component of transport system,
FT                   probably ribose specific"
FT                   /function="putative transport; Transport of small
FT                   molecules: Carbohydrates, organic acids, alcohols"
FT                   /note="Residues 16 to 309 of 323 are 36.05 pct identical to
FT                   residues 32 to 316 of 651 from GenPept 118 :
FT                   gi|6714794|emb|CAB66286.1| (AL136519) bifunctional
FT                   carbohydrate binding and transport protein. [Streptomyces
FT                   coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54672"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Z0"
FT                   /protein_id="AAG54672.1"
FT                   /translation="MAELKKRHEFWLALLIVVLFVGLAWRSDEFLTFGNLYDLANNYAM
FT                   LTILACGLFVVLISGGIDISFPAMTIIAQYGMVLLLQKIGGNFAVAFALAGCIGILLGL
FT                   INALLVNRLRVPSIIITISTLNIFYGLLLWLSKGVWLYDFPPWFEQGVMLFKYTDADGY
FT                   DYGLGLPLIAMITVVLLTAFIMNFTSVGRKIYALGGNRESASRIGFSVLKLQLFVYGYM
FT                   GLMSGAAGVVQSWTVMTVAPDSLLGYELTVLAAVVLGGTSLLGGRGTLTGTLLGVVLLA
FT                   VMQNGLNLLGVSSYWQTLITGIIIVASISATAWSQHQNRSLL"
FT   gene            398539..399495
FT                   /locus_tag="Z0419"
FT   CDS_pept        398539..399495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0419"
FT                   /product="putative permease component of transport system,
FT                   probably ribose specific"
FT                   /function="putative transport; Transport of small
FT                   molecules: Carbohydrates, organic acids, alcohols"
FT                   /note="Residues 14 to 303 of 318 are 34.69 pct identical to
FT                   residues 26 to 311 of 322 from GenPept 118 :
FT                   gi|2636120|emb|CAB15612.1| (Z99122) ribose ABC transporter
FT                   (permease) [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54673"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C227"
FT                   /protein_id="AAG54673.1"
FT                   /translation="MKKSWRNNVEFYLIGLLVLTVAAFSITMPEIFWSISNFQSVASQM
FT                   PVLGILALAMAVTMLCGGINLSIIATANACSLVMAWVATQYPPGIATVVATLLAGAGAA
FT                   VIIGLCNGVLIAGIRVLPILATLGMMTLLKGINILVTGGSAIANYPSWVLWLNHAQWFG
FT                   IPLPMWLFAAVALGLWILLEKTPLGKAIYLIGSNERATLYSGINTRRVLIWVYVISALL
FT                   CAVAAFLMMSKLNSAKASYGESYLLVSILAAVLGGVNPDGGSGRIIGMVLALFLLQIIE
FT                   SGFNILGISPYLTMALWGTLLLCFIQARGMLGLDRVV"
FT   gene            399582..400631
FT                   /gene="yahK"
FT                   /locus_tag="Z0420"
FT   CDS_pept        399582..400631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahK"
FT                   /locus_tag="Z0420"
FT                   /product="putative oxidoreductase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 349 of 349 are 99.42 pct identical to
FT                   residues 1 to 349 of 349 from Escherichia coli K-12 Strain
FT                   MG1655: B0325"
FT                   /db_xref="EnsemblGenomes-Gn:Z0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54674"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C222"
FT                   /protein_id="AAG54674.1"
FT                   /translation="MKIKAVGSYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLH
FT                   QVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKHAPGDLVGVGCIVDSCKHCEECEDGLE
FT                   NYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLRIRHPQEQLAAVAPLLCAGITT
FT                   YSPLRHWQAGPGKKVGVVGIGGLGHMGIKLAHAMGAHVVAFTTSEAKREAAKALGADEV
FT                   VNSRNADEMAAHLKSFDFILNTVAAPHNLDDFTTLLKRDGTMTLVGAPATPHKSPEVFN
FT                   LIMKRRAIAGSMIGGIPETQEMLDFCAEHGIVADIEMIRADQINEAYERMLRGDVKYRF
FT                   VIDNRTLTD"
FT   gene            400874..401689
FT                   /gene="yahL"
FT                   /locus_tag="Z0421"
FT   CDS_pept        400874..401689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="Z0421"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 271 of 271 are 98.15 pct identical to
FT                   residues 1 to 271 of 271 from Escherichia coli K-12 Strain
FT                   MG1655: B0326"
FT                   /db_xref="EnsemblGenomes-Gn:Z0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TZC5"
FT                   /protein_id="AAG54675.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFRILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFINSVRTDCKCI
FT                   LLEHHMPLLRLFPKGKECMHVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIYPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEGISNRVQELGDRYYPVNKHVKIRYTL"
FT   gene            402035..402115
FT                   /locus_tag="Z0422"
FT   tRNA            402035..402115
FT                   /locus_tag="Z0422"
FT                   /product="tRNA-OTHER"
FT                   /function="RNA; tRNA"
FT                   /note="anticodon: ???"
FT   gene            402210..402350
FT                   /locus_tag="Z0423"
FT   CDS_pept        402210..402350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0423"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 46 of 46 are 95.65 pct identical to
FT                   residues 46 to 91 of 91 from Escherichia coli K-12 Strain
FT                   MG1655: B0327"
FT                   /db_xref="EnsemblGenomes-Gn:Z0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFT5"
FT                   /protein_id="AAG54676.1"
FT                   /translation="MKKAHTGESGLKWEAKDSSKLIGNKDHALRGLSSPMVGIRQIRLI
FT                   T"
FT   gene            complement(402367..403038)
FT                   /gene="yahN"
FT                   /locus_tag="Z0424"
FT   CDS_pept        complement(402367..403038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="Z0424"
FT                   /product="putative cytochrome subunit of dehydrogenase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 223 of 223 are 99.55 pct identical to
FT                   residues 1 to 223 of 223 from Escherichia coli K-12 Strain
FT                   MG1655: B0328"
FT                   /db_xref="EnsemblGenomes-Gn:Z0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54677"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2L8"
FT                   /protein_id="AAG54677.1"
FT                   /translation="MMQLVHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTS
FT                   LASGRRAGVLTGLGVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCS
FT                   MRRQSTPQMSTLQQPINAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARL
FT                   MAWAGIVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQ
FT                   R"
FT   gene            403185..403460
FT                   /gene="yahO"
FT                   /locus_tag="Z0425"
FT   CDS_pept        403185..403460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="Z0425"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 91 of 91 are 97.80 pct identical to
FT                   residues 1 to 91 of 91 from Escherichia coli K-12 Strain
FT                   MG1655: B0329"
FT                   /db_xref="EnsemblGenomes-Gn:Z0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54678"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDJ0"
FT                   /protein_id="AAG54678.1"
FT                   /translation="MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTADIYKKK"
FT   gene            complement(403558..405144)
FT                   /gene="prpR"
FT                   /locus_tag="Z0426"
FT   CDS_pept        complement(403558..405144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="Z0426"
FT                   /product="regulator for prp operon"
FT                   /function="regulator; Not classified"
FT                   /note="Residues 1 to 528 of 528 are 99.05 pct identical to
FT                   residues 1 to 528 of 528 from Escherichia coli K-12 Strain
FT                   MG1655: B0330"
FT                   /db_xref="EnsemblGenomes-Gn:Z0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54679"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3X2"
FT                   /protein_id="AAG54679.1"
FT                   /translation="MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLG
FT                   FEKAVTYIRKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLT
FT                   SSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLIT
FT                   DLAEEAGMTGIFIYSAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQS
FT                   PQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAV
FT                   NCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLL
FT                   RVLEEKEVTRVGGHQPVPVDVRVISATHCNLEEDMRQGQFRRDLFYRLSILRLQLPPLR
FT                   ERVADILPLAESFLKVSLAALSAPFSAALRQGLQASETVLVHYDWPGNIRELRNMMERL
FT                   ALFLSVEPTPDLTPQFLQLLLPELARESAKIPAPRLLTPQQALEKFNGDKTAAANYLGI
FT                   SRTTFWRRLKS"
FT   gene            405383..406273
FT                   /gene="prpB"
FT                   /locus_tag="Z0427"
FT   CDS_pept        405383..406273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="Z0427"
FT                   /product="putative phosphonomutase 2"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 296 of 296 are 98.64 pct identical to
FT                   residues 1 to 296 of 296 from Escherichia coli K-12 Strain
FT                   MG1655: B0331"
FT                   /db_xref="EnsemblGenomes-Gn:Z0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54680"
FT                   /db_xref="GOA:A0A4Q0C1Y4"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Y4"
FT                   /protein_id="AAG54680.1"
FT                   /translation="MSLHSPGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVARTVKSM
FT                   IKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTDALA
FT                   VEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTT
FT                   DELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYH
FT                   YEEKLDDLFVRSQAK"
FT   gene            406429..407598
FT                   /gene="prpC"
FT                   /locus_tag="Z0428"
FT   CDS_pept        406429..407598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="Z0428"
FT                   /product="putative citrate synthase; propionate metabolism"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 389 of 389 are 99.22 pct identical to
FT                   residues 1 to 389 of 389 from Escherichia coli K-12 Strain
FT                   MG1655: B0333"
FT                   /db_xref="EnsemblGenomes-Gn:Z0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54681"
FT                   /db_xref="GOA:A0A4Q0C399"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C399"
FT                   /protein_id="AAG54681.1"
FT                   /translation="MSDTTILQNSTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPSQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVESKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSQEGGSLKMYNIADRLETVMWESKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYVGPEDRQFVALDKRQ"
FT   gene            407632..409083
FT                   /gene="prpD"
FT                   /locus_tag="Z0429"
FT   CDS_pept        407632..409083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="Z0429"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 483 of 483 are 99.37 pct identical to
FT                   residues 1 to 483 of 483 from Escherichia coli K-12 Strain
FT                   MG1655: B0334"
FT                   /db_xref="EnsemblGenomes-Gn:Z0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54682"
FT                   /db_xref="GOA:Q8X693"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X693"
FT                   /protein_id="AAG54682.1"
FT                   /translation="MSAQINNIRPEFDREIVDIVDYVMNYEISSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTMKQVLTGMIKAHEIQGCIALENS
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAPVWGFYDVSFKGESFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVSIRTHEACIRIIDKKGPLNN
FT                   PADRDHCIQYMVAIPLLFGRLTAADYEDNVAQDKRIDALREKINCFEDPVFTADYHDPE
FT                   KRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQR
FT                   ILEVSLDRARLEQMPVNEYLDLYVI"
FT   gene            409123..411009
FT                   /gene="prpE"
FT                   /locus_tag="Z0430"
FT   CDS_pept        409123..411009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="Z0430"
FT                   /product="putative propionyl-CoA synthetase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 628 of 628 are 99.36 pct identical to
FT                   residues 1 to 628 of 628 from Escherichia coli K-12 Strain
FT                   MG1655: B0335"
FT                   /db_xref="EnsemblGenomes-Gn:Z0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54683"
FT                   /db_xref="GOA:A0A4Q0C1Z9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Z9"
FT                   /protein_id="AAG54683.1"
FT                   /translation="MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARW
FT                   FCEGRTNLCHNAIDRWLEKQPEALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLG
FT                   VQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSAD
FT                   AGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGA
FT                   RVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWKIVEKYQVSRMFSAPTAIRVL
FT                   KKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA
FT                   RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDD
FT                   DRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSH
FT                   PGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQEKAIMALVDSQIGNFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLNQIRQAMEE"
FT   misc_feature    411034..411598
FT                   /note="O-island #18; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(411372..411509)
FT                   /locus_tag="Z0431"
FT   CDS_pept        complement(411372..411509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0431"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54684"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3K9"
FT                   /protein_id="AAG54684.1"
FT                   /translation="MRCERLIRPTVQACRHDKTHQRRIRHLRMVSDAARAPYPTYGSGL
FT                   "
FT   gene            411903..413162
FT                   /gene="codB"
FT                   /locus_tag="Z0432"
FT   CDS_pept        411903..413162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="Z0432"
FT                   /product="cytosine permease/transport"
FT                   /function="transport; Transport of small molecules:
FT                   Nucleosides, purines, pyrimidines"
FT                   /note="Residues 1 to 419 of 419 are 99.76 pct identical to
FT                   residues 1 to 419 of 419 from Escherichia coli K-12 Strain
FT                   MG1655: B0336"
FT                   /db_xref="EnsemblGenomes-Gn:Z0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54685"
FT                   /db_xref="GOA:Q8X691"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X691"
FT                   /protein_id="AAG54685.1"
FT                   /translation="MSQDNNFSQGPVPQSARKGVLALTFVMLGLTFFSASMWTGGTLGT
FT                   GLSYHDFFLAVLIGNLLLGIYTSFLGYIGAKTGLTTHLLARFSFGVKGSWLPSLLLGGT
FT                   QVGWFGVGVAMFAIPVGKATGLDINLLIAVSGLLMTVTVFFGISALTVLSLIAVPAIAC
FT                   LGGYSVWLAVNGMGGLDALKAVVPAQPLDFNVALALVVGSFISAGTLTADFVRFGRNAK
FT                   LAVLVAMVAFFLGNSLMFIFGAAGAAALGMADISDVMIAQGLLLPAIVVLGLNIWTTND
FT                   NALYASGLGFANITGMSSKTLSVINGIIGTVCALWLYNNFVGWLTFLSAAIPPVGGVII
FT                   ADYLMNRRRYEHFATTRMMSVNWVAILAVALGIAAGHWLPGIVPVNAVLGGALSYLILN
FT                   PILNRKTTAAMTHVEANSVE"
FT   gene            413152..414435
FT                   /gene="codA"
FT                   /locus_tag="Z0433"
FT   CDS_pept        413152..414435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="Z0433"
FT                   /product="cytosine deaminase"
FT                   /function="enzyme; Central intermediary metabolism: Salvage
FT                   of nucleosides and nucleotides"
FT                   /note="Residues 1 to 427 of 427 are 99.06 pct identical to
FT                   residues 1 to 427 of 427 from Escherichia coli K-12 Strain
FT                   MG1655: B0337"
FT                   /db_xref="EnsemblGenomes-Gn:Z0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54686"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C232"
FT                   /protein_id="AAG54686.1"
FT                   /translation="MSNNALQTIINARLPGKEGLWQIHLQDGKISAIDAQSGVMPITEN
FT                   SLDAEQGLVIPPFVEPHIHLDTTQTAGQPNWNQSGTLFEGIERWAERKALLTHDDVKQR
FT                   AWQTLKWQIANGIQHVRTHVDVSDATLTALKAMLEVKLEVAPWIDLQIVAFPQEGILSY
FT                   PNGEALLEEALRLGADVVGAIPHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDE
FT                   QSRFVETVAALAHREGMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNI
FT                   HLQGRFDTYPKRRGITRVKEMLESGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQ
FT                   LMGYGQINDGLNLITHHSARTLNLQDYSIAAGNSANLIILPAENGFDALRRQVPVRYSV
FT                   RGGKVIASTQPAQTTVYLEQPEAIDYKR"
FT   gene            complement(414568..415467)
FT                   /gene="cynR"
FT                   /locus_tag="Z0434"
FT   CDS_pept        complement(414568..415467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynR"
FT                   /locus_tag="Z0434"
FT                   /product="cyn operon positive regulator"
FT                   /function="regulator; Central intermediary metabolism:
FT                   Pool, multipurpose conversions of intermed. met'm"
FT                   /note="Residues 1 to 299 of 299 are 96.32 pct identical to
FT                   residues 1 to 299 of 299 from Escherichia coli K-12 Strain
FT                   MG1655: B0338"
FT                   /db_xref="EnsemblGenomes-Gn:Z0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54687"
FT                   /db_xref="GOA:Q8X4M5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X4M5"
FT                   /protein_id="AAG54687.1"
FT                   /translation="MLSRHINYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGV
FT                   PLFDRSGRTIHLTDAGEVWRQYASRALQELGAGKRAIHDVADLTRGSLRIAVTPTFTSY
FT                   FIGPLMADFYARYPGITLQLQEMSQEKIEDLLCRDELDVGIAFAPVHLPELEAIPLLTE
FT                   SLALVVAQHHPLAACEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLHPQVVIEAN
FT                   SISAVLELIRRTSLSTLLPAAIATQHDGLKAIPLAPPLLERTAVLLRRKNSWQTAAAKA
FT                   FLHMALEECADVGENESR"
FT   gene            415577..416236
FT                   /gene="cynT"
FT                   /locus_tag="Z0435"
FT   CDS_pept        415577..416236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="Z0435"
FT                   /product="carbonic anhydrase"
FT                   /function="enzyme; Central intermediary metabolism: Pool,
FT                   multipurpose conversions of intermed. met'm"
FT                   /note="Residues 1 to 219 of 219 are 100.00 pct identical to
FT                   residues 1 to 219 of 219 from Escherichia coli K-12 Strain
FT                   MG1655: B0339"
FT                   /db_xref="EnsemblGenomes-Gn:Z0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54688"
FT                   /db_xref="GOA:P0ABF0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABF0"
FT                   /protein_id="AAG54688.1"
FT                   /translation="MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLV
FT                   PELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVSDIVICGHSNCGAM
FT                   TAIASCQCMDHMPAVSHWLRYADSARVVNEARPHSDLPSKAAAMVRENVIAQLANLQTH
FT                   PSVRLALEEGRIALHGWVYDIESGSIAAFDGATRQFVPLAANPRVCAIPLRQPTAA"
FT   gene            416267..416737
FT                   /gene="cynS"
FT                   /locus_tag="Z0436"
FT   CDS_pept        416267..416737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="Z0436"
FT                   /product="cyanate aminohydrolase, cyanase"
FT                   /function="enzyme; Central intermediary metabolism: Pool,
FT                   multipurpose conversions of intermed. met'm"
FT                   /note="Residues 1 to 156 of 156 are 98.71 pct identical to
FT                   residues 1 to 156 of 156 from Escherichia coli K-12 Strain
FT                   MG1655: B0340"
FT                   /db_xref="EnsemblGenomes-Gn:Z0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54689"
FT                   /db_xref="GOA:P58704"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58704"
FT                   /protein_id="AAG54689.1"
FT                   /translation="MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTA
FT                   ALLGQQALPADAARQVGAKLDLDEDAILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVY
FT                   GTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF"
FT   gene            416770..417924
FT                   /gene="cynX"
FT                   /locus_tag="Z0437"
FT   CDS_pept        416770..417924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynX"
FT                   /locus_tag="Z0437"
FT                   /product="cyanate transport"
FT                   /function="transport; Transport of small molecules: Anions"
FT                   /note="Residues 1 to 384 of 384 are 98.43 pct identical to
FT                   residues 1 to 384 of 384 from Escherichia coli K-12 Strain
FT                   MG1655: B0341"
FT                   /db_xref="EnsemblGenomes-Gn:Z0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54690"
FT                   /db_xref="GOA:A0A0H3JDP7"
FT                   /db_xref="InterPro:IPR004747"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDP7"
FT                   /protein_id="AAG54690.1"
FT                   /translation="MLLVLVLIGLNMRPLLTSVGPLLPQLRQASGMSFSVAALLTALPV
FT                   VTMGGLALAGSWLHQHVSERRSVAISLLLIAVGALMRELYPQSALLLSSALLGGVGIGI
FT                   IQAVMPSVIKRRFQQRTPLVMGLWSAALMGGGGLGAALTPWLVQHSETWYQTLAWWALP
FT                   AVVALFAWWWQSTREVASSHKTTTIPVRVVFTPRAWTLGVYFGLINGGYASLIAWLPAF
FT                   YIEIGASAQYSGSLLALMTLGQAAGALLMPAMARHQDRRKLLMLALALQLVGFCGFIWL
FT                   PLQLPVLWAMVCGLGLGGAFPLCLLLALDHSVQPAIAGKLVAFMQGIGFIIAGLAPWFS
FT                   GVLRSISGNYLMDWAFHALCVVGLMIITLRFAPARFPQLWVKEA"
FT   gene            complement(418027..418638)
FT                   /gene="lacA"
FT                   /locus_tag="Z0438"
FT   CDS_pept        complement(418027..418638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="Z0438"
FT                   /product="thiogalactoside acetyltransferase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 203 of 203 are 97.04 pct identical to
FT                   residues 1 to 203 of 203 from Escherichia coli K-12 Strain
FT                   MG1655: B0342"
FT                   /db_xref="EnsemblGenomes-Gn:Z0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54691"
FT                   /db_xref="GOA:A0A4Q0C3Y1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3Y1"
FT                   /protein_id="AAG54691.1"
FT                   /translation="MNMSMTERIKAGKLFTDMCEGLPEKRLRRKTLMYEFNHSHPSEVD
FT                   KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
FT                   APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
FT                   VTKDIPPNVVAAGVPCRVIREINDRDKQYYFRDYKVESSV"
FT   gene            complement(418704..419957)
FT                   /gene="lacY"
FT                   /locus_tag="Z0439"
FT   CDS_pept        complement(418704..419957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="Z0439"
FT                   /product="galactoside permease (M protein)"
FT                   /function="transport; Transport of small molecules:
FT                   Carbohydrates, organic acids, alcohols"
FT                   /note="Residues 1 to 417 of 417 are 99.76 pct identical to
FT                   residues 1 to 417 of 417 from Escherichia coli K-12 Strain
FT                   MG1655: B0343"
FT                   /db_xref="EnsemblGenomes-Gn:Z0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54692"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C1Z3"
FT                   /protein_id="AAG54692.1"
FT                   /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT                   GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT                   VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT                   INNQFVFWLGSGCALILAILLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT                   LSGPGPLSLLRRQVNEVA"
FT   gene            complement(420009..423083)
FT                   /gene="lacZ"
FT                   /locus_tag="Z0440"
FT   CDS_pept        complement(420009..423083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="Z0440"
FT                   /product="beta-D-galactosidase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 1024 of 1024 are 97.36 pct identical
FT                   to residues 1 to 1024 of 1024 from Escherichia coli K-12
FT                   Strain MG1655: B0344"
FT                   /db_xref="EnsemblGenomes-Gn:Z0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54693"
FT                   /db_xref="GOA:Q8X685"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X685"
FT                   /protein_id="AAG54693.1"
FT                   /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART
FT                   NRPSQQLRSLNGEWQFVWFPAPEAVPESWLECDLPDADTVVVPSNWQMHGYDAPIYTNV
FT                   TYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYG
FT                   QDSRLLSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQ
FT                   ISDFHVATLFNDDFSRAVLEAEVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIID
FT                   ERGGYADRVTLGLNVENPKLWSAEIPNIYRAVVELHTADGTLIEAEACDVGFREVRIEN
FT                   GLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLW
FT                   YTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWS
FT                   LGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTSATDIICPMYARVDEDQPFPAVP
FT                   KWSIKKWLSLPGEMRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDLVDQSL
FT                   IKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGR
FT                   TIEVTSEYLFRHSDNELLHWTVALDGKPLASGEVPLDVAPQGKQVIELPELPRLESTGQ
FT                   LWLTVHVVQPNATAWSEAGHISAWQQWRLAENLSVTLPSAPHAIPQLTTSETDFCIELD
FT                   NKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWK
FT                   AAGHYQAEAALLQCTADTLADAVLITTVHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
FT                   EVASDTPHPARIGLTCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPY
FT                   VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDG
FT                   FHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK"
FT   gene            complement(423206..424288)
FT                   /gene="lacI"
FT                   /locus_tag="Z0441"
FT   CDS_pept        complement(423206..424288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="Z0441"
FT                   /product="transcriptional repressor of the lac operon"
FT                   /function="regulator; Degradation of small molecules:
FT                   Carbon compounds"
FT                   /note="Residues 1 to 360 of 360 are 99.44 pct identical to
FT                   residues 1 to 360 of 360 from Escherichia coli K-12 Strain
FT                   MG1655: B0345"
FT                   /db_xref="EnsemblGenomes-Gn:Z0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54694"
FT                   /db_xref="GOA:Q8X684"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X684"
FT                   /protein_id="AAG54694.1"
FT                   /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
FT                   NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
FT                   EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACANVPALFLDVSDQTPINSIIFSH
FT                   EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
FT                   MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
FT                   YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPXTQTASPR
FT                   ALADSLMQLAXQVSRLESGQ"
FT   gene            complement(424325..425278)
FT                   /locus_tag="Z0442"
FT   CDS_pept        complement(424325..425278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0442"
FT                   /product="putative AraC-like transcriptional regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 6 to 314 of 317 are 39.54 pct identical to
FT                   residues 25 to 335 of 398 from GenPept 118 :
FT                   gi|7544056|emb|CAB87229.1| (AL163641) araC-family
FT                   transcriptional regulator [Streptomyces coelicolor A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54695"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C211"
FT                   /protein_id="AAG54695.1"
FT                   /translation="MRPLTVAIIAVAGFSPFHLSVPFIVFSEKMAEKKRFHVIICAEKP
FT                   GNVDSADGFSVTATHDYTAVIQADIVIIPYWGTITQKPPQKLLEALTTARDNGAQIVGL
FT                   CLGTFVLGYAGLLKNKRAATHWEFEREFQARFPQTHLDINALYVDDDGIITSAGTAAAL
FT                   DCCLYIVRQHFGSDYANHIARRMVVPPYRTGGQAQFIEQPVPKNTHDERINLLLDYLRQ
FT                   NIAQQHDLDSLAQRVMMSRRTLTRHFMKATGSSIAEWLITERLRRSQELLGSSQLPVER
FT                   IAAEVGFLSPVTWRQHFKSHFGVSPAEWRKTFRGMA"
FT   misc_feature    424359..426192
FT                   /note="O-island #19; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(425298..426074)
FT                   /locus_tag="Z0443"
FT   CDS_pept        complement(425298..426074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0443"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 258 of 258 are 47.49 pct identical to
FT                   residues 1 to 254 of 254 from GenPept 118 :
FT                   gi|2632808|emb|CAB12315.1| (Z99106) yddR [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54696"
FT                   /db_xref="GOA:A0A4Q0C243"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C243"
FT                   /protein_id="AAG54696.1"
FT                   /translation="MKITQIRNATQIIQYAGKTFLIDPLLAPKGSYPGFAGTARAEIRN
FT                   PTVELPCDLTTLLNVDALIVTHLHEDHWDETASRVVPKDKLIYVQNEQDAESLNKQGFT
FT                   HLTVLTDETKFGDITLHKTTGQHGSDRTYADPAMAKRLGAACGVVFQHPTEKTLYLAGD
FT                   TLWRDDVEATMLTFQPEVVVLNAGFAHVLGHGAIIMGAEDILKTHFTLPEAQIIATHME
FT                   AVNHCLLTRDALKEYARDNQIIEFVNVPEDGETLTF"
FT   gene            complement(426189..427061)
FT                   /gene="mhpR"
FT                   /locus_tag="Z0444"
FT   CDS_pept        complement(426189..427061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpR"
FT                   /locus_tag="Z0444"
FT                   /product="transcriptional regulator for mhp operon"
FT                   /function="regulator; Not classified"
FT                   /note="Residues 1 to 290 of 290 are 98.62 pct identical to
FT                   residues 26 to 315 of 315 from Escherichia coli K-12 Strain
FT                   MG1655: B0346"
FT                   /db_xref="EnsemblGenomes-Gn:Z0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54697"
FT                   /db_xref="GOA:Q8X681"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X681"
FT                   /protein_id="AAG54697.1"
FT                   /translation="MHNVVLTIEMSINMQNNEQTEYKTVRGLTRGLMLLNMLNKLDGGA
FT                   SVGLLAELSGLHRTTVRRLLETLQEEGYVRRSPSDDSFRLTIKVRQLSEGFRDEQWISA
FT                   LAAPLLGDLLREVVWPTDVSTLDVDAMVVRETTHRFSRLSFHRAMVGRRLPLLKTASGL
FT                   TWLAFCPEQERKELIEMLASRPGDDYQLAREPLKLEAILARARKEGYGQNYRGWDQEEK
FT                   IASIAVPLRSEQRVIGCLNLVYMASAMTIEQAAEKHLPALQRVAKQIEEGVESQAILVA
FT                   GRRSGVHLR"
FT   gene            427213..428877
FT                   /gene="mhpA"
FT                   /locus_tag="Z0445"
FT   CDS_pept        427213..428877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="Z0445"
FT                   /product="3-(3-hydroxyphenyl)propionate hydroxylase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 554 of 554 are 99.27 pct identical to
FT                   residues 1 to 554 of 554 from Escherichia coli K-12 Strain
FT                   MG1655: B0347"
FT                   /db_xref="EnsemblGenomes-Gn:Z0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54698"
FT                   /db_xref="GOA:Q8X680"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR023786"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X680"
FT                   /protein_id="AAG54698.1"
FT                   /translation="MAIQHPDIQPAVNHSVQVAIAGAGPVGLMMANYLGQMGIDVLVVE
FT                   KLDKLIDYPRAIGIDDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFADIQPMTD
FT                   EFGWPRRNAFIQPQVDAVMLEGVSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAEGLRE
FT                   IVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRPY
FT                   VSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
FT                   AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQ
FT                   ERRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQY
FT                   YGGALVREGEAKHSPVGKMFIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDE
FT                   QIQQWRALSTRFIQVVPEVQIHTAQDNHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDR
FT                   FVAATAIPQTLGKTLNKLASVMTLTRPDADVSVEKVA"
FT   gene            428879..429823
FT                   /gene="mhpB"
FT                   /locus_tag="Z0446"
FT   CDS_pept        428879..429823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="Z0446"
FT                   /product="2,3-dihydroxyphenylpropionate 1,2-dioxygenase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 314 of 314 are 100.00 pct identical to
FT                   residues 1 to 314 of 314 from Escherichia coli K-12 Strain
FT                   MG1655: B0348"
FT                   /db_xref="EnsemblGenomes-Gn:Z0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54699"
FT                   /db_xref="GOA:P0ABS0"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABS0"
FT                   /protein_id="AAG54699.1"
FT                   /translation="MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPEL
FT                   VVLFAPDHYNGFFYDVMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGID
FT                   LAVSYCMQVDHGFAQPLEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTS
FT                   TLNKRVLFLGSGGLSHQPPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEK
FT                   FVEDQRTLHPLNPIWDNQFMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAA
FT                   ISAFGNWRSEGRYYRPIPEWIAGFGSLSARTEN"
FT   gene            429778..430707
FT                   /gene="mhpC"
FT                   /locus_tag="Z0447"
FT   CDS_pept        429778..430707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="Z0447"
FT                   /product="2-hydroxy-6-ketonona-2,4-dienedioic acid
FT                   hydrolase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 308 of 309 are 99.35 pct identical to
FT                   residues 1 to 308 of 309 from Escherichia coli K-12 Strain
FT                   MG1655: B0349"
FT                   /db_xref="EnsemblGenomes-Gn:Z0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54700"
FT                   /db_xref="GOA:Q8X5K0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR023791"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5K0"
FT                   /protein_id="AAG54700.1"
FT                   /translation="MDCRIWLVKRQNRELNMQEKMMSYQPQTEAATSRFLNVEEAGKTL
FT                   RIHFNDCGQGDETVVLLHGSGPGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDSIV
FT                   NSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMGGGTG
FT                   GMSLFTPMPTEGIKRLNQLYRQPTIENLKLMMDIFVFDTSDLTDALFEARLNNMLSRRD
FT                   HLENFVKSLEANPKQFPDFGPRLAEIKAQTLIVWGRNDRFVPMDAGLRLLSGIAGSELH
FT                   IFRDCGHWAQWEHADAFNQLVLNFLARA"
FT   gene            430717..431526
FT                   /gene="mhpD"
FT                   /locus_tag="Z0448"
FT   CDS_pept        430717..431526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="Z0448"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 269 of 269 are 98.88 pct identical to
FT                   residues 3 to 271 of 271 from Escherichia coli K-12 Strain
FT                   MG1655: B0350"
FT                   /db_xref="EnsemblGenomes-Gn:Z0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54701"
FT                   /db_xref="GOA:Q8XEC1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR023793"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEC1"
FT                   /protein_id="AAG54701.1"
FT                   /translation="MTKHTLEQLAADLRRAAEQGEAIAPLRDLIGIDNAEAAYAIQHIN
FT                   VQYDVAQGRRVVGRKVGLTHPKVQQQLGVDQPDFGTLFADMCYGDNEIIPFSRVLQPRI
FT                   EAEIALVLNRDLPATDITFDELYNAIEWVLPALEVVGSRIRDWSIQFVDTVADNASCGV
FT                   YVIGGPAQRPAGLDLKNCAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKMASLGEPL
FT                   RAGDIILTGALGPMVAVNAGDRFEAHIEGIGSVAAAFSSAAPKGSLS"
FT   gene            431523..432473
FT                   /gene="mhpF"
FT                   /locus_tag="Z0450"
FT   CDS_pept        431523..432473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpF"
FT                   /locus_tag="Z0450"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 316 of 316 are 99.05 pct identical to
FT                   residues 1 to 316 of 316 from Escherichia coli K-12 Strain
FT                   MG1655: B0351"
FT                   /db_xref="EnsemblGenomes-Gn:Z0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54702"
FT                   /db_xref="GOA:Q8X5J9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J9"
FT                   /protein_id="AAG54702.1"
FT                   /translation="MSKRKVAIIGSGNIGTDLMIKILRHDQHLEMAVMVGIDPQSDGLA
FT                   RARRMGVATTHEGVIGLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTP
FT                   AAIGPYCVPVVNLEENVDQLNVNMVTCGGQATIPMVAAVSRVVRVHYAEIIASIASKSA
FT                   GPGTRANIDEFTETTSRAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDI
FT                   EASINEMAEAVQAYVPGYRLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAH
FT                   YLPAYAGNLDIMTSSALATAEKMAQSLARKAGEAA"
FT   gene            432470..433483
FT                   /gene="mhpE"
FT                   /locus_tag="Z0452"
FT   CDS_pept        432470..433483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpE"
FT                   /locus_tag="Z0452"
FT                   /product="4-hydroxy-2-ketovalerate aldolase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 337 of 337 are 99.10 pct identical to
FT                   residues 1 to 337 of 337 from Escherichia coli K-12 Strain
FT                   MG1655: B0352"
FT                   /db_xref="EnsemblGenomes-Gn:Z0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54703"
FT                   /db_xref="GOA:Q8X5J8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J8"
FT                   /protein_id="AAG54703.1"
FT                   /translation="MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIE
FT                   VAHGDGLQGSSFNYGFGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGA
FT                   RVVRVATHCTEADVSAQHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCI
FT                   YVVDSGGAMNMSDIRDRFRALKAVLKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDA
FT                   SLAGMGAGAGNAPLEVFIAAVDKLGWQHGADLYALMDAADDLVRPLQDRPVRVDRETLA
FT                   LGYAGVYSSFLRHCETAAARYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK"
FT   gene            433614..434870
FT                   /gene="mhpT"
FT                   /locus_tag="Z0453"
FT   CDS_pept        433614..434870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpT"
FT                   /locus_tag="Z0453"
FT                   /product="putative transport protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 418 of 418 are 99.28 pct identical to
FT                   residues 1 to 418 of 418 from Escherichia coli K-12 Strain
FT                   MG1655: B0353"
FT                   /db_xref="EnsemblGenomes-Gn:Z0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54704"
FT                   /db_xref="GOA:A0A0H3JFU9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFU9"
FT                   /protein_id="AAG54704.1"
FT                   /translation="MYQSRFTCTRNEVHLMSTRTPSSSSSRLMLTIGLCFLVALMEGLD
FT                   LQAAGIAAGGIAQAFALDKMQMGWIFSAGILGLLPGALVGGMLADRYGRKRILIGSVAL
FT                   FGLFSLATAIAWDFPSLVFARLMTGVGLGAALPNLIALTSEAAGPRFRGTAVSLMYCGV
FT                   PIGAALAATLGFAGANLAWQTVFWVGGVVPLILVPLLMRWLPESAVFAGEKQAAPPLRA
FT                   LFAPETATATLLLWLCYFFTLLVVYMLINWLPLLLVEQGFQPSQAAGVMFALQMGAASG
FT                   TLMLGALMDKLRPVTMSLLIYSGMLASLLALGTVSSFNGMLLAGFVAGLFATGGQSVLY
FT                   ALAPLFYSSQIRATGVGTAVAVGRLGAMSGPLLAGKMLALGTGTVGVMAASAPGILVAG
FT                   LAVFILMSRRLRMQPCADA"
FT   gene            434855..435511
FT                   /gene="yaiL"
FT                   /locus_tag="Z0454"
FT   CDS_pept        434855..435511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="Z0454"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 218 of 218 are 97.70 pct identical to
FT                   residues 1 to 218 of 218 from Escherichia coli K-12 Strain
FT                   MG1655: B0354"
FT                   /db_xref="EnsemblGenomes-Gn:Z0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54705"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCB4"
FT                   /protein_id="AAG54705.1"
FT                   /translation="MCRCLTRLIKQGRKGLAPNTPTAFTGILAKNYSAGLETKMAKLTL
FT                   QEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEENKKAQLERDKQLSEQQKQAAL
FT                   AKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFVDKLTQAQLINGRLAIARLLV
FT                   DNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQDEDNPYADFKVPDDLMW"
FT   gene            complement(435636..436469)
FT                   /gene="yaiM"
FT                   /locus_tag="Z0455"
FT   CDS_pept        complement(435636..436469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiM"
FT                   /locus_tag="Z0455"
FT                   /product="putative esterase"
FT                   /function="putative enzyme; Not classified"
FT                   /EC_number="3.1.1.1"
FT                   /note="Residues 1 to 277 of 277 are 96.38 pct identical to
FT                   residues 1 to 277 of 277 from Escherichia coli K-12 Strain
FT                   MG1655: B0355"
FT                   /db_xref="EnsemblGenomes-Gn:Z0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54706"
FT                   /db_xref="GOA:Q8X5J5"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J5"
FT                   /protein_id="AAG54706.1"
FT                   /translation="MELIEKHASFGGWQNVYRHYSASLKCEMNVGVYLPPKAAGEKLPV
FT                   LYWLSGLTCNEQNFITKSGVQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGAGFYL
FT                   NATQAPWNEHYKMYDYIRNELPDLVMNHFPATAKKSISGHSMGGLGALVLALRNPDEYV
FT                   SVSAFSPIVSPSQVPWGQQAFAAYLGENKEAWLDYHPVSLISQGQRVAEIMVDQGLSDD
FT                   FYAEQLRTQNLEKICQEMNIKTLIRYHEGYDHSYYFVSSFIGEHIAYHANKLNMR"
FT   gene            complement(436562..437671)
FT                   /gene="adhC"
FT                   /locus_tag="Z0456"
FT   CDS_pept        complement(436562..437671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="Z0456"
FT                   /product="alcohol dehydrogenase class III; formaldehyde
FT                   dehydrogenase, glutathione-dependent"
FT                   /function="enzyme; Energy metabolism, carbon: Fermentation"
FT                   /note="Residues 1 to 369 of 369 are 99.45 pct identical to
FT                   residues 1 to 369 of 369 from Escherichia coli K-12 Strain
FT                   MG1655: B0356"
FT                   /db_xref="EnsemblGenomes-Gn:Z0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54707"
FT                   /db_xref="GOA:Q8X5J4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J4"
FT                   /protein_id="AAG54707.1"
FT                   /translation="MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAF
FT                   TLSGDDPEGVFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTN
FT                   LCVAVRETQGKGLMPDGTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANHEH
FT                   VCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPK
FT                   KFDLARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGW
FT                   GQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPF
FT                   VTHTMSLDEINDAFDLMHEGKSIRTVIRY"
FT   gene            complement(437706..438002)
FT                   /gene="yaiN"
FT                   /locus_tag="Z0457"
FT   CDS_pept        complement(437706..438002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiN"
FT                   /locus_tag="Z0457"
FT                   /product="putative alpha helix chain"
FT                   /function="phenotype; Not classified"
FT                   /note="Residues 1 to 98 of 98 are 100.00 pct identical to
FT                   residues 1 to 98 of 98 from Escherichia coli K-12 Strain
FT                   MG1655: B0357"
FT                   /db_xref="EnsemblGenomes-Gn:Z0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54708"
FT                   /db_xref="GOA:Q8X5J3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J3"
FT                   /protein_id="AAG54708.1"
FT                   /translation="MQMMRCEMPSTPEEKKKVLTRVRRIRGQIDALERSLEGDAECRAI
FT                   LQQIAAVRGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK"
FT   misc_feature    438084..446197
FT                   /note="O-island #20; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(438141..439199)
FT                   /gene="afuC"
FT                   /locus_tag="Z0458"
FT   CDS_pept        complement(438141..439199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="Z0458"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 352 of 352 are 94.03 pct identical to
FT                   residues 1 to 352 of 352 from Escherichia coli K-12 Strain
FT                   MG1655: B0262"
FT                   /db_xref="EnsemblGenomes-Gn:Z0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54709"
FT                   /db_xref="GOA:Q7AH43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AH43"
FT                   /protein_id="AAG54709.1"
FT                   /translation="MERTMSQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPS
FT                   GCGKTTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVG
FT                   YGLKMLGVSRSEVKQRVKEALAXVDXEGFEDRYVDQISGGQQQRVALARALILKPKVLL
FT                   FDEPLSNLDANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQI
FT                   GSPQDLYRQPASRFMASFMGDANLFPANFSEEYVDIYGYRLPRAAHFPVQGSGTVGVRP
FT                   EAITLSNHGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDIGEHYYLEI
FT                   HPYGMFVLADAA"
FT   gene            complement(439199..441277)
FT                   /gene="afuB"
FT                   /locus_tag="Z0459"
FT   CDS_pept        complement(439199..441277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuB"
FT                   /locus_tag="Z0459"
FT                   /product="putative permease component of transport system
FT                   for ferric iron"
FT                   /function="putative transport; Transport of small
FT                   molecules: Cations"
FT                   /note="Residues 19 to 689 of 692 are 66.07 pct identical to
FT                   residues 17 to 684 of 687 from GenPept 118 :
FT                   gi|1477454|gb|AAB17217.1| (U04954) afuB [Actinobacillus
FT                   pleuropneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54710"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2P8"
FT                   /protein_id="AAG54710.1"
FT                   /translation="MSQTLALHPVKKRDAIFLWVLLGWLAFVLLPSWSLDYGLLESTSD
FT                   EILGAYGWSHFNISWLWYLLPSLLLVRPFRQATREQRSRHYFDAGWALLCMAFIVISAT
FT                   VAGRGLGYAAIVLFVELGAIMTLALTRLEWLGGDRFVIGSLIAIVALIGIFIVWPSIAI
FT                   FIPMFTNDAGELAPLAFMTVLSQAHIVQVIVNSIVLSIAVGIGCAFFGLVLAIYTTRIA
FT                   KRSAIIGRIFSILPIVTPPFVVGLGVTLMMGRSGYVTEFMVEWFGLTNTNWLYGFTGIW
FT                   LAQVLAFTPMAFMILDGAIKTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLI
FT                   VVVQSLADFSNPLVLGGNFDVLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCIQY
FT                   MWIGKRSYVTVSGKSYRGDVQPLPVTLVWSVVAILAIWIAFNALLYGSIFYGSFTVNWG
FT                   VDYTLTLDNFIKLFGQGMSDGAWPSLLDTLLYAGIAAPITAIFGLLIAWVVVRQQFKGK
FT                   KTIEFTTMLCFAVPGTVAGVSYILAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAG
FT                   LGQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTP
FT                   DTRVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFLFDWLIGEARISRSKAKNQA"
FT   gene            complement(441346..442377)
FT                   /gene="afuA"
FT                   /locus_tag="Z0460"
FT   CDS_pept        complement(441346..442377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuA"
FT                   /locus_tag="Z0460"
FT                   /product="periplasmic ferric iron-binding protein"
FT                   /function="putative transport; Transport of small
FT                   molecules: Cations"
FT                   /note="Residues 1 to 343 of 343 are 72.83 pct identical to
FT                   residues 1 to 346 of 346 from GenPept 118 :
FT                   gi|1477455|gb|AAB17218.1| (U04954) afuA [Actinobacillus
FT                   pleuropneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54711"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDJ3"
FT                   /protein_id="AAG54711.1"
FT                   /translation="MKMTFTSTLIASAVALATLTGAAQAKGRLVVYCSATNEMCEAETK
FT                   AFGEKYDVKTSFIRNGSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQAYKSP
FT                   NLEQIMEKFRDPAKVKGNLSSAVYVGILGFGVNTDRLKEKNLPVPKCWKDLTKPEYKGE
FT                   IQIADPQSSGTAYTALATFAQLWGEDQAFDYLKQLNANVSQYTKSGIAPARNAARGETA
FT                   IGIGFLHDYSLEKEQGAPLELISPCEGTGYEIGGVSILKGARNLDNAKLFVDWVLSKEA
FT                   QELAWKKGKSYQILTNTTAETSPNSLKLDDLKLINYDMDKYGSTDVRKALINKWVSEVK
FT                   MGK"
FT   gene            complement(442374..443678)
FT                   /locus_tag="Z0461"
FT   CDS_pept        complement(442374..443678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0461"
FT                   /product="putative permease; hexosephosphate transport"
FT                   /function="putative transport; Transport of small
FT                   molecules: Carbohydrates, organic acids, alcohols"
FT                   /note="Residues 8 to 422 of 434 are 53.25 pct identical to
FT                   residues 20 to 434 of 440 from GenPept 118 :
FT                   gi|2367260|gb|AAC76690.1| (AE000444) regulator of uhpT
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54712"
FT                   /db_xref="GOA:A0A384LGB7"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGB7"
FT                   /protein_id="AAG54712.1"
FT                   /translation="MHARSAREINQCYRTLRPRLLMCMIIGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGVGLFATGLLNVVFAFG
FT                   ESLTLLLVVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPQEEGLPTVGHWRHDPLELRQEQQS
FT                   PPMGLWQMLRTTMLQNPLIWLLGVSYVLVYVIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAVCF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYGWP
FT                   GMFSLLSVAAVLMGLLLMPLLMAGITTTHARRIKQ"
FT   gene            complement(443763..445304)
FT                   /locus_tag="Z0462"
FT   CDS_pept        complement(443763..445304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0462"
FT                   /product="putative sensor kinase; hexosephosphate
FT                   transport"
FT                   /function="putative regulator; Transport of small
FT                   molecules: Carbohydrates, organic acids, alcohols"
FT                   /note="Residues 9 to 505 of 513 are 35.75 pct identical to
FT                   residues 11 to 496 of 500 from GenPept 118 :
FT                   gi|154409|gb|AAA27244.1| (M89480) hexosephosphate transport
FT                   protein [Salmonella typhimurium]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54713"
FT                   /db_xref="GOA:A0A4Q0C213"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C213"
FT                   /protein_id="AAG54713.1"
FT                   /translation="MSRNLRHWVILLFIVLAWGTGWLMLWTLSFYLTNNGQQAVLFLPQ
FT                   GVYLALVILLSRRYWPALVLPPLLMMFWLHSEQLLNGYLMLATPVISLFPALLAQNFWH
FT                   RFPLYWQRLTLLLATVTAASLLNTALLSPFMSGPIMLPGLTSFTGGVLLTPFVYLIFEF
FT                   LRQQHRYQLLGLDTHNPPLRTSLIIWCSLFFIIGIGTQMVLSPEIERLLLIVVFLPNVV
FT                   MAWKFGWQGGVLSGLLGSMMITIARQIGVGFSNLVELEIFLATQALLGIGLGIAISRQQ
FT                   HLALNLHHYRQRLEAELAARRALAEKLIHTEEDTRKNLARELHDEIGQNITAIQIQSQL
FT                   VKRARDPAQIQSAASQINELARRIHLSTRQLLRQLRPPALDELTFREALLHLINEFAFS
FT                   ERGIHCQFAYQLNSTPENETVRFTLYRLLQELLNNICKHAEASEVTIILRQQGEVLHLE
FT                   VSDNGVGIASGKMAGFGIQGMRERVSALGGDLTLEKQHGTRVIVNLPTFLQQIAG"
FT   gene            complement(445304..445933)
FT                   /locus_tag="Z0463"
FT   CDS_pept        complement(445304..445933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0463"
FT                   /product="putative response regulator; hexosephosphate
FT                   transport"
FT                   /function="putative regulator; Transport of small
FT                   molecules: Carbohydrates, organic acids, alcohols"
FT                   /note="Residues 1 to 202 of 209 are 49.00 pct identical to
FT                   residues 1 to 194 of 196 from GenPept 118 :
FT                   gi|154408|gb|AAA27243.1| (M89480) hexosephosphate
FT                   utilization protein [Salmonella typhimurium]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54714"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3D0"
FT                   /protein_id="AAG54714.1"
FT                   /translation="MIRVVLVDDHVVVRSGFAQLLSLEDDLEVIGQYSSAAQAWSALIR
FT                   DDVNVAVIDIAMPDENGLSLLKRLRAQKPQFRAIILSIYDAPTFVQSALDAGASGYLTK
FT                   RCGPEELVQAVRSVGLGGHYLCADAIRALRGGGQPAQALEILTPREREVFELLVKGDSV
FT                   KEIAFKLELSHKTVHVHRANVLGKLNCHSTIELVHFALDHHLLAGH"
FT   gene            446236..447198
FT                   /gene="tauA"
FT                   /locus_tag="Z0464"
FT   CDS_pept        446236..447198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="Z0464"
FT                   /product="taurine transport system periplasmic protein"
FT                   /function="transport; Transport of small molecules: Amino
FT                   acids, amines"
FT                   /note="Residues 1 to 320 of 320 are 99.68 pct identical to
FT                   residues 20 to 339 of 339 from Escherichia coli K-12 Strain
FT                   MG1655: B0365"
FT                   /db_xref="EnsemblGenomes-Gn:Z0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54715"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TZC1"
FT                   /protein_id="AAG54715.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFSKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
FT   gene            447211..447978
FT                   /gene="tauB"
FT                   /locus_tag="Z0465"
FT   CDS_pept        447211..447978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="Z0465"
FT                   /product="taurine ATP-binding component of a transport
FT                   system"
FT                   /function="transport; Transport of small molecules: Amino
FT                   acids, amines"
FT                   /note="Residues 1 to 255 of 255 are 99.21 pct identical to
FT                   residues 1 to 255 of 255 from Escherichia coli K-12 Strain
FT                   MG1655: B0366"
FT                   /db_xref="EnsemblGenomes-Gn:Z0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54716"
FT                   /db_xref="GOA:Q8X5I6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5I6"
FT                   /protein_id="AAG54716.1"
FT                   /translation="MLQISHLYADYGGKPVLEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
FT   gene            447975..448802
FT                   /gene="tauC"
FT                   /locus_tag="Z0466"
FT   CDS_pept        447975..448802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="Z0466"
FT                   /product="taurine transport system permease protein"
FT                   /function="transport; Transport of small molecules: Amino
FT                   acids, amines"
FT                   /note="Residues 1 to 275 of 275 are 97.81 pct identical to
FT                   residues 1 to 275 of 275 from Escherichia coli K-12 Strain
FT                   MG1655: B0367"
FT                   /db_xref="EnsemblGenomes-Gn:Z0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54717"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C261"
FT                   /protein_id="AAG54717.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVLIGIPVGIA
FT                   MGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
FT   gene            448799..449650
FT                   /gene="tauD"
FT                   /locus_tag="Z0467"
FT   CDS_pept        448799..449650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="Z0467"
FT                   /product="taurine dioxygenase, 2-oxoglutarate-dependent"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 283 of 283 are 99.64 pct identical to
FT                   residues 1 to 283 of 283 from Escherichia coli K-12 Strain
FT                   MG1655: B0368"
FT                   /db_xref="EnsemblGenomes-Gn:Z0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54718"
FT                   /db_xref="GOA:A0A4Q0C259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C259"
FT                   /protein_id="AAG54718.1"
FT                   /translation="MSERLSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVV
FT                   FLRDQAITPQQQRALAQRFGELHIHPVYPHAEGVDEIIVLDTHNDNPPDNDNWHTDVTF
FT                   IETPPAGAILAAKELPSTGGDTLWTSGIAAYEALSVPFRQLLSGLRAEHDFRKSFPEYK
FT                   YRKTEEEHQRWREAVAKNPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVSEKESEALL
FT                   GFLFAHITKPEFQVRWRWQPNDIAIWDNRVTQHYANADYLPQRRIMHRATILGDKPFYR
FT                   AG"
FT   gene            complement(449757..450764)
FT                   /gene="hemB"
FT                   /locus_tag="Z0468"
FT   CDS_pept        complement(449757..450764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="Z0468"
FT                   /product="5-aminolevulinate dehydratase = porphobilinogen
FT                   synthase"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="Residues 1 to 335 of 335 are 99.10 pct identical to
FT                   residues 1 to 335 of 335 from Escherichia coli K-12 Strain
FT                   MG1655: B0369"
FT                   /db_xref="EnsemblGenomes-Gn:Z0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54719"
FT                   /db_xref="GOA:Q8X5I0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5I0"
FT                   /protein_id="AAG54719.1"
FT                   /translation="MHLNSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLP
FT                   IFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAW
FT                   REDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAV
FT                   VAAAAGADFIAPSAAMDGQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSA
FT                   LKGDRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAY
FT                   QVSGEYAMIKFAALAGAIDEEKVVLESLGSIXRAGADLIFSYFALDLAEKKILR"
FT   gene            451257..454199
FT                   /locus_tag="Z0469"
FT   CDS_pept        451257..454199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0469"
FT                   /product="putative structural protein (partial)"
FT                   /function="putative structure; Not classified"
FT                   /note="Residues 510 to 980 of 980 are 90.08 pct identical
FT                   to residues 1 to 467 of 467 from Escherichia coli K-12
FT                   Strain MG1655: B0374"
FT                   /db_xref="EnsemblGenomes-Gn:Z0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54720"
FT                   /db_xref="GOA:Q8X5H7"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5H7"
FT                   /protein_id="AAG54720.1"
FT                   /translation="MHSWKKKLIVSQLALACTLAITSQANAATNDISGQTYNTFHHYND
FT                   ATYADDVYYDGYVGWNNYAADSYYNGDIYPVINNATVNGVISTYYLDDGISTNTNANSL
FT                   TIKNSTIHGMITSECMTTDCADDRATGYVYDRLTLSVDNSTIDDNYEHYTYNGTYNNAA
FT                   DTHVVDVYDMGTAITLDQEVDLSITNNSHVAGITLTQGYEWEDIDDNTVSTGVNSSEVF
FT                   NNTITVKDSTVTSGSWTDEGTTGWFGHTGNASNYSNTLTADDVAIAAIANPYADNAMQT
FT                   TVTLDNSTLMGDVVFSSNFDENFFPQGANSYRDADGDVDTNGWDGTDRMDVTLNNGSKW
FT                   VGAAMSVHMVDEDGDGSYDGYAVGTEATATLLDIAANSLWPSSTVGVDNINTQYDENGH
FT                   IVGNEVYQSGLFNVTLNGGSEWDTTKSSLIDTLSINSGSQVNVADSRLISDTVSLTGGS
FT                   NLNIGEDGHVATNTLTIDNSTVKMSDDVSAGWGLEDAALYANTITVTNDGLLDINVDQF
FT                   DANPFQADTLNLTSTTDTNGNIHAGVFDIHSSDYVMDTDLVNDRTNDTTKSNYGYGLIA
FT                   MNSDGHLTINGNGDNDNTASIEAGQNEVDNNGDHVAAATGNYKVRIDNATGAGSIADYN
FT                   GNELIYVNDKNSNATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSAN
FT                   TNIWNLEQDTVGTRLTNSRHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDT
FT                   KIDGNNAKWIVGAAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHF
FT                   NNDLSATMSNGTYVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYXSISGLFQSGDDYQL
FT                   SNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSID
FT                   NGTEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
FT   misc_feature    451351..452744
FT                   /locus_tag="Z0469"
FT                   /note="O-island #21; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            454242..454910
FT                   /gene="yaiV"
FT                   /locus_tag="Z0470"
FT   CDS_pept        454242..454910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="Z0470"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 222 of 222 are 100.00 pct identical to
FT                   residues 1 to 222 of 222 from Escherichia coli K-12 Strain
FT                   MG1655: B0375"
FT                   /db_xref="EnsemblGenomes-Gn:Z0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54721"
FT                   /db_xref="GOA:P0AAP6"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAP6"
FT                   /protein_id="AAG54721.1"
FT                   /translation="MPVKDLTGITAKDAQMLSVVKPLQEFGKLDKCLSRYGTRFEFNNE
FT                   KQVIFSSDVNNEDTFVILEGVISLRREENVLIGITQAPYIMGLADGLMKNDIPYKLISE
FT                   GNCTGYHLPAKQTITLIEQNQLWRDAFYWLAWQNRILELRDVQLIGHNSYEQIRATLLS
FT                   MIDWNEELRSRIGVMNYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVAINRLPSEY
FT                   "
FT   gene            complement(454911..456068)
FT                   /gene="yaiH"
FT                   /locus_tag="Z0472"
FT   CDS_pept        complement(454911..456068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiH"
FT                   /locus_tag="Z0472"
FT                   /product="putative enzyme"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 385 of 385 are 100.00 pct identical to
FT                   residues 1 to 385 of 385 from Escherichia coli K-12 Strain
FT                   MG1655: B0376"
FT                   /db_xref="EnsemblGenomes-Gn:Z0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54722"
FT                   /db_xref="GOA:P0AD71"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD71"
FT                   /protein_id="AAG54722.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYG
FT                   SGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTY
FT                   TPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQAD
FT                   RMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAM
FT                   IPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS"
FT   gene            456420..457640
FT                   /gene="sbmA"
FT                   /locus_tag="Z0473"
FT   CDS_pept        456420..457640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="Z0473"
FT                   /product="sensitivity to microcin B17, possibly envelop
FT                   protein"
FT                   /function="putative membrane; Protection responses:
FT                   Drug/analog sensitivity"
FT                   /note="Residues 1 to 406 of 406 are 100.00 pct identical to
FT                   residues 1 to 406 of 406 from Escherichia coli K-12 Strain
FT                   MG1655: B0377"
FT                   /db_xref="EnsemblGenomes-Gn:Z0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54723"
FT                   /db_xref="GOA:P0AFY7"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFY7"
FT                   /protein_id="AAG54723.1"
FT                   /translation="MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
FT   gene            457653..458747
FT                   /gene="yaiW"
FT                   /locus_tag="Z0474"
FT   CDS_pept        457653..458747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="Z0474"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 364 of 364 are 98.62 pct identical to
FT                   residues 1 to 364 of 364 from Escherichia coli K-12 Strain
FT                   MG1655: B0378"
FT                   /db_xref="EnsemblGenomes-Gn:Z0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54724"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3E0"
FT                   /protein_id="AAG54724.1"
FT                   /translation="MSRVNHLSSLSFLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSGIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAAKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
FT   gene            complement(458806..459114)
FT                   /locus_tag="Z0475"
FT   CDS_pept        complement(458806..459114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0475"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 102 of 102 are 100.00 pct identical to
FT                   residues 1 to 102 of 102 from Escherichia coli K-12 Strain
FT                   MG1655: B0379"
FT                   /db_xref="EnsemblGenomes-Gn:Z0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54725"
FT                   /db_xref="GOA:P0AAP9"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAP9"
FT                   /protein_id="AAG54725.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
FT   gene            459242..459586
FT                   /locus_tag="Z0476"
FT   CDS_pept        459242..459586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0476"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 114 of 114 are 97.36 pct identical to
FT                   residues 1 to 114 of 114 from Escherichia coli K-12 Strain
FT                   MG1655: B0380"
FT                   /db_xref="EnsemblGenomes-Gn:Z0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54726"
FT                   /db_xref="GOA:A0A0H3JDR3"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDR3"
FT                   /protein_id="AAG54726.1"
FT                   /translation="MNLRCESQNSNFKLNLLTIAKMLSTPQTVVAEYARMLFFVNGAAM
FT                   NLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR
FT                   RRDEETENAQ"
FT   gene            complement(459610..460704)
FT                   /locus_tag="Z0477"
FT   CDS_pept        complement(459610..460704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0477"
FT                   /product="hypothetical protein"
FT                   /function="putative enzyme; Cell envelop: Murein sacculus,
FT                   peptidoglycan"
FT                   /note="Residues 1 to 364 of 364 are 100.00 pct identical to
FT                   residues 1 to 364 of 364 from Escherichia coli K-12 Strain
FT                   MG1655: B0381"
FT                   /db_xref="EnsemblGenomes-Gn:Z0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54727"
FT                   /db_xref="GOA:P0A6J9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6J9"
FT                   /protein_id="AAG54727.1"
FT                   /translation="MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDK
FT                   QGQWHVSDASNYLLNADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTR
FT                   ANRHNISFAEVESKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQ
FT                   GIKGREIECAVLGNDNPQASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDK
FT                   IRAIAVQAYQTLGCAGMARVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYT
FT                   DLITRLIELALERHAADNALKTTM"
FT   gene            461167..461427
FT                   /gene="yaiB"
FT                   /locus_tag="Z0478"
FT   CDS_pept        461167..461427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="Z0478"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 86 of 86 are 100.00 pct identical to
FT                   residues 1 to 86 of 86 from Escherichia coli K-12 Strain
FT                   MG1655: B0382"
FT                   /db_xref="EnsemblGenomes-Gn:Z0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54728"
FT                   /db_xref="GOA:P0AAP0"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAP0"
FT                   /protein_id="AAG54728.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
FT   gene            461459..462943
FT                   /gene="phoA"
FT                   /locus_tag="Z0479"
FT   CDS_pept        461459..462943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="Z0479"
FT                   /product="alkaline phosphatase"
FT                   /function="enzyme; Central intermediary metabolism:
FT                   Phosphorus compounds"
FT                   /note="Residues 1 to 494 of 494 are 99.59 pct identical to
FT                   residues 1 to 494 of 494 from Escherichia coli K-12 Strain
FT                   MG1655: B0383"
FT                   /db_xref="EnsemblGenomes-Gn:Z0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54729"
FT                   /db_xref="GOA:A0A0H3JCH7"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCH7"
FT                   /protein_id="AAG54729.1"
FT                   /translation="MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKAR
FT                   TPEMPVLENRAAQGDITAPGGARRLTADQTAALRDSLSDKPAKNIILLIGDGMGDSEIT
FT                   AARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNG
FT                   ALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEK
FT                   CPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQL
FT                   VSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDS
FT                   VPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALE
FT                   FAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHT
FT                   GSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK"
FT   gene            463044..463382
FT                   /gene="psiF"
FT                   /locus_tag="Z0480"
FT   CDS_pept        463044..463382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="Z0480"
FT                   /product="induced by phosphate starvation"
FT                   /function="phenotype; Central intermediary metabolism:
FT                   Phosphorus compounds"
FT                   /note="Residues 1 to 112 of 112 are 100.00 pct identical to
FT                   residues 1 to 112 of 112 from Escherichia coli K-12 Strain
FT                   MG1655: B0384"
FT                   /db_xref="EnsemblGenomes-Gn:Z0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54730"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFW7"
FT                   /protein_id="AAG54730.1"
FT                   /translation="MKRDGAMKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQ
FT                   ATAQALKGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFM
FT                   SACLKKAA"
FT   gene            463484..464599
FT                   /gene="yaiC"
FT                   /locus_tag="Z0481"
FT   CDS_pept        463484..464599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiC"
FT                   /locus_tag="Z0481"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 371 of 371 are 99.73 pct identical to
FT                   residues 1 to 371 of 371 from Escherichia coli K-12 Strain
FT                   MG1655: B0385"
FT                   /db_xref="EnsemblGenomes-Gn:Z0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54731"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDJ5"
FT                   /protein_id="AAG54731.1"
FT                   /translation="MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPR
FT                   AVGLAGMFLPIASTLVSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKT
FT                   DAVLAGMWVGVMGVNVLPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGI
FT                   TVSFNSAPLEWWLSLPIIVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRR
FT                   HWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRG
FT                   SDVIGRFGGDEFAVIMSGTPAESAITAMLRVHEGLNTLRLPNTPQVNLRISVGVAPLNP
FT                   QMSHYREWLKSADLALYKAKKAGRNRTEVAA"
FT   gene            complement(464616..465425)
FT                   /gene="proC"
FT                   /locus_tag="Z0482"
FT   CDS_pept        complement(464616..465425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="Z0482"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /function="enzyme; Amino acid biosynthesis: Proline"
FT                   /note="Residues 1 to 269 of 269 are 99.62 pct identical to
FT                   residues 1 to 269 of 269 from Escherichia coli K-12 Strain
FT                   MG1655: B0386"
FT                   /db_xref="EnsemblGenomes-Gn:Z0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54732"
FT                   /db_xref="GOA:A0A4Q0C411"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C411"
FT                   /protein_id="AAG54732.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDKFGINAAESAQEVAQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPALVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHP
FT                   GALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSEKLSKS"
FT   gene            465425..466003
FT                   /locus_tag="Z0483"
FT   CDS_pept        465425..466003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0483"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 192 of 192 are 100.00 pct identical to
FT                   residues 1 to 192 of 192 from Escherichia coli K-12 Strain
FT                   MG1655: B0387"
FT                   /db_xref="EnsemblGenomes-Gn:Z0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54733"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8D5"
FT                   /protein_id="AAG54733.1"
FT                   /translation="MPHSCREIHCFDNRWQKHKQNYAGRQKRDTIEDYPTKDDFMTIWV
FT                   DADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFIRTLRVAAGFDVADNEIVRQ
FT                   CEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRERLTMRDFMDTLRASGIQTG
FT                   GPDSLSQRDRQAFAAELEKWWLEVQRSRG"
FT   gene            466186..466710
FT                   /gene="aroL"
FT                   /locus_tag="Z0484"
FT   CDS_pept        466186..466710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="Z0484"
FT                   /product="shikimate kinase II"
FT                   /function="enzyme; Amino acid biosynthesis: Chorismate"
FT                   /note="Residues 1 to 174 of 174 are 100.00 pct identical to
FT                   residues 1 to 174 of 174 from Escherichia coli K-12 Strain
FT                   MG1655: B0388"
FT                   /db_xref="EnsemblGenomes-Gn:Z0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54734"
FT                   /db_xref="GOA:P0A6E3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6E3"
FT                   /protein_id="AAG54734.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
FT   gene            466760..466951
FT                   /gene="yaiA"
FT                   /locus_tag="Z0485"
FT   CDS_pept        466760..466951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="Z0485"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 63 of 63 are 100.00 pct identical to
FT                   residues 1 to 63 of 63 from Escherichia coli K-12 Strain
FT                   MG1655: B0389"
FT                   /db_xref="EnsemblGenomes-Gn:Z0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54735"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAN7"
FT                   /protein_id="AAG54735.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
FT   gene            467209..467886
FT                   /gene="aroM"
FT                   /locus_tag="Z0486"
FT   CDS_pept        467209..467886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="Z0486"
FT                   /product="protein of aro operon, regulated by aroR"
FT                   /function="phenotype; Amino acid biosynthesis: Chorismate"
FT                   /note="Residues 1 to 225 of 225 are 97.33 pct identical to
FT                   residues 1 to 225 of 225 from Escherichia coli K-12 Strain
FT                   MG1655: B0390"
FT                   /db_xref="EnsemblGenomes-Gn:Z0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54736"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C247"
FT                   /protein_id="AAG54736.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNHLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
FT   gene            467958..468242
FT                   /gene="yaiE"
FT                   /locus_tag="Z0487"
FT   CDS_pept        467958..468242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="Z0487"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 94 of 94 are 100.00 pct identical to
FT                   residues 1 to 94 of 94 from Escherichia coli K-12 Strain
FT                   MG1655: B0391"
FT                   /db_xref="EnsemblGenomes-Gn:Z0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54737"
FT                   /db_xref="GOA:P0C039"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C039"
FT                   /protein_id="AAG54737.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
FT   misc_feature    468385..470323
FT                   /note="O-island #22; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            470384..470665
FT                   /locus_tag="Z0489"
FT   CDS_pept        470384..470665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0489"
FT                   /product="unknown"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 93 of 93 are 92.47 pct identical to
FT                   residues 1 to 93 of 93 from Escherichia coli K-12 Strain
FT                   MG1655: B0392"
FT                   /db_xref="EnsemblGenomes-Gn:Z0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54738"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCI0"
FT                   /protein_id="AAG54738.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPASLLTTLTESQDRSLAINNPQLAAD
FT                   VKTVWLKEDPSLLLFVDKPDLSQLRDLVKTGATRKIRNEARHRLEEKQ"
FT   gene            470662..471111
FT                   /locus_tag="Z0491"
FT   CDS_pept        470662..471111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0491"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2K8"
FT                   /protein_id="AAG54739.1"
FT                   /translation="MTQRPWSKLQREIYDLLTPTINLQIHCTRYPMRSQNGGSTDLPRY
FT                   WITLDKNVIWDYPKDFIAGNGGVRNFHGETCWYPYLTDICSISDLLREYIDTPKAELLT
FT                   KQFTSDKWGLVNILRAADRRIGMRRLDQLRRKTHNIAALKNYCPP"
FT   misc_feature    470691..471062
FT                   /locus_tag="Z0491"
FT                   /note="O-island #23; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(471196..472107)
FT                   /gene="yaiD"
FT                   /locus_tag="Z0492"
FT   CDS_pept        complement(471196..472107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiD"
FT                   /locus_tag="Z0492"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 303 of 303 are 99.66 pct identical to
FT                   residues 1 to 303 of 303 from Escherichia coli K-12 Strain
FT                   MG1655: B0393"
FT                   /db_xref="EnsemblGenomes-Gn:Z0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54740"
FT                   /db_xref="GOA:Q8XEA1"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEA1"
FT                   /protein_id="AAG54740.1"
FT                   /translation="MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLSMANPIELTLTEWVRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQNLIEGLGGEAQR"
FT   gene            472094..473140
FT                   /gene="yajF"
FT                   /locus_tag="Z0493"
FT   CDS_pept        472094..473140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajF"
FT                   /locus_tag="Z0493"
FT                   /product="hypothetical protein"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 1 to 348 of 348 are 99.42 pct identical to
FT                   residues 1 to 348 of 348 from Escherichia coli K-12 Strain
FT                   MG1655: B0394"
FT                   /db_xref="EnsemblGenomes-Gn:Z0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54741"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCC7"
FT                   /protein_id="AAG54741.1"
FT                   /translation="MNHSMIISTALSLNLAGMITNCRRPCIANPVVRLYAIDIEKNKES
FT                   TVRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRG
FT                   TVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDG
FT                   AAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPC
FT                   YCGKQGCIETFISGTGFATDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKS
FT                   LAHVVNILDPDVIVLGGGMSNVDRLYQTVPQLIKQFVFGGECETPVRKAKHGDSSGVRG
FT                   AAWLWPQE"
FT   gene            complement(473283..474467)
FT                   /gene="araJ"
FT                   /locus_tag="Z0494"
FT   CDS_pept        complement(473283..474467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="Z0494"
FT                   /product="involved in either transport or processing of
FT                   arabinose polymers"
FT                   /function="transport; Degradation of small molecules:
FT                   Carbon compounds"
FT                   /note="Residues 1 to 394 of 394 are 99.49 pct identical to
FT                   residues 1 to 394 of 394 from Escherichia coli K-12 Strain
FT                   MG1655: B0396"
FT                   /db_xref="EnsemblGenomes-Gn:Z0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54742"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDU9"
FT                   /protein_id="AAG54742.1"
FT                   /translation="MKKVILSLALGTFGLGMAEFGIMGVLTELAHNVGISIPAAGHMIS
FT                   YYALGVVVGAPIIALFSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFP
FT                   HGAFFGVGAIVLSKIIKPGKVTAAVAGMVSGMTVANLLGIPLGTYLSQEFSWRYTFLLI
FT                   AVFNIAVMASVYFWVPDIRDEAKGKLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYV
FT                   KPYMMFISGFSETAMTFIMMLVGLGMVLGNMLSGRISGRYSPLRIAAVTDFIIVLALLM
FT                   LFFCGGMKTTSLIFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAVG
FT                   AYCGGMMLTLGLAYNYVALPAALLSFAAMSSLLLYGRYKRQQAADSPVLAKPLG"
FT   gene            complement(474593..477736)
FT                   /gene="sbcC"
FT                   /locus_tag="Z0495"
FT   CDS_pept        complement(474593..477736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="Z0495"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of DNA"
FT                   /note="Residues 1 to 1047 of 1047 are 97.80 pct identical
FT                   to residues 1 to 1048 of 1048 from Escherichia coli K-12
FT                   Strain MG1655: B0397"
FT                   /db_xref="EnsemblGenomes-Gn:Z0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54743"
FT                   /db_xref="GOA:A0A384KT31"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KT31"
FT                   /protein_id="AAG54743.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNRARNQ
FT                   PDGNLQVPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKPKERAELLEELTGTEIYGQISAMVFEQHKSARTELEKLQAQASGVALLTPEQVQSLT
FT                   ASLQVLTDEEKQLLTAQQQEQQSLNWLTRLDELQQEASRRQQALQQALAEEEKAQPQLA
FT                   ALSLAQPARNLRPHWERIAEHSAALAHTRQQIEEVNTRLQNTMALRASIRHHAAKQSAE
FT                   LQQQQQSLNTWLQEHDRFRQWNNELAGWRAQFSQQTSDREHLRQWQQQLTHAEQKLNAL
FT                   AAITLMLTADEVATALAQHAEQRPLRQRLVALHGQIVPQQKRLAQLMVTIQNVTLEQTQ
FT                   RNAALNEMRQRYKEKTQQLADVKTICEQEARIKTLEAQRAQLQAGQPCPLCGSTSHPAV
FT                   EAYQALEPGVNQSRLLALENEVKKLGEEGAALRGQLDALTKQLQRDENEAQSLRQDEQA
FT                   LTQQWQAVTASLNITLQPQDDIQPWLDAQDEHERQLRLLSQRHELQGQIAAHNQQIIQY
FT                   QQQIEQRQQQLLTALAGYALTLPQEDEEESWLATRQQEAQSWQQRQNELTALQNRIQQL
FT                   TPILETLPQSDDLPHSEETVALDNWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQ
FT                   FDTALQASVFDDQQAFLAALMDEQTLTQLEQLKQNLENQRRQAQTLVTQTAETLAQHQQ
FT                   HRPDGLALTVTVEQIQQELAQTHQKLRENTTSQGEIRQQLKQDADNRQQQQTLLQQIAQ
FT                   MTQQVEDWGYLNSLIGSKEGDKFRKFAQGLTLDNLVHLANQQLTRLHGRYLLQRKASEA
FT                   LEVEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLD
FT                   SETLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLESTFAVK"
FT   gene            complement(477733..478935)
FT                   /gene="sbcD"
FT                   /locus_tag="Z0496"
FT   CDS_pept        complement(477733..478935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="Z0496"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of DNA"
FT                   /note="Residues 1 to 400 of 400 are 100.00 pct identical to
FT                   residues 1 to 400 of 400 from Escherichia coli K-12 Strain
FT                   MG1655: B0398"
FT                   /db_xref="EnsemblGenomes-Gn:Z0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54744"
FT                   /db_xref="GOA:P0AG77"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG77"
FT                   /protein_id="AAG54744.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSREAEHQAFLDWLLETAQTHQVDAIIV
FT                   AGDVFDTGSPPSYARTLYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDIMAFLNTTV
FT                   VASAGHAPQILPRRDGTPGAVLCPIPFLRPRDIITSQAGLNGIEKQQHLLAAITDYYQQ
FT                   HYADACKLRGDQPLPIIATGHLTTVGASKSDAVRDIYIGTLDAFPAQNFPPADYIALGH
FT                   IHRAQIIGGMEHVRYCGSPIPLSFDECGKSKYVHLVTFSNGKLESVENLNVPVTQPMAV
FT                   LKGDLASITAQLEQWRDVSQEPPVWLDIEITTDEYLHDIQRKIQALTESLPVEVLLVRR
FT                   SREQRERVLASQQRETLSELSVEEVFNRRLALEELDESQQQRLQHLFTTTLHTLAGEHE
FT                   A"
FT   gene            479125..479814
FT                   /gene="phoB"
FT                   /locus_tag="Z0497"
FT   CDS_pept        479125..479814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="Z0497"
FT                   /product="positive response regulator for pho regulon,
FT                   sensor is PhoR (or CreC)"
FT                   /function="regulator; Global regulatory functions"
FT                   /note="Residues 1 to 229 of 229 are 100.00 pct identical to
FT                   residues 1 to 229 of 229 from Escherichia coli K-12 Strain
FT                   MG1655: B0399"
FT                   /db_xref="EnsemblGenomes-Gn:Z0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54745"
FT                   /db_xref="GOA:P0AFJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFJ6"
FT                   /protein_id="AAG54745.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP
FT                   WPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   gene            479872..481167
FT                   /gene="phoR"
FT                   /locus_tag="Z0498"
FT   CDS_pept        479872..481167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="Z0498"
FT                   /product="positive and negative sensor protein for pho
FT                   regulon"
FT                   /function="enzyme; Global regulatory functions"
FT                   /note="Residues 1 to 431 of 431 are 99.07 pct identical to
FT                   residues 1 to 431 of 431 from Escherichia coli K-12 Strain
FT                   MG1655: B0400"
FT                   /db_xref="EnsemblGenomes-Gn:Z0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54746"
FT                   /db_xref="GOA:A0A4Q0C244"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C244"
FT                   /protein_id="AAG54746.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSVISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIVKNSD"
FT   gene            481574..482893
FT                   /gene="brnQ"
FT                   /locus_tag="Z0499"
FT   CDS_pept        481574..482893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="Z0499"
FT                   /product="branched chain amino acid transport system II
FT                   carrier protein"
FT                   /function="transport; Transport of small molecules: Amino
FT                   acids, amines"
FT                   /note="Residues 1 to 439 of 439 are 100.00 pct identical to
FT                   residues 1 to 439 of 439 from Escherichia coli K-12 Strain
FT                   MG1655: B0401"
FT                   /db_xref="EnsemblGenomes-Gn:Z0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54747"
FT                   /db_xref="GOA:P0ADA0"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ADA0"
FT                   /protein_id="AAG54747.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
FT   gene            482969..484342
FT                   /gene="proY"
FT                   /locus_tag="Z0500"
FT   CDS_pept        482969..484342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="Z0500"
FT                   /product="proline permease transport protein"
FT                   /function="transport; Transport of small molecules: Amino
FT                   acids, amines"
FT                   /note="Residues 1 to 457 of 457 are 100.00 pct identical to
FT                   residues 1 to 457 of 457 from Escherichia coli K-12 Strain
FT                   MG1655: B0402"
FT                   /db_xref="EnsemblGenomes-Gn:Z0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54748"
FT                   /db_xref="GOA:P0AAE4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAE4"
FT                   /protein_id="AAG54748.1"
FT                   /translation="MESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGIAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGFGIIIWGIGNGGQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTT
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVP
FT                   GGVATTIGGLIFLLFIIGLIGYHPDTRISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ"
FT   gene            484498..486315
FT                   /gene="malZ"
FT                   /locus_tag="Z0501"
FT   CDS_pept        484498..486315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="Z0501"
FT                   /product="maltodextrin glucosidase"
FT                   /function="enzyme; Degradation of small molecules: Carbon
FT                   compounds"
FT                   /note="Residues 1 to 605 of 605 are 98.67 pct identical to
FT                   residues 1 to 605 of 605 from Escherichia coli K-12 Strain
FT                   MG1655: B0403"
FT                   /db_xref="EnsemblGenomes-Gn:Z0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54749"
FT                   /db_xref="GOA:Q8XE98"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE98"
FT                   /protein_id="AAG54749.1"
FT                   /translation="MMLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNE
FT                   EMSVPMHKQRSQPQPGVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPA
FT                   RLEQFAVDVPDIGPQWAADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWD
FT                   EPVTAQAGGSTFYGGDLDGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDP
FT                   QFGGDGALLRLRHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDW
FT                   YSFSDDGTALDWLGYASLPKLDYQSESLVNEIYRGEDSIVRHWLKAPWNMBGXRLDVVH
FT                   MLGEAGGARNNLQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTF
FT                   PLWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLG
FT                   REVARLPLAVVWLFTWPGVPCIYYGDEVGLDGKNDPFCRKPFPWQVEKQDMALFALYQR
FT                   MIALRKKSQALRRGGCQVLYAEDNVVVFVRVLNQQRVLVAINRGEACEVVLPASPFLNV
FT                   VQWQRKEGHGQLTDGILALPAISATVWMN"
FT   misc_feature    486316..487965
FT                   /note="O-island #24; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            486503..487948
FT                   /locus_tag="Z0502"
FT   CDS_pept        486503..487948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0502"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 207 to 352 of 481 are 25.65 pct identical
FT                   to residues 461 to 610 of 628 from GenPept 118 :
FT                   gi|7302721|gb|AAF57799.1| (AE003802) CG12298 gene product
FT                   [Drosophila melanogaster]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2L6"
FT                   /protein_id="AAG54750.1"
FT                   /translation="MTISNSNLLKPFITGTELPPFKEDVFSKTEEQFKKSTYGKSLFIS
FT                   GNENLVNISAEKIDEIKNSKNFFSNIVNIIILLIKHPDKILPILHGCPVESIEVIKNAK
FT                   RTGQWSYEMTDKNGQSIEVSYIFTDTIDDKSDGKLCLKICNSCNQNDSSTHEYKIDHQQ
FT                   LKNHIRQLEEWALLEKFYDNNAYYSKRTKQLEKKIADAGFITRKVKAENFNVKEFKDDI
FT                   ASMLCEQPPMRTHQISSSGYVSADKLHKLYKTNLEDAQRDLKTTPVDIDGVSLKSITRE
FT                   KIAEEIAKKTAEIIAKQNAKSIEEKNIEKNKKQTNSEDNFVLKFSPEEINEMLLDYSDE
FT                   EQKKLRPFFTSDHIYCLFDAFSQGLHNVARNGSPRYAGLLRQIASKSAILQDFDQQLFW
FT                   RTFTGGVLHRHISVKSEPEKTDVWRFSSQFDFPHINENGELSRTVLMFEGVAESNFKDI
FT                   ANHSSECFSYRCYAAPLDANAKK"
FT   gene            complement(487969..488550)
FT                   /gene="yajB"
FT                   /locus_tag="Z0503"
FT   CDS_pept        complement(487969..488550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajB"
FT                   /locus_tag="Z0503"
FT                   /product="putative glycoprotein"
FT                   /function="orf; Not classified"
FT                   /note="Residues 1 to 193 of 193 are 99.48 pct identical to
FT                   residues 1 to 193 of 193 from Escherichia coli K-12 Strain
FT                   MG1655: B0404"
FT                   /db_xref="EnsemblGenomes-Gn:Z0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54751"
FT                   /db_xref="GOA:Q8XE96"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE96"
FT                   /protein_id="AAG54751.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYAALETRFWQFYPRMMAQASRKAL"
FT   gene            488643..489713
FT                   /gene="queA"
FT                   /locus_tag="Z0504"
FT   CDS_pept        488643..489713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="Z0504"
FT                   /product="synthesis of queuine in tRNA; probably
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /function="enzyme; Amino acyl tRNA syn; tRNA modific'n"
FT                   /note="Residues 1 to 356 of 356 are 100.00 pct identical to
FT                   residues 1 to 356 of 356 from Escherichia coli K-12 Strain
FT                   MG1655: B0405"
FT                   /db_xref="EnsemblGenomes-Gn:Z0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54752"
FT                   /db_xref="GOA:P0A7G0"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7G0"
FT                   /protein_id="AAG54752.1"
FT                   /translation="MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   AELLLGDDESINATMTARHGALFEVEFNDERSVLDILNSIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQ
FT                   IFIYPGFQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDA
FT                   MFITYNPQAINERVGE"
FT   gene            489768..490895
FT                   /gene="tgt"
FT                   /locus_tag="Z0505"
FT   CDS_pept        489768..490895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="Z0505"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /function="enzyme; Amino acyl tRNA syn; tRNA modific'n"
FT                   /note="Residues 1 to 375 of 375 are 100.00 pct identical to
FT                   residues 1 to 375 of 375 from Escherichia coli K-12 Strain
FT                   MG1655: B0406"
FT                   /db_xref="EnsemblGenomes-Gn:Z0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54753"
FT                   /db_xref="GOA:P0A849"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A849"
FT                   /protein_id="AAG54753.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD"
FT   gene            490918..491250
FT                   /gene="yajC"
FT                   /locus_tag="Z0506"
FT   CDS_pept        490918..491250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="Z0506"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 110 of 110 are 100.00 pct identical to
FT                   residues 1 to 110 of 110 from Escherichia coli K-12 Strain
FT                   MG1655: B0407"
FT                   /db_xref="EnsemblGenomes-Gn:Z0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54754"
FT                   /db_xref="GOA:P0ADZ9"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ADZ9"
FT                   /protein_id="AAG54754.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            491278..493125
FT                   /gene="secD"
FT                   /locus_tag="Z0507"
FT   CDS_pept        491278..493125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="Z0507"
FT                   /product="protein secretion; membrane protein, part of the
FT                   channel"
FT                   /function="transport; Transport of large molecules:
FT                   Protein, peptide secretion"
FT                   /note="Residues 1 to 615 of 615 are 100.00 pct identical to
FT                   residues 1 to 615 of 615 from Escherichia coli K-12 Strain
FT                   MG1655: B0408"
FT                   /db_xref="EnsemblGenomes-Gn:Z0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54755"
FT                   /db_xref="GOA:P0AG91"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG91"
FT                   /protein_id="AAG54755.1"
FT                   /translation="MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAA
FT                   SEQTLIQVQKTLQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALN
FT                   LAPATPRWLAAIHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGINNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACL
FT                   AGLLVSILFMIIFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIVGTRAIVNLLYGGKRVKKLSI"
FT   gene            493136..494107
FT                   /gene="secF"
FT                   /locus_tag="Z0508"
FT   CDS_pept        493136..494107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="Z0508"
FT                   /product="protein secretion, membrane protein"
FT                   /function="transport; Transport of large molecules:
FT                   Protein, peptide secretion"
FT                   /note="Residues 1 to 323 of 323 are 100.00 pct identical to
FT                   residues 1 to 323 of 323 from Escherichia coli K-12 Strain
FT                   MG1655: B0409"
FT                   /db_xref="EnsemblGenomes-Gn:Z0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54756"
FT                   /db_xref="GOA:P0AG95"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG95"
FT                   /protein_id="AAG54756.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGE
FT                   TGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   misc_feature    494109..494795
FT                   /note="O-island #25; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            494258..494500
FT                   /locus_tag="Z0509"
FT   CDS_pept        494258..494500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0509"
FT                   /product="unknown"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 70 of 80 are 45.71 pct identical to
FT                   residues 1 to 70 of 80 from GenPept 118 :
FT                   gi|4324374|gb|AAD16851.1| (AF102990) unknown [Yersinia
FT                   enterocolitica]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54757"
FT                   /db_xref="GOA:P58092"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58092"
FT                   /protein_id="AAG54757.1"
FT                   /translation="MRKITSVSVGEQLDSFITRMVQSGRYGSASEVMRSALRLLEQQES
FT                   RDEAVRNAVIEGLESGESSMTLRDIAAERKQKHRV"
FT   gene            494493..494774
FT                   /locus_tag="Z0510"
FT   CDS_pept        494493..494774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0510"
FT                   /product="unknown"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 88 of 93 are 37.07 pct identical to
FT                   residues 1 to 89 of 99 from GenPept 118 :
FT                   gi|3822096|gb|AAC69816.1| (AF074612) unknown [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54758"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C295"
FT                   /protein_id="AAG54758.1"
FT                   /translation="MYKLSGKAVEDFRGIYDYTLGKFGDEQADRYTDSLGTFLDTLSQM
FT                   PEIGQDYDAIPEVKKIAFRFHTVYYVIRVDDILIARILHQLMEPRRHW"
FT   gene            494862..495209
FT                   /gene="yajD"
FT                   /locus_tag="Z0511"
FT   CDS_pept        494862..495209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="Z0511"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 115 of 115 are 100.00 pct identical to
FT                   residues 1 to 115 of 115 from Escherichia coli K-12 Strain
FT                   MG1655: B0410"
FT                   /db_xref="EnsemblGenomes-Gn:Z0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54759"
FT                   /db_xref="GOA:P0AAQ4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAQ4"
FT                   /protein_id="AAG54759.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
FT   gene            complement(495386..496270)
FT                   /gene="tsx"
FT                   /locus_tag="Z0512"
FT   CDS_pept        complement(495386..496270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="Z0512"
FT                   /product="nucleoside channel; receptor of phage T6 and
FT                   colicin K"
FT                   /function="transport; Transport of small molecules:
FT                   Nucleosides, purines, pyrimidines"
FT                   /note="Residues 1 to 294 of 294 are 100.00 pct identical to
FT                   residues 1 to 294 of 294 from Escherichia coli K-12 Strain
FT                   MG1655: B0411"
FT                   /db_xref="EnsemblGenomes-Gn:Z0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54760"
FT                   /db_xref="GOA:P0A928"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A928"
FT                   /protein_id="AAG54760.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   BAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
FT   gene            complement(496569..497168)
FT                   /gene="yajI"
FT                   /locus_tag="Z0513"
FT   CDS_pept        complement(496569..497168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="Z0513"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 199 of 199 are 98.49 pct identical to
FT                   residues 1 to 199 of 199 from Escherichia coli K-12 Strain
FT                   MG1655: B0412"
FT                   /db_xref="EnsemblGenomes-Gn:Z0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54761"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDS5"
FT                   /protein_id="AAG54761.1"
FT                   /translation="MLSLLLPSTIRLIATRKGRPMNINVFRLILLGSLFSLSACVQQSE
FT                   VRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLR
FT                   MSLVNITPDTDGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAP
FT                   ASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQ"
FT   gene            497259..497708
FT                   /gene="ybaD"
FT                   /locus_tag="Z0514"
FT   CDS_pept        497259..497708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="Z0514"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 149 of 149 are 100.00 pct identical to
FT                   residues 1 to 149 of 149 from Escherichia coli K-12 Strain
FT                   MG1655: B0413"
FT                   /db_xref="EnsemblGenomes-Gn:Z0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54762"
FT                   /db_xref="GOA:P0A8D2"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8D2"
FT                   /protein_id="AAG54762.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
FT   gene            497712..498815
FT                   /gene="ribD"
FT                   /locus_tag="Z0515"
FT   CDS_pept        497712..498815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="Z0515"
FT                   /product="bifunctional pyrimidine deaminase/reductase in
FT                   pathway of riboflavin synthesis"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Riboflavin"
FT                   /note="Residues 1 to 367 of 367 are 97.82 pct identical to
FT                   residues 1 to 367 of 367 from Escherichia coli K-12 Strain
FT                   MG1655: B0414"
FT                   /db_xref="EnsemblGenomes-Gn:Z0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54763"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C443"
FT                   /protein_id="AAG54763.1"
FT                   /translation="MQDEYYMARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWSELDVQTQALYPQH
FT                   HLRQPVRIVIDSQNRVTPEHHIVQQPGETWFARTQEDSREWPETVRTLLIPEHKGHLDL
FT                   VVLMMQLGKQQINSIWVEAGPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLE
FT                   KLADAPQFKFKEIRHVGPDVCLHLVGA"
FT   gene            498904..499374
FT                   /locus_tag="Z0516"
FT   CDS_pept        498904..499374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0516"
FT                   /product="hypothetical protein"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Riboflavin"
FT                   /note="Residues 1 to 156 of 156 are 100.00 pct identical to
FT                   residues 1 to 156 of 156 from Escherichia coli K-12 Strain
FT                   MG1655: B0415"
FT                   /db_xref="EnsemblGenomes-Gn:Z0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54764"
FT                   /db_xref="GOA:P61717"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61717"
FT                   /protein_id="AAG54764.1"
FT                   /translation="MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVK
FT                   DENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHV
FT                   AQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   gene            499394..499813
FT                   /gene="nusB"
FT                   /locus_tag="Z0518"
FT   CDS_pept        499394..499813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="Z0518"
FT                   /product="transcription termination; L factor"
FT                   /function="factor; Macromolecule synthesis, modification:
FT                   RNA synthesis, modification, DNA transcript'n"
FT                   /note="Residues 1 to 139 of 139 are 100.00 pct identical to
FT                   residues 1 to 139 of 139 from Escherichia coli K-12 Strain
FT                   MG1655: B0416"
FT                   /db_xref="EnsemblGenomes-Gn:Z0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54765"
FT                   /db_xref="GOA:P0A782"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A782"
FT                   /protein_id="AAG54765.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   gene            499891..500868
FT                   /gene="thiL"
FT                   /locus_tag="Z0519"
FT   CDS_pept        499891..500868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="Z0519"
FT                   /product="thiamin-monophosphate kinase"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Thiamin"
FT                   /note="Residues 1 to 325 of 325 are 99.69 pct identical to
FT                   residues 1 to 325 of 325 from Escherichia coli K-12 Strain
FT                   MG1655: B0417"
FT                   /db_xref="EnsemblGenomes-Gn:Z0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54766"
FT                   /db_xref="GOA:Q8XE87"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE87"
FT                   /protein_id="AAG54766.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVVPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTLDWKGYDHFATP"
FT   gene            500846..501361
FT                   /gene="pgpA"
FT                   /locus_tag="Z0520"
FT   CDS_pept        500846..501361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="Z0520"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /function="enzyme; Macromolecule synthesis, modification:
FT                   Phospholipids"
FT                   /note="Residues 1 to 171 of 171 are 100.00 pct identical to
FT                   residues 1 to 171 of 172 from Escherichia coli K-12 Strain
FT                   MG1655: B0418"
FT                   /db_xref="EnsemblGenomes-Gn:Z0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54767"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C272"
FT                   /protein_id="AAG54767.1"
FT                   /translation="MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAA
FT                   IPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMA
FT                   LPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIG
FT                   HHWPLGIL"
FT   misc_feature    501358..503340
FT                   /note="O-island #26; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(501539..503110)
FT                   /locus_tag="Z0521"
FT   CDS_pept        complement(501539..503110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0521"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 173 to 335 of 523 are 27.54 pct identical
FT                   to residues 124 to 287 of 295 from GenPept 118 :
FT                   gi|886362|gb|AAA69501.1| (L42525) product unknown; 32 kd
FT                   ORF [Plasmid pSW200]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54768"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2A4"
FT                   /protein_id="AAG54768.1"
FT                   /translation="MMKTITKQPILFTDVPVADLRNSMKQDLNQNLIERLWNKIRDFFL
FT                   DSDKQKAFKSIHKYINTLSVLNYNSALTPDPNFNIDATSDLDSYLKLDFDRLSPKQKQT
FT                   TLCCFWNKIASSLPEPYNSTIKHNIIFYKDGENLMIRGTISIVNEVVKTYSLPIEKDDN
FT                   GYYDFSGLYLAHSNISGKDPNKDPDIDFGIDMGNCNCSNVNFEHTYFYGVKFTNANCTN
FT                   ANFNNCRFKKCDLTNMNCTGAILDNAMIYGKEKEPEMQYPEADQIIQRITYQKSDGNET
FT                   KGMILTNCSCVKTTFNWADLSESDCQNVDFSEANLSNTILPDIVRMKGTKLYRTDLFNP
FT                   ILKTEAESTEEKDISPLAKIILDYIESDKNPESLNFEEKSTVIKIKQDIDNFIFYNQHL
FT                   KKIFNRAMNLQEKISRKKYNEFFKYIQAEAKQYFKDQYKLTKNDYLKKVPLTAQLIAKY
FT                   KMDDQLDQLLVTREIQDEIKSKIQDKIDELSKNLFNTMTETIENNFDDIFRQQSENMSN
FT                   YYEFVD"
FT   gene            complement(503341..504315)
FT                   /gene="yajO"
FT                   /locus_tag="Z0522"
FT   CDS_pept        complement(503341..504315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="Z0522"
FT                   /product="putative NAD(P)H-dependent xylose reductase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 324 of 324 are 99.69 pct identical to
FT                   residues 25 to 348 of 348 from Escherichia coli K-12 Strain
FT                   MG1655: B0419"
FT                   /db_xref="EnsemblGenomes-Gn:Z0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54769"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2A3"
FT                   /protein_id="AAG54769.1"
FT                   /translation="MQYNPLGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFSRREDVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLRRLGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALELQKQHGWAQFVSMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDEVGKNLYKESDENDAQIAERLTGVSEELGATRAQVALAWLLSKPGIAA
FT                   PIIGTSREEQLDELLNAVDITLKPEQIAELETPYKPHPVVGFK"
FT   gene            complement(504370..506232)
FT                   /gene="dxs"
FT                   /locus_tag="Z0523"
FT   CDS_pept        complement(504370..506232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="Z0523"
FT                   /product="1-deoxyxylulose-5-phosphate synthase;
FT                   flavoprotein"
FT                   /function="enzyme; Central intermediary metabolism: Pool,
FT                   multipurpose conversions of intermed. met'm"
FT                   /note="Residues 1 to 620 of 620 are 99.67 pct identical to
FT                   residues 1 to 620 of 620 from Escherichia coli K-12 Strain
FT                   MG1655: B0420"
FT                   /db_xref="EnsemblGenomes-Gn:Z0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54770"
FT                   /db_xref="GOA:Q8XE76"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE76"
FT                   /protein_id="AAG54770.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRA
FT                   YDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECR
FT                   QMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPE
FT                   AAKVAESLNATLVDMRFVKPLDETLILEMAASHEALVTVEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA"
FT   gene            complement(506257..507156)
FT                   /gene="ispA"
FT                   /locus_tag="Z0524"
FT   CDS_pept        complement(506257..507156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="Z0524"
FT                   /product="geranyltranstransferase (farnesyldiphosphate
FT                   synthase)"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Menaquinone, ubiquinone"
FT                   /note="Residues 1 to 299 of 299 are 99.33 pct identical to
FT                   residues 1 to 299 of 299 from Escherichia coli K-12 Strain
FT                   MG1655: B0421"
FT                   /db_xref="EnsemblGenomes-Gn:Z0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54771"
FT                   /db_xref="GOA:A0A4Q0C2V8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2V8"
FT                   /protein_id="AAG54771.1"
FT                   /translation="MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGK
FT                   RLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVK
FT                   FGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLD
FT                   AEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKAQDLIDDARQSLKQLAEQS
FT                   IDTSALEALADYIIQRNK"
FT   gene            complement(507156..507398)
FT                   /gene="xseB"
FT                   /locus_tag="Z0525"
FT   CDS_pept        complement(507156..507398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="Z0525"
FT                   /product="exonuclease VII, small subunit"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of DNA"
FT                   /note="Residues 1 to 80 of 80 are 100.00 pct identical to
FT                   residues 1 to 80 of 80 from Escherichia coli K-12 Strain
FT                   MG1655: B0422"
FT                   /db_xref="EnsemblGenomes-Gn:Z0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54772"
FT                   /db_xref="GOA:P0A8H1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8H1"
FT                   /protein_id="AAG54772.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
FT   gene            507604..509052
FT                   /gene="yajK"
FT                   /locus_tag="Z0526"
FT   CDS_pept        507604..509052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajK"
FT                   /locus_tag="Z0526"
FT                   /product="putative oxidoreductase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 482 of 482 are 98.54 pct identical to
FT                   residues 1 to 482 of 482 from Escherichia coli K-12 Strain
FT                   MG1655: B0423"
FT                   /db_xref="EnsemblGenomes-Gn:Z0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54773"
FT                   /db_xref="GOA:Q8XE74"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE74"
FT                   /protein_id="AAG54773.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLTIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLDG
FT                   KTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKSKIEAEEEKFDFSILDKVVEEANNVDIREIAQQTGQEVVEVE
FT                   TVNDFGPNDVILDIRSVDEQEDKPLKVEGIDVVSLPFYKLSTKFGDLDQNRTWLLWCER
FT                   GVMSRLQALYLREQGFKNVKVYRP"
FT   gene            complement(509106..509702)
FT                   /gene="thiJ"
FT                   /locus_tag="Z0527"
FT   CDS_pept        complement(509106..509702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="Z0527"
FT                   /product="4-methyl-5(beta-hydroxyethyl)-thiazole
FT                   monophosphate synthesis"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Biotin"
FT                   /note="Residues 1 to 198 of 198 are 98.98 pct identical to
FT                   residues 1 to 198 of 198 from Escherichia coli K-12 Strain
FT                   MG1655: B0424"
FT                   /db_xref="EnsemblGenomes-Gn:Z0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54774"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCJ0"
FT                   /protein_id="AAG54774.1"
FT                   /translation="MNMSASALVCLAPGSEETEAVTTIDLLIRGGIKVTTASVASDGNL
FT                   AITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIV
FT                   AAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTA
FT                   IDFGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
FT   gene            complement(509659..510570)
FT                   /gene="apbA"
FT                   /locus_tag="Z0528"
FT   CDS_pept        complement(509659..510570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /locus_tag="Z0528"
FT                   /product="involved in thiamin biosynthesis, alternative
FT                   pyrimidine biosynthesis"
FT                   /function="phenotype; Not classified"
FT                   /note="Residues 1 to 303 of 303 are 99.33 pct identical to
FT                   residues 1 to 303 of 303 from Escherichia coli K-12 Strain
FT                   MG1655: B0425"
FT                   /db_xref="EnsemblGenomes-Gn:Z0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54775"
FT                   /db_xref="GOA:Q8XE72"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE72"
FT                   /protein_id="AAG54775.1"
FT                   /translation="MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETD
FT                   GSIFNESLTANDPDFLATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIE
FT                   ELQNIQQPLLMGTTTHAACRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDV
FT                   AWHNNIRAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHT
FT                   SAEDLRDYVMQVIDATAENISSMLQDIRTLRHTEIDYINGFLLRRARAHGIAVPENTRL
FT                   FEMVKRKESEYERIGTGLPRPW"
FT   gene            510720..511229
FT                   /gene="yajQ"
FT                   /locus_tag="Z0529"
FT   CDS_pept        510720..511229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="Z0529"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 169 of 169 are 100.00 pct identical to
FT                   residues 1 to 169 of 169 from Escherichia coli K-12 Strain
FT                   MG1655: B0426"
FT                   /db_xref="EnsemblGenomes-Gn:Z0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54776"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8E9"
FT                   /protein_id="AAG54776.1"
FT                   /translation="MKGEEKMPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASF
FT                   ELNDASKTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKL
FT                   KQGIESATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQ
FT                   FKNFRD"
FT   gene            complement(511357..512727)
FT                   /gene="yajR"
FT                   /locus_tag="Z0530"
FT   CDS_pept        complement(511357..512727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="Z0530"
FT                   /product="putative transport protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 456 of 456 are 98.90 pct identical to
FT                   residues 1 to 456 of 456 from Escherichia coli K-12 Strain
FT                   MG1655: B0427"
FT                   /db_xref="EnsemblGenomes-Gn:Z0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54777"
FT                   /db_xref="GOA:A0A0H3JFY5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFY5"
FT                   /protein_id="AAG54777.1"
FT                   /translation="MVMNDYKMTPGERRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQ
FT                   GASEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIW
FT                   GIILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITHK
FT                   LGLHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRLLKLNFG
FT                   IMCLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMLIAFGSVVPFIIYAEVKRKMKQ
FT                   VFVFCVGLIVVAEIVLRNAQTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYKGT
FT                   AMGVYSTSQFLGVAIGGSLGGWIDGMFDGQGVFLAGAMLAAVWLAVASTMKEPPYVSSL
FT                   RIEIPANIAANEALKVRLLETEGIKEVLIAEEEHSAYVKIDSKVTNRFDVEQAIRQA"
FT   gene            complement(512870..513760)
FT                   /gene="cyoE"
FT                   /locus_tag="Z0531"
FT   CDS_pept        complement(512870..513760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="Z0531"
FT                   /product="protoheme IX farnesyltransferase (haeme O
FT                   biosynthesis)"
FT                   /function="enzyme; Energy metabolism, carbon: Aerobic
FT                   respiration"
FT                   /note="Residues 1 to 296 of 296 are 100.00 pct identical to
FT                   residues 1 to 296 of 296 from Escherichia coli K-12 Strain
FT                   MG1655: B0428"
FT                   /db_xref="EnsemblGenomes-Gn:Z0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54778"
FT                   /db_xref="GOA:P0AEA7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEA7"
FT                   /protein_id="AAG54778.1"
FT                   /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
FT                   VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFMLLWFG
FT                   ANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEFDSGAA
FT                   ILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLM
FT                   LSLGGYAGYKYLVVAAAVSVWWLGMALRGYKVADDRIWARKLFGFSIIAITALSVMMSV
FT                   DFMVPDSHTLLAAVW"
FT   gene            complement(513772..514101)
FT                   /gene="cyoD"
FT                   /locus_tag="Z0532"
FT   CDS_pept        complement(513772..514101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="Z0532"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /function="enzyme; Energy metabolism, carbon: Aerobic
FT                   respiration"
FT                   /note="Residues 1 to 109 of 109 are 100.00 pct identical to
FT                   residues 1 to 109 of 109 from Escherichia coli K-12 Strain
FT                   MG1655: B0429"
FT                   /db_xref="EnsemblGenomes-Gn:Z0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54779"
FT                   /db_xref="GOA:P0ABJ7"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABJ7"
FT                   /protein_id="AAG54779.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(514101..514715)
FT                   /gene="cyoC"
FT                   /locus_tag="Z0533"
FT   CDS_pept        complement(514101..514715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="Z0533"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /function="enzyme; Energy metabolism, carbon: Aerobic
FT                   respiration"
FT                   /note="Residues 1 to 204 of 204 are 99.50 pct identical to
FT                   residues 1 to 204 of 204 from Escherichia coli K-12 Strain
FT                   MG1655: B0430"
FT                   /db_xref="EnsemblGenomes-Gn:Z0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54780"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2P4"
FT                   /protein_id="AAG54780.1"
FT                   /translation="MATDTLTHATVHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
FT   gene            complement(514705..516696)
FT                   /gene="cyoB"
FT                   /locus_tag="Z0534"
FT   CDS_pept        complement(514705..516696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="Z0534"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /function="enzyme; Energy metabolism, carbon: Aerobic
FT                   respiration"
FT                   /note="Residues 1 to 663 of 663 are 100.00 pct identical to
FT                   residues 1 to 663 of 663 from Escherichia coli K-12 Strain
FT                   MG1655: B0431"
FT                   /db_xref="EnsemblGenomes-Gn:Z0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54781"
FT                   /db_xref="GOA:P0ABJ0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABJ0"
FT                   /protein_id="AAG54781.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYALGFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMY
FT                   VSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKK
FT                   PDHYEEIHMPKNSGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVD
FT                   YYVPVAEIEKLENQHFDEITKAGLKNGN"
FT   gene            complement(516718..517665)
FT                   /gene="cyoA"
FT                   /locus_tag="Z0535"
FT   CDS_pept        complement(516718..517665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="Z0535"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /function="enzyme; Energy metabolism, carbon: Aerobic
FT                   respiration"
FT                   /note="Residues 1 to 315 of 315 are 99.04 pct identical to
FT                   residues 1 to 315 of 315 from Escherichia coli K-12 Strain
FT                   MG1655: B0432"
FT                   /db_xref="EnsemblGenomes-Gn:Z0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54782"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDK0"
FT                   /protein_id="AAG54782.1"
FT                   /translation="MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGFATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATPDRAAFDQWVAKAKQSPNSMSDMAAFEKLAAPSEYNQVEYFSNVKPNLFADVINKF
FT                   MAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH"
FT   gene            complement(518125..519600)
FT                   /gene="ampG"
FT                   /locus_tag="Z0536"
FT   CDS_pept        complement(518125..519600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="Z0536"
FT                   /product="regulates beta-lactamase synthesis"
FT                   /function="regulator; Protection responses: Drug/analog
FT                   sensitivity"
FT                   /note="Residues 1 to 491 of 491 are 100.00 pct identical to
FT                   residues 1 to 491 of 491 from Escherichia coli K-12 Strain
FT                   MG1655: B0433"
FT                   /db_xref="EnsemblGenomes-Gn:Z0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54783"
FT                   /db_xref="GOA:P0AE17"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE17"
FT                   /protein_id="AAG54783.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFFGRRRGWLLATQILLLVAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADKWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPVPKTLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKHLYSMGAAVFFENLCGGMGTSAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWSTFYLFSVAAAVPGLILL
FT                   LVCRQTLEYTRVNDNFISRTAYPAGYAFAMWTLAAGVSLLAVWLLLLTMDALDLTHFSF
FT                   LPALLEVGVLVALSGVVLGGLLDYLALRKTHLT"
FT   gene            complement(519644..520324)
FT                   /gene="yajG"
FT                   /locus_tag="Z0537"
FT   CDS_pept        complement(519644..520324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="Z0537"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 226 of 226 are 99.55 pct identical to
FT                   residues 1 to 226 of 226 from Escherichia coli K-12 Strain
FT                   MG1655: B0434"
FT                   /db_xref="EnsemblGenomes-Gn:Z0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54784"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDT0"
FT                   /protein_id="AAG54784.1"
FT                   /translation="MMNLHALPTSPRRWQCYDGGNFYQTRLRVSESPNMFKKILFPLVA
FT                   LFMLAGCARPPTTIEVSPTITLPQQDPSLMGVTVSINGADQRTDQALAKVTRDNQIVTL
FT                   TASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQIIVSQLYADVSQGNVRYNIATKADI
FT                   AIIATAQNGNKMTKNYRASYNVEGAFQASNKNIADAVNSVLTDTIADMSQDTSIHEFIK
FT                   QNAR"
FT   gene            520494..520844
FT                   /gene="bolA"
FT                   /locus_tag="Z0539"
FT   CDS_pept        520494..520844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="Z0539"
FT                   /product="possible regulator of murein genes"
FT                   /function="putative regulator; Cell envelop: Murein
FT                   sacculus, peptidoglycan"
FT                   /note="Residues 1 to 116 of 116 are 100.00 pct identical to
FT                   residues 1 to 116 of 116 from Escherichia coli K-12 Strain
FT                   MG1655: B0435"
FT                   /db_xref="EnsemblGenomes-Gn:Z0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54785"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCJ5"
FT                   /protein_id="AAG54785.1"
FT                   /translation="MTSQRCRRRYFMMIRERIEEKLRAAFQPVFLEVVDESYRHNVPAG
FT                   SESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHTYTIKEWEGLQDTVF
FT                   ASPPCRGAGSIA"
FT   gene            521188..522486
FT                   /gene="tig"
FT                   /locus_tag="Z0541"
FT   CDS_pept        521188..522486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="Z0541"
FT                   /product="trigger factor; a molecular chaperone involved in
FT                   cell division"
FT                   /function="factor; Cell division"
FT                   /note="Residues 1 to 432 of 432 are 100.00 pct identical to
FT                   residues 1 to 432 of 432 from Escherichia coli K-12 Strain
FT                   MG1655: B0436"
FT                   /db_xref="EnsemblGenomes-Gn:Z0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54786"
FT                   /db_xref="GOA:P0A851"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A851"
FT                   /protein_id="AAG54786.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFT
FT                   YSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDR
FT                   VTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSA
FT                   IRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVTEKETTFNELMNQQA"
FT   gene            522731..523354
FT                   /gene="clpP"
FT                   /locus_tag="Z0542"
FT   CDS_pept        522731..523354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="Z0542"
FT                   /product="ATP-dependent proteolytic subunit of clpA-clpP
FT                   serine protease, heat shock protein F21.5"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of proteins, peptides, glyco"
FT                   /note="Residues 1 to 207 of 207 are 100.00 pct identical to
FT                   residues 1 to 207 of 207 from Escherichia coli K-12 Strain
FT                   MG1655: B0437"
FT                   /db_xref="EnsemblGenomes-Gn:Z0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54787"
FT                   /db_xref="GOA:P0A6G9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6G9"
FT                   /protein_id="AAG54787.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
FT   gene            523480..524754
FT                   /gene="clpX"
FT                   /locus_tag="Z0543"
FT   CDS_pept        523480..524754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="Z0543"
FT                   /product="ATP-dependent specificity component of clpP
FT                   serine protease, chaperone"
FT                   /function="enzyme; Macromolecule degradation: Degradation
FT                   of proteins, peptides, glyco"
FT                   /note="Residues 1 to 424 of 424 are 100.00 pct identical to
FT                   residues 1 to 424 of 424 from Escherichia coli K-12 Strain
FT                   MG1655: B0438"
FT                   /db_xref="EnsemblGenomes-Gn:Z0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54788"
FT                   /db_xref="GOA:P0A6H3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6H3"
FT                   /protein_id="AAG54788.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIDGQSKPLLIYGKPEAQQASGE"
FT   gene            524897..527296
FT                   /gene="lon"
FT                   /locus_tag="Z0545"
FT   CDS_pept        524897..527296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="Z0545"
FT                   /product="DNA-binding, ATP-dependent protease La; heat
FT                   shock K-protein"
FT                   /function="enzyme; Global regulatory functions"
FT                   /note="Residues 16 to 799 of 799 are 99.74 pct identical to
FT                   residues 1 to 784 of 784 from Escherichia coli K-12 Strain
FT                   MG1655: B0439"
FT                   /db_xref="EnsemblGenomes-Gn:Z0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54789"
FT                   /db_xref="GOA:Q8XE60"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE60"
FT                   /protein_id="AAG54789.1"
FT                   /translation="MSSDYLAEIKLRESSMNPERSERIEIPVLPLRDVVVYPHMVIPLF
FT                   VGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVK
FT                   VLVEGLQRARISALSDNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKI
FT                   PPEVLTSLNSIDDPARLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLL
FT                   QVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKE
FT                   AKEKAEAELQKLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILNTDHY
FT                   GLERVKDRILEYLAVQSRVNKIKGPILCLVXPPGVGKTSLGQSIAKATGRKYVRMALGG
FT                   VRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEV
FT                   LDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIA
FT                   KRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAVKQLLL
FT                   DKSLKHIEINGDNLHDYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPG
FT                   KGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPS
FT                   AGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPF
FT                   ENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   gene            527505..527777
FT                   /gene="hupB"
FT                   /locus_tag="Z0547"
FT   CDS_pept        527505..527777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="Z0547"
FT                   /product="DNA-binding protein HU-beta, NS1 (HU-1)"
FT                   /function="factor; Basic proteins - synthesis,
FT                   modification"
FT                   /note="Residues 1 to 90 of 90 are 100.00 pct identical to
FT                   residues 1 to 90 of 90 from Escherichia coli K-12 Strain
FT                   MG1655: B0440"
FT                   /db_xref="EnsemblGenomes-Gn:Z0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54790"
FT                   /db_xref="GOA:P0ACF6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACF6"
FT                   /protein_id="AAG54790.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   gene            527969..529840
FT                   /gene="ybaU"
FT                   /locus_tag="Z0548"
FT   CDS_pept        527969..529840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaU"
FT                   /locus_tag="Z0548"
FT                   /product="putative protease maturation protein"
FT                   /function="putative factor; Not classified"
FT                   /note="Residues 1 to 623 of 623 are 99.51 pct identical to
FT                   residues 1 to 623 of 623 from Escherichia coli K-12 Strain
FT                   MG1655: B0441"
FT                   /db_xref="EnsemblGenomes-Gn:Z0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54791"
FT                   /db_xref="GOA:A0A4Q0C2X6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2X6"
FT                   /protein_id="AAG54791.1"
FT                   /translation="MMDSLRTAANSLVLKIIFGIIIVSFILTGVSGYLIGGGNNYAAKV
FT                   NDQEISRGQFENAFNSERNRMQQQLGDQYSELAANEGYMKTLRQQVLNRLIDEALLDQY
FT                   ARELKLGISDEQVKQAIFATPAFQVDGKFDNSRYNGILNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVAQQRVVREATIDVNALAAKQPVTEQEIASYYEQNK
FT                   NNFMTPEQFRVSYIKLDAATMQQPVSDADLQSYYDQHQDQFTQPQRTRYSIIQTKTEDE
FT                   AKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSG
FT                   VIKSSVGFLIVRLDDIQPAKVKSLDEVRDDVAAKVKHEKALDAYYALQQKVSDAASNDT
FT                   ESLAGAEQAAGVKATQTGWFSKENLPEELNFKPVADAIFNGGLVGENGAPGINSDIITV
FT                   DGDRAFVLRISEHKPEAVKPLADVQEQVKALVQHNKAEQQAKVDAEKLLVDLKAGKGAE
FT                   AMQAAGLKFGEPKTLSRSGRDPISQAAFALPLPAKDKPSYGMATDMQGNVVLLALDEVK
FT                   QGSMPEDQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   gene            529992..530363
FT                   /gene="ybaV"
FT                   /locus_tag="Z0549"
FT   CDS_pept        529992..530363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="Z0549"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 123 of 123 are 98.37 pct identical to
FT                   residues 1 to 123 of 123 from Escherichia coli K-12 Strain
FT                   MG1655: B0442"
FT                   /db_xref="EnsemblGenomes-Gn:Z0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54792"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDK1"
FT                   /protein_id="AAG54792.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   NKAAVPAKASDEEGSRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
FT   gene            530469..530867
FT                   /gene="ybaW"
FT                   /locus_tag="Z0550"
FT   CDS_pept        530469..530867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="Z0550"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 132 of 132 are 99.24 pct identical to
FT                   residues 1 to 132 of 132 from Escherichia coli K-12 Strain
FT                   MG1655: B0443"
FT                   /db_xref="EnsemblGenomes-Gn:Z0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54793"
FT                   /db_xref="GOA:A0A4Q0C470"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C470"
FT                   /protein_id="AAG54793.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFHWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
FT   gene            complement(530919..531614)
FT                   /gene="ybaX"
FT                   /locus_tag="Z0551"
FT   CDS_pept        complement(530919..531614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="Z0551"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 231 of 231 are 98.70 pct identical to
FT                   residues 1 to 231 of 231 from Escherichia coli K-12 Strain
FT                   MG1655: B0444"
FT                   /db_xref="EnsemblGenomes-Gn:Z0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54794"
FT                   /db_xref="GOA:Q8XE52"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE52"
FT                   /protein_id="AAG54794.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKVLNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLK"
FT   gene            complement(531679..533379)
FT                   /gene="ybaE"
FT                   /locus_tag="Z0552"
FT   CDS_pept        complement(531679..533379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="Z0552"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 566 of 566 are 99.29 pct identical to
FT                   residues 1 to 566 of 566 from Escherichia coli K-12 Strain
FT                   MG1655: B0445"
FT                   /db_xref="EnsemblGenomes-Gn:Z0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54795"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3L0"
FT                   /protein_id="AAG54795.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLR
FT                   QAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEKALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSADGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPHWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFNALKAV
FT                   FSQLMTDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
FT   gene            533467..534297
FT                   /gene="cof"
FT                   /locus_tag="Z0553"
FT   CDS_pept        533467..534297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="Z0553"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 276 of 276 are 98.91 pct identical to
FT                   residues 1 to 276 of 276 from Escherichia coli K-12 Strain
FT                   MG1655: B0446"
FT                   /db_xref="EnsemblGenomes-Gn:Z0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54796"
FT                   /db_xref="GOA:Q8XE50"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE50"
FT                   /protein_id="AAG54796.1"
FT                   /translation="MEKEMARLAAFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFA
FT                   TGRHALEMQHILGAISLDAYLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRA
FT                   SMHIFNDDGWFTGKEIPALLQAFVYSGFRYQIIDVKKMPLGSVTKICFCGDHDDLTRLQ
FT                   IQLHEALGERAHLCFSATDCLEVLPVGCNKGAALTVLTQHLGLSLRDCMAFGDAMNDRE
FT                   MLGSVGSGFIMGNAMPQLRAELPHLPVIGHCRNQAVSHYLTHWLDYPHLPYSPE"
FT   gene            534449..534907
FT                   /gene="ybaO"
FT                   /locus_tag="Z0555"
FT   CDS_pept        534449..534907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="Z0555"
FT                   /product="putative transcriptional regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 1 to 152 of 152 are 100.00 pct identical to
FT                   residues 30 to 181 of 181 from Escherichia coli K-12 Strain
FT                   MG1655: B0447"
FT                   /db_xref="EnsemblGenomes-Gn:Z0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54797"
FT                   /db_xref="GOA:P0ACJ7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACJ7"
FT                   /protein_id="AAG54797.1"
FT                   /translation="MLDKIDRKLLALLQQDCTLSLQALAEAVNLTTTPCWKRLKRLEDD
FT                   GILIGKVALLDPEKIGLGLTAFVLIKTQHHSSEWYCRFVTVVTEMPEVLGFWRMAGEYD
FT                   YLMRVQVADMKRYDEFYKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
FT   gene            534937..536709
FT                   /gene="mdlA"
FT                   /locus_tag="Z0557"
FT   CDS_pept        534937..536709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="Z0557"
FT                   /product="ATP-binding component of a transport system"
FT                   /function="transport; Not classified"
FT                   /note="Residues 1 to 590 of 590 are 99.83 pct identical to
FT                   residues 1 to 590 of 590 from Escherichia coli K-12 Strain
FT                   MG1655: B0448"
FT                   /db_xref="EnsemblGenomes-Gn:Z0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54798"
FT                   /db_xref="GOA:A0A4Q0C2D0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2D0"
FT                   /protein_id="AAG54798.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDG
FT                   VTEQHFTTGQILMWIATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYLRHRTGDLMARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLF
FT                   ALLPMPVMAIMIKRNGDALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSAL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIH
FT                   QFTYPQTDHPALENVNFALKPGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIP
FT                   LTKLQLDSWRSRLAVVSQTPFLFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRL
FT                   PQGYDTEVGERGVMLSGGQKQRISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQ
FT                   WGQGRTVIISAHRLSALTEASEIIVMQHGHIAQRGNHDVLAQQSGWYRDMYRYQQLEAA
FT                   LDDAPENREEAVDA"
FT   gene            536702..538483
FT                   /gene="mdlB"
FT                   /locus_tag="Z0559"
FT   CDS_pept        536702..538483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="Z0559"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 593 of 593 are 100.00 pct identical to
FT                   residues 1 to 593 of 593 from Escherichia coli K-12 Strain
FT                   MG1655: B0449"
FT                   /db_xref="EnsemblGenomes-Gn:Z0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54799"
FT                   /db_xref="GOA:P0AAG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAG7"
FT                   /protein_id="AAG54799.1"
FT                   /translation="MRSFSQLWPTLKRLLAYGSPWRKPLGIAVLMMWVAAAAEVSGPLL
FT                   ISYFIDNMVAKNNLPLKVVAGLAAAYVGLQLFAAGLHYAQSLLFNRAAVGVVQQLRTDV
FT                   MDAALRQPLSEFDTQPVGQVISRVTNDTEVIRDLYVTVVATVLRSAALVGAMLVAMFSL
FT                   DWRMALVAIMIFPVVLVVMVIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSSLILCGLLMLFGFSASGTIEV
FT                   GVLYAFISYLGRLNEPLIELTTQQAMLQQAVVAGERVFELMDGPRQQYGNDDRPLQSGT
FT                   IEVDNVSFAYRDDNLVLKNINLSVPSRNFVALVGHTGSGKSTLASLLMGYYPLTEGEIR
FT                   LDGRPLSSLSHSALRQGVAMVQQDPVVLADTFLANVTLGRDISEERVWQALETVQLAEL
FT                   ARSMSDGIYTPLGEQGNNLSVGQKQLLALARVLVETPQILILDEATASIDSGTEQAIQH
FT                   ALAAVREHTTLVVIAHRLSTIVDADTILVLHRGQAVEQGTHQQLLAAQGRYWQMYQLQL
FT                   AGEELAASVREEESLSA"
FT   gene            538664..539002
FT                   /gene="glnK"
FT                   /locus_tag="Z0562"
FT   CDS_pept        538664..539002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="Z0562"
FT                   /product="nitrogen regulatory protein P-II 2"
FT                   /function="regulator; Central intermediary metabolism:
FT                   Pool, multipurpose conversions of intermed. met'm"
FT                   /note="Residues 1 to 112 of 112 are 100.00 pct identical to
FT                   residues 1 to 112 of 112 from Escherichia coli K-12 Strain
FT                   MG1655: B0450"
FT                   /db_xref="EnsemblGenomes-Gn:Z0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54800"
FT                   /db_xref="GOA:P0AC57"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AC57"
FT                   /protein_id="AAG54800.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
FT   gene            539032..540318
FT                   /gene="amtB"
FT                   /locus_tag="Z0563"
FT   CDS_pept        539032..540318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="Z0563"
FT                   /product="probable ammonium transporter"
FT                   /function="putative transport; Central intermediary
FT                   metabolism: Pool, multipurpose conversions of intermed.
FT                   met'm"
FT                   /note="Residues 1 to 428 of 428 are 100.00 pct identical to
FT                   residues 1 to 428 of 428 from Escherichia coli K-12 Strain
FT                   MG1655: B0451"
FT                   /db_xref="EnsemblGenomes-Gn:Z0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54801"
FT                   /db_xref="GOA:P69680"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="PDB:4NH2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69680"
FT                   /protein_id="AAG54801.1"
FT                   /translation="MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFM
FT                   TIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLM
FT                   LKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYI
FT                   PIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLL
FT                   GACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLA
FT                   DLTVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(540367..541227)
FT                   /gene="tesB"
FT                   /locus_tag="Z0564"
FT   CDS_pept        complement(540367..541227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="Z0564"
FT                   /product="acyl-CoA thioesterase II"
FT                   /function="enzyme; Fatty acid biosynthesis: Fatty acid and
FT                   phosphatidic acid biosynth"
FT                   /note="Residues 1 to 286 of 286 are 100.00 pct identical to
FT                   residues 1 to 286 of 286 from Escherichia coli K-12 Strain
FT                   MG1655: B0452"
FT                   /db_xref="EnsemblGenomes-Gn:Z0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54802"
FT                   /db_xref="GOA:P0AGG3"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AGG3"
FT                   /protein_id="AAG54802.1"
FT                   /translation="MSQALKNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPV
FT                   EFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEP
FT                   GIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGV
FT                   MRNHN"
FT   gene            541445..542017
FT                   /gene="ybaY"
FT                   /locus_tag="Z0565"
FT   CDS_pept        541445..542017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="Z0565"
FT                   /product="glycoprotein/polysaccharide metabolism"
FT                   /function="phenotype; Not classified"
FT                   /note="Residues 1 to 190 of 190 are 99.47 pct identical to
FT                   residues 1 to 190 of 190 from Escherichia coli K-12 Strain
FT                   MG1655: B0453"
FT                   /db_xref="EnsemblGenomes-Gn:Z0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54803"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C480"
FT                   /protein_id="AAG54803.1"
FT                   /translation="MKLVHMASGLAVAIALAACADKSADIQTPAPAANTSISATQQPAI
FT                   QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLP
FT                   FNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQGGTKADLTLVPVQQTAVPVQAS
FT                   GGATTTVPSTSPTQVNPSSAVPAPTQY"
FT   gene            complement(542050..542421)
FT                   /gene="ybaZ"
FT                   /locus_tag="Z0566"
FT   CDS_pept        complement(542050..542421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="Z0566"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 123 of 123 are 99.18 pct identical to
FT                   residues 7 to 129 of 129 from Escherichia coli K-12 Strain
FT                   MG1655: B0454"
FT                   /db_xref="EnsemblGenomes-Gn:Z0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54804"
FT                   /db_xref="GOA:Q8XD72"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD72"
FT                   /protein_id="AAG54804.1"
FT                   /translation="MRLHSGVFPDYAEKLSQEEKMEKEDSFPQRVWQIVAAIPEGYVTT
FT                   YGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAE
FT                   GVMVSGSGQIDLQRYRWNY"
FT   gene            542492..542629
FT                   /gene="ffs"
FT                   /locus_tag="Z0567"
FT   misc_RNA        542492..542629
FT                   /gene="ffs"
FT                   /locus_tag="Z0567"
FT                   /product="4.5S RNA; component of ribonucleoprotein"
FT                   /function="RNA; Macromolecule synthesis, modification:
FT                   Ribosomal and stable RNAs"
FT   gene            542740..543093
FT                   /gene="ybaA"
FT                   /locus_tag="Z0568"
FT   CDS_pept        542740..543093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="Z0568"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 117 of 117 are 100.00 pct identical to
FT                   residues 1 to 117 of 117 from Escherichia coli K-12 Strain
FT                   MG1655: B0456"
FT                   /db_xref="EnsemblGenomes-Gn:Z0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54805"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAQ8"
FT                   /protein_id="AAG54805.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
FT   gene            complement(543135..544691)
FT                   /gene="ylaB"
FT                   /locus_tag="Z0569"
FT   CDS_pept        complement(543135..544691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="Z0569"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 518 of 518 are 98.84 pct identical to
FT                   residues 1 to 518 of 518 from Escherichia coli K-12 Strain
FT                   MG1655: B0457"
FT                   /db_xref="EnsemblGenomes-Gn:Z0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54806"
FT                   /db_xref="GOA:A0A0H3JDT3"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDT3"
FT                   /protein_id="AAG54806.1"
FT                   /translation="MLVRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDT
FT                   YSSRVAIRANKVATQGKDALQELERWQGADCSEAHLMEMRRVSYSYRYIQEVVYIDNNV
FT                   PQCSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASF
FT                   IDVIPYSSWQIDAAIIGNAHNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPFP
FT                   EMNISIITWASSKMLQKGWHRQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAI
FT                   ENRDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLI
FT                   IRSVFEDMGDWLRQHPQQHISINLESTVLTSEKIPQLLREMINHYQVNPRQIALELTER
FT                   EFADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKN
FT                   VTPHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQH
FT                   L"
FT   gene            complement(544849..545358)
FT                   /gene="ylaC"
FT                   /locus_tag="Z0570"
FT   CDS_pept        complement(544849..545358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="Z0570"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 169 of 169 are 100.00 pct identical to
FT                   residues 1 to 169 of 169 from Escherichia coli K-12 Strain
FT                   MG1655: B0458"
FT                   /db_xref="EnsemblGenomes-Gn:Z0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54807"
FT                   /db_xref="GOA:P0AAS1"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAS1"
FT                   /protein_id="AAG54807.1"
FT                   /translation="MFPGKLQIPRRQTMTEIQRLLTETIESLNTREKRDNKPRFSISFI
FT                   RKHPGLFIGMYVAFFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDID
FT                   VLDFRVCYNGEWYNTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLA
FT                   RAESTS"
FT   gene            complement(545435..545986)
FT                   /gene="ylaD"
FT                   /locus_tag="Z0571"
FT   CDS_pept        complement(545435..545986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaD"
FT                   /locus_tag="Z0571"
FT                   /product="putative transferase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 183 of 183 are 99.45 pct identical to
FT                   residues 1 to 183 of 183 from Escherichia coli K-12 Strain
FT                   MG1655: B0459"
FT                   /db_xref="EnsemblGenomes-Gn:Z0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54808"
FT                   /db_xref="GOA:A0A4Q0C2E1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2E1"
FT                   /protein_id="AAG54808.1"
FT                   /translation="MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTL
FT                   RQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAL
FT                   GVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVT
FT                   KDVPDNVVVGGNPARIIKKL"
FT   gene            complement(546158..546376)
FT                   /gene="hha"
FT                   /locus_tag="Z0573"
FT   CDS_pept        complement(546158..546376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="Z0573"
FT                   /product="haemolysin expression modulating protein"
FT                   /function="regulator; Macromolecule synthesis,
FT                   modification: Proteins - translation and modification"
FT                   /note="Residues 1 to 72 of 72 are 100.00 pct identical to
FT                   residues 1 to 72 of 72 from Escherichia coli K-12 Strain
FT                   MG1655: B0460"
FT                   /db_xref="EnsemblGenomes-Gn:Z0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54809"
FT                   /db_xref="GOA:P0ACE5"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACE5"
FT                   /protein_id="AAG54809.1"
FT                   /translation="MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   gene            complement(546402..546776)
FT                   /gene="ybaJ"
FT                   /locus_tag="Z0574"
FT   CDS_pept        complement(546402..546776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="Z0574"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 124 of 124 are 100.00 pct identical to
FT                   residues 1 to 124 of 124 from Escherichia coli K-12 Strain
FT                   MG1655: B0461"
FT                   /db_xref="EnsemblGenomes-Gn:Z0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54810"
FT                   /db_xref="GOA:P0AAR2"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAR2"
FT                   /protein_id="AAG54810.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
FT   gene            complement(547322..550471)
FT                   /gene="acrB"
FT                   /locus_tag="Z0576"
FT   CDS_pept        complement(547322..550471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="Z0576"
FT                   /product="acridine efflux pump"
FT                   /function="transport; Protection responses: Drug/analog
FT                   sensitivity"
FT                   /note="Residues 1 to 1049 of 1049 are 99.80 pct identical
FT                   to residues 1 to 1049 of 1049 from Escherichia coli K-12
FT                   Strain MG1655: B0462"
FT                   /db_xref="EnsemblGenomes-Gn:Z0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54811"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C302"
FT                   /protein_id="AAG54811.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSIEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
FT                   NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIAKGDHGEGKKGFFGWFN
FT                   RMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMV
FT                   QLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTGVGYDWTGMSYQERLSGN
FT                   QAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPL
FT                   VISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEHNHTVDH
FT                   H"
FT   gene            complement(550494..551687)
FT                   /gene="acrA"
FT                   /locus_tag="Z0578"
FT   CDS_pept        complement(550494..551687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="Z0578"
FT                   /product="acridine efflux pump"
FT                   /function="transport; Protection responses: Drug/analog
FT                   sensitivity"
FT                   /note="Residues 1 to 397 of 397 are 100.00 pct identical to
FT                   residues 1 to 397 of 397 from Escherichia coli K-12 Strain
FT                   MG1655: B0463"
FT                   /db_xref="EnsemblGenomes-Gn:Z0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54812"
FT                   /db_xref="GOA:P0AE07"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE07"
FT                   /protein_id="AAG54812.1"
FT                   /translation="MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTV
FT                   KTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVAS
FT                   QAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS"
FT   gene            551829..552476
FT                   /gene="acrR"
FT                   /locus_tag="Z0579"
FT   CDS_pept        551829..552476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="Z0579"
FT                   /product="acrAB operon repressor"
FT                   /function="regulator; Protection responses: Drug/analog
FT                   sensitivity"
FT                   /note="Residues 1 to 215 of 215 are 99.53 pct identical to
FT                   residues 1 to 215 of 215 from Escherichia coli K-12 Strain
FT                   MG1655: B0464"
FT                   /db_xref="EnsemblGenomes-Gn:Z0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54813"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TUP1"
FT                   /protein_id="AAG54813.1"
FT                   /translation="MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTR
FT                   GAIYWHFKDKSDLFSEIWELSESNIGELELEYQAKFPSDPLSVLREILIHVLESTVTEE
FT                   RRRLLMEIIFHKCEFVGEMAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRA
FT                   AIIMRGYISGLMENWLFAPQSFDLKKEARDYVAILLEMYLLCPTLRNPATNE"
FT   gene            552604..555966
FT                   /gene="aefA"
FT                   /locus_tag="Z0581"
FT   CDS_pept        552604..555966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aefA"
FT                   /locus_tag="Z0581"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 1120 of 1120 are 99.73 pct identical
FT                   to residues 1 to 1120 of 1120 from Escherichia coli K-12
FT                   Strain MG1655: B0465"
FT                   /db_xref="EnsemblGenomes-Gn:Z0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54814"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2A9"
FT                   /protein_id="AAG54814.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRVKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQAQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATENGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVNKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQSLKDEFKSMKITVNWEKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLSGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGTEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
FT   gene            complement(556005..556169)
FT                   /locus_tag="Z0583"
FT   CDS_pept        complement(556005..556169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0583"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 52 of 54 are 86.53 pct identical to
FT                   residues 1 to 52 of 53 from Escherichia coli K-12 Strain
FT                   MG1655: B0466"
FT                   /db_xref="EnsemblGenomes-Gn:Z0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54815"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C3N2"
FT                   /protein_id="AAG54815.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPARTVLRALDIVKRDYEKKL
FT                   QSDEASQSE"
FT   gene            complement(556183..556710)
FT                   /gene="priC"
FT                   /locus_tag="Z0584"
FT   CDS_pept        complement(556183..556710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="Z0584"
FT                   /product="primosomal replication protein N''"
FT                   /function="factor; Macromolecule synthesis, modification:
FT                   DNA - replication, repair, restr./modific'n"
FT                   /note="Residues 1 to 175 of 175 are 97.71 pct identical to
FT                   residues 1 to 175 of 175 from Escherichia coli K-12 Strain
FT                   MG1655: B0467"
FT                   /db_xref="EnsemblGenomes-Gn:Z0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54816"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD51"
FT                   /protein_id="AAG54816.1"
FT                   /translation="MKTALLLEKLEXQLATLRQRCAPVSQFATLSARFNRHLFQTRATT
FT                   LQACLDKAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREATAWSLREWDSAPPQ
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
FT   gene            556780..557157
FT                   /gene="ybaN"
FT                   /locus_tag="Z0585"
FT   CDS_pept        556780..557157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="Z0585"
FT                   /product="putative gene 58"
FT                   /function="orf; Not classified"
FT                   /note="Residues 1 to 125 of 125 are 100.00 pct identical to
FT                   residues 1 to 125 of 125 from Escherichia coli K-12 Strain
FT                   MG1655: B0468"
FT                   /db_xref="EnsemblGenomes-Gn:Z0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54817"
FT                   /db_xref="GOA:P0AAR6"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAR6"
FT                   /protein_id="AAG54817.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
FT   gene            557310..557861
FT                   /gene="apt"
FT                   /locus_tag="Z0586"
FT   CDS_pept        557310..557861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="Z0586"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /function="enzyme; Central intermediary metabolism: Salvage
FT                   of nucleosides and nucleotides"
FT                   /note="Residues 1 to 183 of 183 are 99.45 pct identical to
FT                   residues 1 to 183 of 183 from Escherichia coli K-12 Strain
FT                   MG1655: B0469"
FT                   /db_xref="EnsemblGenomes-Gn:Z0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54818"
FT                   /db_xref="GOA:Q8XD48"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD48"
FT                   /protein_id="AAG54818.1"
FT                   /translation="MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   DLLVERYKNAGINKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
FT                   GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGG
FT                   EQRLEKQGITSYSLVPFPGH"
FT   gene            557990..559921
FT                   /gene="dnaX"
FT                   /locus_tag="Z0587"
FT   CDS_pept        557990..559921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="Z0587"
FT                   /product="DNA polymerase III, tau and gamma subunits; DNA
FT                   elongation factor III"
FT                   /function="enzyme; Macromolecule synthesis, modification:
FT                   DNA - replication, repair, restr./modific'n"
FT                   /note="Residues 1 to 643 of 643 are 99.68 pct identical to
FT                   residues 1 to 643 of 643 from Escherichia coli K-12 Strain
FT                   MG1655: B0470"
FT                   /db_xref="EnsemblGenomes-Gn:Z0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54819"
FT                   /db_xref="GOA:A0A4Q0C2E8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2E8"
FT                   /protein_id="AAG54819.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEAL
FT                   LVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELP
FT                   YAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQ
FT                   APTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQ
FT                   ARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKALEHEKTPELAAKLAAEA
FT                   IERDAWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEAL
FT                   SMLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAEL
FT                   DEDSIRPI"
FT   gene            559974..560303
FT                   /gene="ybaB"
FT                   /locus_tag="Z0588"
FT   CDS_pept        559974..560303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="Z0588"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 109 of 109 are 100.00 pct identical to
FT                   residues 1 to 109 of 109 from Escherichia coli K-12 Strain
FT                   MG1655: B0471"
FT                   /db_xref="EnsemblGenomes-Gn:Z0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54820"
FT                   /db_xref="GOA:P0A8B7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8B7"
FT                   /protein_id="AAG54820.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   gene            560303..560908
FT                   /gene="recR"
FT                   /locus_tag="Z0589"
FT   CDS_pept        560303..560908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="Z0589"
FT                   /product="recombination and repair"
FT                   /function="putative enzyme; Macromolecule synthesis,
FT                   modification: DNA - replication, repair, restr./modific'n"
FT                   /note="Residues 1 to 201 of 201 are 100.00 pct identical to
FT                   residues 1 to 201 of 201 from Escherichia coli K-12 Strain
FT                   MG1655: B0472"
FT                   /db_xref="EnsemblGenomes-Gn:Z0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54821"
FT                   /db_xref="GOA:P0A7H8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7H8"
FT                   /protein_id="AAG54821.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
FT   gene            561018..562892
FT                   /gene="htpG"
FT                   /locus_tag="Z0590"
FT   CDS_pept        561018..562892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="Z0590"
FT                   /product="chaperone Hsp90, heat shock protein C 62.5"
FT                   /function="factor; Folding and ushering proteins:
FT                   Chaperones"
FT                   /note="Residues 1 to 624 of 624 are 100.00 pct identical to
FT                   residues 1 to 624 of 624 from Escherichia coli K-12 Strain
FT                   MG1655: B0473"
FT                   /db_xref="EnsemblGenomes-Gn:Z0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54822"
FT                   /db_xref="GOA:P0A6Z5"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Z5"
FT                   /protein_id="AAG54822.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKS
FT                   FLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYT
FT                   VADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRNKSEITDEEYKEFYKHIAHXFNDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQ
FT                   DSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKL
FT                   LRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADEVDESAKEAEKALTPFIDRVKA
FT                   LLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVL
FT                   VKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS"
FT   gene            563073..563717
FT                   /gene="adk"
FT                   /locus_tag="Z0591"
FT   CDS_pept        563073..563717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="Z0591"
FT                   /product="adenylate kinase activity; pleiotropic effects on
FT                   glycerol-3-phosphate acyltransferase activity"
FT                   /function="enzyme; Nucleotide biosynthesis: Purine
FT                   ribonucleotide biosynthesis"
FT                   /note="Residues 1 to 214 of 214 are 100.00 pct identical to
FT                   residues 1 to 214 of 214 from Escherichia coli K-12 Strain
FT                   MG1655: B0474"
FT                   /db_xref="EnsemblGenomes-Gn:Z0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54823"
FT                   /db_xref="GOA:P69442"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69442"
FT                   /protein_id="AAG54823.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG"
FT   misc_feature    563719..563771
FT                   /note="O-island #27; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            563849..564811
FT                   /gene="hemH"
FT                   /locus_tag="Z0592"
FT   CDS_pept        563849..564811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="Z0592"
FT                   /product="ferrochelatase: final enzyme of heme
FT                   biosynthesis"
FT                   /function="enzyme; Biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="Residues 1 to 320 of 320 are 99.68 pct identical to
FT                   residues 1 to 320 of 320 from Escherichia coli K-12 Strain
FT                   MG1655: B0475"
FT                   /db_xref="EnsemblGenomes-Gn:Z0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54824"
FT                   /db_xref="GOA:Q8XD39"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD39"
FT                   /protein_id="AAG54824.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTSRLLW
FT                   WPLLRGVILPLRSPRVAKLYASVWMEGGSPLMVYSRQQQQALAQRLPETPVALGMSYGS
FT                   PSLESAVDELLAEHVDHIVVLPLYPQFSCSTVGAVWDELARILARKRSIPGISFIRDYA
FT                   DNHDYINALANSVRASFAKHGEPDLLLLSYHGIPQRYADEGDDYPQRCRTTTRELASAL
FT                   GMAPEKVMMTFQSRFGREPWLMPYTDETLKMLGEKGVGHIQVMCPGFAADCLETLEEIA
FT                   EQNREVFLGAGGKKYEYIPALNATPEHIEMMANLVAAYR"
FT   gene            complement(564808..565767)
FT                   /gene="ybaC"
FT                   /locus_tag="Z0593"
FT   CDS_pept        complement(564808..565767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaC"
FT                   /locus_tag="Z0593"
FT                   /product="putative lipase"
FT                   /function="orf; Not classified"
FT                   /EC_number="3.1.1.-"
FT                   /note="Residues 1 to 319 of 319 are 99.37 pct identical to
FT                   residues 1 to 319 of 319 from Escherichia coli K-12 Strain
FT                   MG1655: B0476"
FT                   /db_xref="EnsemblGenomes-Gn:Z0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54825"
FT                   /db_xref="GOA:Q8XD38"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD38"
FT                   /protein_id="AAG54825.1"
FT                   /translation="MKPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYT
FT                   LERRFWNAGAPEMATKAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHD
FT                   RIMRLLASYSQCTVIGIDYTLSPEARFPQVIEEIVAACCYFHQQAEDYQINMSRIGFAG
FT                   DSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQ
FT                   MYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQP
FT                   CEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL"
FT   gene            565919..567223
FT                   /gene="gsk"
FT                   /locus_tag="Z0596"
FT   CDS_pept        565919..567223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="Z0596"
FT                   /product="inosine-guanosine kinase"
FT                   /function="enzyme; Central intermediary metabolism: Salvage
FT                   of nucleosides and nucleotides"
FT                   /note="Residues 1 to 434 of 434 are 100.00 pct identical to
FT                   residues 1 to 434 of 434 from Escherichia coli K-12 Strain
FT                   MG1655: B0477"
FT                   /db_xref="EnsemblGenomes-Gn:Z0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54826"
FT                   /db_xref="GOA:P0AEW8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEW8"
FT                   /protein_id="AAG54826.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEALYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   gene            complement(567356..569032)
FT                   /gene="ybaL"
FT                   /locus_tag="Z0597"
FT   CDS_pept        complement(567356..569032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="Z0597"
FT                   /product="putative transport protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 558 of 558 are 99.82 pct identical to
FT                   residues 1 to 558 of 558 from Escherichia coli K-12 Strain
FT                   MG1655: B0478"
FT                   /db_xref="EnsemblGenomes-Gn:Z0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54827"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TUI2"
FT                   /protein_id="AAG54827.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKAIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSLAAFFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVAYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
FT   gene            complement(569269..570489)
FT                   /gene="fsr"
FT                   /locus_tag="Z0598"
FT   CDS_pept        complement(569269..570489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="Z0598"
FT                   /product="fosmidomycin resistance protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 406 of 406 are 99.75 pct identical to
FT                   residues 1 to 406 of 406 from Escherichia coli K-12 Strain
FT                   MG1655: B0479"
FT                   /db_xref="EnsemblGenomes-Gn:Z0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2G0"
FT                   /protein_id="AAG54828.1"
FT                   /translation="MAMSEQTQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFL
FT                   PDNRHKD"
FT   gene            570707..572359
FT                   /gene="ushA"
FT                   /locus_tag="Z0599"
FT   CDS_pept        570707..572359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="Z0599"
FT                   /product="UDP-sugar hydrolase (5'-nucleotidase)"
FT                   /function="enzyme; Central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="Residues 1 to 550 of 550 are 99.27 pct identical to
FT                   residues 1 to 550 of 550 from Escherichia coli K-12 Strain
FT                   MG1655: B0480"
FT                   /db_xref="EnsemblGenomes-Gn:Z0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54829"
FT                   /db_xref="GOA:A0A4Q0C2F5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2F5"
FT                   /protein_id="AAG54829.1"
FT                   /translation="MKLLQRGVALALLTTFTLASEAALAYEQDKTYKITVLHTNDHHGH
FT                   FWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDL
FT                   KIAVIGLTTDDTAKLGNPENFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYD
FT                   NGDHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIA
FT                   ENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGA
FT                   DFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVN
FT                   TGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ"
FT   gene            complement(572396..572875)
FT                   /gene="ybaK"
FT                   /locus_tag="Z0600"
FT   CDS_pept        complement(572396..572875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="Z0600"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 159 of 159 are 99.37 pct identical to
FT                   residues 1 to 159 of 159 from Escherichia coli K-12 Strain
FT                   MG1655: B0481"
FT                   /db_xref="EnsemblGenomes-Gn:Z0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54830"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2V0"
FT                   /protein_id="AAG54830.1"
FT                   /translation="MTPAVKSLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGIS
FT                   PLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD"
FT   gene            complement(573079..573873)
FT                   /gene="ybaP"
FT                   /locus_tag="Z0601"
FT   CDS_pept        complement(573079..573873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="Z0601"
FT                   /product="putative ligase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 264 of 264 are 98.86 pct identical to
FT                   residues 1 to 264 of 264 from Escherichia coli K-12 Strain
FT                   MG1655: B0482"
FT                   /db_xref="EnsemblGenomes-Gn:Z0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54831"
FT                   /db_xref="GOA:A0A4Q0C323"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C323"
FT                   /protein_id="AAG54831.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDISLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQKLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
FT   gene            573957..574352
FT                   /gene="ybaQ"
FT                   /locus_tag="Z0602"
FT   CDS_pept        573957..574352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaQ"
FT                   /locus_tag="Z0602"
FT                   /product="orf, hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1 to 131 of 131 are 98.47 pct identical to
FT                   residues 1 to 131 of 131 from Escherichia coli K-12 Strain
FT                   MG1655: B0483"
FT                   /db_xref="EnsemblGenomes-Gn:Z0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54832"
FT                   /db_xref="GOA:A0A384KY27"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KY27"
FT                   /protein_id="AAG54832.1"
FT                   /translation="MIQYVLVSLFTGKQQLKTMKQATRKPTTPGDILLYEYLEPLDLKI
FT                   NELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLWEVENNM
FT                   RTQEELGRIETVAEYLARREERAKKVA"
FT   gene            complement(574567..577071)
FT                   /gene="ybaR"
FT                   /locus_tag="Z0604"
FT   CDS_pept        complement(574567..577071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaR"
FT                   /locus_tag="Z0604"
FT                   /product="putative ATPase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 834 of 834 are 99.04 pct identical to
FT                   residues 1 to 834 of 834 from Escherichia coli K-12 Strain
FT                   MG1655: B0484"
FT                   /db_xref="EnsemblGenomes-Gn:Z0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54833"
FT                   /db_xref="GOA:Q8XD24"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD24"
FT                   /protein_id="AAG54833.1"
FT                   /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTG
FT                   TASAEQLIETIKQAGYDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLL
FT                   LSGMSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYGAEA
FT                   IEDDAKRRERQQETAVATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVI
FT                   GLITLAVMVFAGGHFYRSAWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEA
FT                   RHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAE
FT                   VQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSV
FT                   LFRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVVIALVSAAIWYFF
FT                   GPAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTL
FT                   DTVVFDKTGTLTEGKPQVVAVKTFADFDEAQALRLAAALEQGSSHPLARAILDKASDMQ
FT                   LPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNDQQVDTKAIEADISAQASQGATPVLL
FT                   AVDGKAVALLAVRDPLRSDSVAALQRLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIA
FT                   GVLPDGKAEAIKRLQSEGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLM
FT                   RHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAA
FT                   MALSSITVVSNANRLLRFKPKE"
FT   gene            577333..578265
FT                   /gene="ybaS"
FT                   /locus_tag="Z0606"
FT   CDS_pept        577333..578265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="Z0606"
FT                   /product="putative glutaminase"
FT                   /function="putative enzyme; Not classified"
FT                   /note="Residues 1 to 310 of 310 are 98.06 pct identical to
FT                   residues 1 to 310 of 310 from Escherichia coli K-12 Strain
FT                   MG1655: B0485"
FT                   /db_xref="EnsemblGenomes-Gn:Z0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54834"
FT                   /db_xref="GOA:Q8XD23"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD23"
FT                   /protein_id="AAG54834.1"
FT                   /translation="MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAI
FT                   VTSDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIAL
FT                   ELHGGKPLSPLVNAGAIATTSLINAENAEQRWQRILHIQQQLAGELVALSDEVNQSEQT
FT                   TNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTH
FT                   KRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSP
FT                   PLDEEGNSVRGQKMVASVAKQLGYNVFKG"
FT   gene            578268..579560
FT                   /gene="ybaT"
FT                   /locus_tag="Z0607"
FT   CDS_pept        578268..579560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="Z0607"
FT                   /product="putative amino acid/amine transport protein"
FT                   /function="putative transport; Not classified"
FT                   /note="Residues 1 to 430 of 430 are 99.30 pct identical to
FT                   residues 1 to 430 of 430 from Escherichia coli K-12 Strain
FT                   MG1655: B0486"
FT                   /db_xref="EnsemblGenomes-Gn:Z0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54835"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q2TZ27"
FT                   /protein_id="AAG54835.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKRMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGAILLSLIVAMVMKRNKTV"
FT   misc_feature    579589..604753
FT                   /note="O-island #28; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            579898..581253
FT                   /locus_tag="Z0608"
FT   CDS_pept        579898..581253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0608"
FT                   /product="putative outer membrane export protein"
FT                   /function="putative membrane; Transport of large molecules:
FT                   Protein, peptide secretion"
FT                   /note="Residues 29 to 413 of 451 are 25.81 pct identical to
FT                   residues 45 to 442 of 474 from GenPept 118 :
FT                   gi|39735|emb|CAA32414.1| (X14199) cyaE [Bordetella
FT                   pertussis]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54836"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2C8"
FT                   /protein_id="AAG54836.1"
FT                   /translation="MARFQFKNRKNNGLIFFISFMVMGEAAIAAPLPQWANAPAVTPVA
FT                   QLSLQESILRAFARNPGVTQQAAQIGIGEAQIDEAKSAWYPHVGLTGNAGPSRQTDSSG
FT                   RLDNNVSYGITLTQLVYDFGKTNNDINLQTAARDSYRFKLMATLTDVAEKTATAYMEVS
FT                   RYQALCDAAQRNIHSLENVYNMAALRANAGLNSSSDELQAQTRIAGMRSTLEQYQAQMA
FT                   SAKAQLAVLTGVQPEAIAAPPAELAEQPVSLKNIDYQSIPLVLAAENLRQSAQYGVEKT
FT                   KAQYWPTLSIQGGKTRYQTSDRSYWDDQLQLNVNAPLYQGGAVSAQVQQAEGQQKISAS
FT                   QVEQAKLDVLQRASVAYANWTGARGREEAGLAQSESAHKTRDVYQNEYKLGKRSLNDLL
FT                   TVEQDVFQAQSAEINANYDGWVAAVNYAAAVNNLIPLAGIKQGLYNDLPDLK"
FT   gene            581356..585741
FT                   /locus_tag="Z0609"
FT   CDS_pept        581356..585741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0609"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 159 to 1459 of 1461 are 35.47 pct identical
FT                   to residues 1573 to 2890 of 3029 from GenPept 118 :
FT                   gi|1001461|dbj|BAA10087.1| (D63999) hypothetical protein
FT                   [Synechocystis sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54837"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD19"
FT                   /protein_id="AAG54837.1"
FT                   /translation="MSLIIDVISRKTSVKQTLINPGDVTVVIYEPSVVQVHAQASAVAR
FT                   YVREGNDLLIYMQDGTVIRCNGYFLQAANTAEQSELVFADGQQLTHITFADTAAGGLAP
FT                   VELTAQTTAIESIAPFLDTVAQTSAFPWGWLAGAAVGGGALGALLASGGDGDSKTEVIN
FT                   NPTPPAEPGNATPSFLVTDNQGDQRGILATNDITDDTTPTFSGSGQAGATIQIKDSNGN
FT                   TIASTQVDNNGHWSVSLPTQSAGEHTWSVVQIVGSTITDAGSITLTIDNSQASVQVATT
FT                   AGDNIINASEQAAGFTLSGTSSHLAQGTELTVTLNGKTYTTSVGANGAWSVQVPTADAQ
FT                   ALGEGNQAVLVSGKDATGNTVTGAQLLTVDTQPPTLAINTIAQDNIISAAEHNVALVLS
FT                   GTSNAEAGQTVTLTVNGKSHTATVGSDGTWQVTLPATEVQALAEGNYAVNASVSDRAGN
FT                   TTSHSANFTVDTSAPVVSVNTVAGDDILNNAEQAVAQIISGQVSGASPGDTVTVKLGTH
FT                   VLTGIVLADGSWNVALDPAVTRTLDRGANTIFVTVTDAAGNTGAASRAITLVGVSPLIT
FT                   INTVSGDDIISGAEKGAPLTLTGSTQQXETGQTVTVTLAGQSFTTTVQADGSWSLTVPA
FT                   AAMGNLPDGAVAITASVTDLSGNTGNTSRTITVDSQAPALSIDPLTADNIINAAESGQD
FT                   LPITGTTDAQPGQTVTVTLNGQTYQGVVQPDGTWSVTVPAANVGALADGNATVTASVND
FT                   VAGNPSSVSRVALVDATPPVVTINPVATDNVINTPEHAQAQIISGTVTGAQAGDIVTVT
FT                   LNNVDYTTVVDGSGNWSLGVPASVVSGLADGSYPVSVSVTDKAGNTGSQSLTVTVNTAA
FT                   PLIGINSIAGDDVINASEKGADLQITGTSDQPVNTAITVTLNGQNYTTTTDASGNWSVT
FT                   VPASAVTALGQANYTVTAAVTSDIGNSATASHNVLVDSALPGVTINPVATDDIINAAEA
FT                   GVAQTISGQVTGAEDGDTVTITLGGNTYTATVGSNLTWSVDVPAADIQALGNGDLTVNA
FT                   SVTNQNGNTGSGTRDITIDANLPGLRVDTVAGDDVVNIIEHGQALVVTGSSSGLAESTP
FT                   LTVTINNVEYTTAVQADGSWSVGVTAAQVSAWPAGTVNIAVSGESSAGNSVSITHPVTV
FT                   DLTPAAITINTIATDDVINAAEKGADLTLSGTTTNVEPGQTVTVTFGGKNYTASVASDG
FT                   SWTATVPAADLASLPEGSASALASVSNINGNSASAVHNYSVDSSAPTIIINTVASDNIV
FT                   NASEADAGVTVSGSTTAEAGQIVTITLNSPTVQTYQATVQADGSWSINIPAADLEALTD
FT                   GSHTLTATVNDKAGNPASTTHNLAVDLTVPVLTINTIAGDDIINATEHGQALVISGSST
FT                   GGEAGDVVTVTLNSKTYTTTLDASGNWSVGVPAADVTALGSGPQTVTATVTDAAGNSDN
FT                   "
FT   gene            585949..601515
FT                   /locus_tag="Z0615"
FT   CDS_pept        585949..601515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0615"
FT                   /product="putative RTX family exoprotein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 1483 to 4111 of 5188 are 35.24 pct
FT                   identical to residues 373 to 2965 of 3029 from GenPept 118
FT                   : gi|1001461|dbj|BAA10087.1| (D63999) hypothetical protein
FT                   [Synechocystis sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54838"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4H5"
FT                   /protein_id="AAG54838.1"
FT                   /translation="MPASAVGALGEASYTVTANVTDSAGNSNSASHNVQVNTALPGVTI
FT                   NPVATDDIINAAESGNAQTIXGQVTGAAAGDTVTVTLGGKTYTATVQGNLSWSVDVPAA
FT                   DIQAIGNGNLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVVNSIEHAQAL
FT                   VITGSSSGLAAGAALTVVINTVTYAATVLADGTWSVGVPAADVSNWPAGTVNITVSGTN
FT                   TAGTTSTITHPVTVDLAAVAISINTVSGDDVINAAEKGADLTLSGSTSGVEVGQTVTVT
FT                   FGGKTYTATVAGDGSWTTTVPAADLSVLRDGDATVQASVSTINGNTASATHAYSVDATA
FT                   PTLAINTIATDDILNAAEAGNPLTISGSSTAEAGQTVTVTLNGVTYSGSVQADGSWSVS
FT                   LPTADLSNLTASQYTVSASVSDKAGNPASANHGLAVDLTVPVLTINTVSGDDIINAAEH
FT                   GQALVISGSSTGGEAGDVITVTLNSKTYTTMLDASGNWSVGVPAADVTALGSGPQTITA
FT                   AITDAAGNSDDASRTVTVNLAAPTIGINTIATDDVIKATEKGADLQITGTSNQPAGTTI
FT                   TVTLNGQNYTATTDSNGXWSATVPASAVSALGEANYTVTANVTDTAGNSNSASHNVLVN
FT                   SALPAVTINAVATDDIINAAESGNAQTISGQVTGAAQGDTVTVTLGGNTYTATVQSNLS
FT                   WSVDVPAADIQALGNGDLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVIN
FT                   SIEHNQALVITGSSSGLTAGTALTVEINNVTYGATVLADGTWSLGVPAVDVSNWPAGTV
FT                   NITVSGTNSAGTTSTITHPVTVDLAGVAITINTLSGDDVINAVEKGETLVVSGSTSGVE
FT                   AGQTVTVTFGGKNYTTTVEANGSWTVNVPPADLAALPDGAGNVQASVSNINGNSAQADR
FT                   AYSVDATAPLVTINTIASDDILNVSEAGAGITISGTTTAQAGQTLTVTLNNNTYQTTVL
FT                   ADGTWSVNVPAADLSGLTASSYTVTATVSDKAGNPASADHALVVDITAPDLTINTVAGD
FT                   DIINAIEHGQALVVSGTSTGAAAGDVVTVTLNGKNYTTTLDASGNWSVGIPAADVTALA
FT                   TGSQTITASLSDRAGNSDSTTHDVTVDLSGPTLTINTVSGDDIINAAEIVVAQTISGQV
FT                   TGTAVAGNTVIVTIGGNQYNATVQSDLSWSVSVPANVLQALGNGELTISASLTNSANNT
FT                   GTATHDIVIDANLPGLRVDTVAGDDVINSIEHTQALVITGSSSGLAAGAALTVVINSVT
FT                   YGATVLADGSWSVGVPVADVTNWPAGTVNIAVSGTNTAGTTTSISHPVTVDLAAVAITI
FT                   NTLSTDDVINAAEKGSDLQLSGTTSGVEAGQTITVIFGGKSYTTTVAADNTWGLTIPAV
FT                   DVATLPDGAANVQASVSNVAGNSTQATHAYSVDATAPSVTINTIATDDILNAAEAGSAL
FT                   TISGTSTAEAGQTVTVTLNGVNYSGNVQADGSWSVSVPTGDLASLTASSYTVNASVSDK
FT                   ARNSASATHNLTVDLAAPVVTINTVAGDDIINATEHGQAQIISGSATGATTGNTVSVTI
FT                   GTTTYTTVLDANGNWSIGVPASVISALAQGDVTITATVTDSAGNSGTASHTVTVALGAP
FT                   VLAINTIAVDDIINAAEKGADLAITGTSNQPAGTQITVTLNGQNYTTTADASGNWSVTV
FT                   PASRVSALGEATYTVTAAATDADGNSGSASHNVQVNTALPGVTINVVATDDIINAAEAG
FT                   VEQTISGQVTGAAAGDTVTVTLGGATYTATVQANLSWSVDVPASALQELGNGELTISAS
FT                   VTNSVGNTGNGTREITIDANLPGLRVDTVAGDDVVNIIEHGQALVITGSSSGLAAGSNV
FT                   TLTINGQTYVAAVLADGTWSVGVPAVDVSAWPAGSVTIAASGSTSAGNPVSVTHPVTVD
FT                   LSAVAVSINAITADDVINAAEKGAALTLSGSTSGVEAGQTVTVTFGGKTYSATVAANGS
FT                   WSTSVPAADMAALRDGDASAQASVSNVNGNSATTTHAYSVDASAPTVTINTIAGDDILN
FT                   AAEAGAALTITGSSTAEAGQTVTVTLNGTNYTGTVQTDGSWSVSVPSADLSTLTASXYT
FT                   VNAAVSDKAGNPASVNHNLTVDTSVPVVTINTVAGDDVINATEHAQAQIISGSATGAAT
FT                   GSTVTVTIGTNTFTTVLDASGNWSVGVPASVVSALANGTVTINASVTDAGGNSGSATHQ
FT                   VTVNTGLPTITFNAISGDNILNADEKGQPLTISGGSTGLATGAQVTVTLNGHNYSATTD
FT                   ASGNWTLTVPVSDLAALGQANYTVSASATSAAGNTASSQANLLVDSGLPDVTINTVAGD
FT                   DIINAAEAGADQTISGVVTRAAAGDTVTVTLGGNTYTATVQSNLSWSVSVPTADLQALG
FT                   NGDLTITASVTNANGNTGSGTRDITIDANLPGLRVDTVAGDDIVNSIEHGQALVITGGS
FT                   SGLNAGAVLTVTINSVAYSATVQADGSWSVGIPAANVSAWPAGPLTVEVDGQSSANNPV
FT                   SVSHPFTVDLTAVAISINTVASDDVINAAEKGTNLTLSGSTSGIESGQTVTVTFGGKTY
FT                   TASVAANGSWSVNVPAADLATLPEGAANVQASVSSASGNSASATHAYSVDASAPTLTIN
FT                   TIASDDILNAAEAGSPLTISGTSTAETGQTVTVTLNGATYTGTVQADGSWSVSVPTSAL
FT                   GALNASNYTVSATVNDKAGNPGSASHNLAVDTTAPVLTINTVAGDDIINDAEHAQALVI
FT                   SGTSSGGEXGDVVSVVLNGKTYTTTLDASGNWSVGVPAADVTALGSGAQTITASVSDRA
FT                   GNSDDASRTVTVSLSAPVISINTIAGDDVINATEKGSDLALSGTSDQPAGTAITVTLNG
FT                   QNYSATTDASGNWSVTVPASAVSALGEATYSVTASVTNAQGNSSTASHNVQVNTALPGI
FT                   TINPVATDDIINASEAGSAQTISGQVTGAAAGSTVTVELGGKTYTATVQADLSWNVSVP
FT                   AADWQALGNGELTVNASVTNAVGNTGSGTRDITIDASLPGLRVDTVAGDDVVNIIEHAQ
FT                   AQVITGSSSGFAAGTALTVVINNQTYAATVLANGSWSVGVPATDVSNWPAGTLNITVSG
FT                   ANSAGTQTSITHPLTVDLTAVAISMNSITSDDAINAAEKGAALTLSGSTSGVEAGQTVT
FT                   VTFGGKTYTTTVAANGSWSTTVPAADLAALRDGDASAQVRVTNVNGNSATATHEYSVDS
FT                   AAPTVTINTIASDNIINASEAAAGVTVSGTSTAQTGQTLTVTLNGTNYQTTVQTDGSWS
FT                   LTLPASDLTALANNGYTLTATVSDLAGNLGSASKGVTVDTTAPVISFNTVAGDDVINNV
FT                   EHIQAQIISGTATGAVAGDRLVVTIAGQQYVTSTDASGNWSVGVPASVISGLADGTVTI
FT                   SATITDSAGNSSTQTHNVQVNTAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATG
FT                   TVVTVLLNGKGYSATIQSNGSWSVNVXAADVAALSDGTSYTVSASAQDSAGNSATASRS
FT                   VAVDLTAPVISINTVSTDDRXNAAEQQQPLTLNGSTSAEVGQTVTVTFGGKTYTATVAA
FT                   NGTWALNVPAVDLAALGQGAQTITASVNDRAGNPGQATHALTVDTVAPTVTIATVAGDD
FT                   IINNAEQLAGQTISGTTTAEVGQTVTVTFNGQTWSATVGSGGSWSVFIPAQQFAGLSDG
FT                   SYTISATVSDQAGNPGSASRGVTLNGDVPTVTINTFAGDDVVNAAEHGSSLVISGTTTA
FT                   PVGQTLTLTLNGKTYTTTVQTGGSWSYTLGSADVTALADGNAYVINASVSNAIGNTGSS
FT                   NHTITVDLSAPAMGINIDSLQADTGLSASDFITSVSPVVVNGSLTAALASNETAQISID
FT                   GGTTWTTLTVTGTTWRYNDSRTLTDGNYLYQVRVIDAAGNVGATDSQNVVIDTTAPDPA
FT                   VKTIAISAITTDMGLITNDFVTSDTTLAVSGTLGATLSAGEFAQISLDGGVTWTTLTVV
FT                   GTSWSYADGHTLTDGTWNYTVRVVDLAGNVGQTATQNVVVDTTSPEAAKSITITGIXDD
FT                   TGTSSSDFITSDTTLTVRGVLGAALGANEFAQISTDNGATWVNVTVAADSLNWSYVDGR
FT                   TLTNGTTTWQVRVVDLAGNVGATSSQSALIDTVNPAQVLTIASISTDTGSSATDFITSD
FT                   TMLTLTGSLGAGLASGEVAQISLDSGATWTTLTTNGTQWTYTDSRTLTDGSYVYQVRVL
FT                   DLAGNTGPVVSKTVVVDTINPTATPTIVSYTDDVGQRQGTLSSLQATDDTTPLLNGVLS
FT                   APLASGEVVYLYRNGLLLGAVTMVGALNWTYSDSGLVSGAYTYSARVVDLAGNITSSSD
FT                   FVLTVDTSIPTTLAQITSQTTRDTTPIISGVITAALASGQYVEVVINGKTYTSEPGGAV
FT                   VVDPAHNTWYVQLPDTDALTVSATAYTVTAQVKSSAGNGNNANISNGTVTVNAAIDYTP
FT                   TWTTASKTTAWGLTYGLDSHGMWTVLANQQVMQSTDPLTWSKTALTLYQSGNNYATSSI
FT                   ADYDRNGTGDLFITRDDYGTGYINGFTNNGDGTFSSAIQVTVGTLTWYGSIVAFDKEGD
FT                   GYLDFWIGDAGGPDSNTFLWNNAGTLVGNSTTSNSGGSATVGGAVTGYLSLNEGSGVDL
FT                   NNDGRIDLVQHTYNLNNYYTLSSLINQGNGTFVWGQNTTNTFLSGAGSGAMSSSVSMTW
FT                   ADFDGDGDMDLFLPASQGRANYGSLLFNTNGVLGCPVAVGATATTYASQFSLAVDWNHD
FT                   GLMDIARIAQTGQSYLYTNVSNASNWTQSALGGSQSGTTSGVAAMDYDWDGAVDVLVSK
FT                   QSGSVFLSRNTNTVSYGTSLHLRITDPNGINVYYGNTVKLYNSAGVLVATQIINPQSGM
FT                   GVNDTSALVNFYGLNAGETYNAVLIKSTGTTASNIDQTVNTSWGGLQATDATHAYDLSA
FT                   EAGTASNNGKFVGTGYNDTFFATAGTDTYDGSGGWVYSSGTGTWLANGGMDVVDFRLST
FT                   VGVTANLSSTAAQATGFNTSTFTNIEGISGSNFNDILTGSSGDNQLEGRGGNDTLNIGN
FT                   GGHDTLLYKLLNASDATGGNGSDVVNGFTVGTWEGTADTDRIDIRELLQGSGYTGNGKA
FT                   SYVNGVATLDAQAGNIGDFVKVTQSGSDTIVQIDRDGTGGTFATTNVVTLTGVHTDLAT
FT                   LLANHQLMVV"
FT   gene            601519..603681
FT                   /locus_tag="Z0634"
FT   CDS_pept        601519..603681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0634"
FT                   /product="putative cytoplasmic membrane export protein"
FT                   /function="putative transport; Transport of large
FT                   molecules: Protein, peptide secretion"
FT                   /note="Residues 12 to 701 of 720 are 27.76 pct identical to
FT                   residues 15 to 698 of 711 from GenPept 118 :
FT                   gi|6531348|gb|AAF15371.1|U66588_3 (U66588) PaxB
FT                   [Pasteurella aerogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54839"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2G8"
FT                   /protein_id="AAG54839.1"
FT                   /translation="MKKNAQSVEAWLEAMIAVARYYRLDFSQENVRATVNWERDSKREE
FT                   LLTDMARQLGMGLRLVEFSADSLNPWRLPLIAVFDNQQIGVITRRDNHDNISVQFSGDE
FT                   GLETTLNVADIEDKIVELALLRPLSAIPDARVDDYIRPYQANWFWSLSLKDWRRYGDIM
FT                   LASLVANVLALAAMIFSMQVYDRVVPAQSYPTLWVLFAGVMMAILFEFCMRMVRTHLSD
FT                   VIGKRADLRISDRVFGHALRLKNNVRSKSTGSFISQIRELESVRELITSTTIGAVADLP
FT                   FFLLFVFILWMIGGWLVLVVLLALPLLVIPGLLVQRPLARLANEGMRESAVRNATLVEA
FT                   VQSIEDIKLLRAEQRFQNQWNHTNDVASSISMKQRFLTGLLLTWTQEVQSIVYVVVLLV
FT                   GCFMVMNGDMTTGALVGTTILASRTIAPLSQISGVLSRWQQAKVARNGLDELMKRPVDQ
FT                   PEHGKLVHKAVLHGNYQFSNAVFYYDEEEKIADVAIGKLNIQAGEKIAILGRNGAGKST
FT                   LLQMLAGMRIAQQGQVLLDNISIGQLDPADLRRDMGLLSQTGRLFFGSLRENLTMGMPE
FT                   ASDEDIERALTLSGALPFVQKQKNGLNYMIQEGGFGLSGGQRQTLLLARLLISQPNIVL
FT                   LDEPSASLDEMAEAYLIEQLKQWIGHRTLIIATHRTAMLQLVDRIIVMDQGRIVMDGAK
FT                   EAILREQGEPTARRVVLQEKNKGSAA"
FT   gene            603678..604853
FT                   /locus_tag="Z0635"
FT   CDS_pept        603678..604853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0635"
FT                   /product="putative membrane spanning export protein"
FT                   /function="putative transport; Transport of large
FT                   molecules: Protein, peptide secretion"
FT                   /note="Residues 1 to 390 of 391 are 29.70 pct identical to
FT                   residues 1 to 438 of 439 from GenPept 118 :
FT                   gi|2281441|gb|AAB64092.1| (U89163) PrsE [Sinorhizobium
FT                   meliloti]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54840"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2G4"
FT                   /protein_id="AAG54840.1"
FT                   /translation="MNGQLQYNRGLTEPRLPRSALAVRVTAVMLLCFLGWAWYFQLDEV
FT                   TTGSGTVEPSGREQVVQSLEGGILYHLDVKVGDIVEQGQPLAQLNRTKTESDVQEAMSR
FT                   LYAALATSARLRAEVSNKPLVFPDELNKFPELIESETALYNTRRDGLNKATTGLTQGIS
FT                   LVNRELAMTQPLVKQGAASSVEVLRLQRQANELENKLSDVRTQYYVQAREELAKANAEV
FT                   ETQRSVIRGREDSLTRLNFTAPVRGIVQDIDVTTVGGVIAPGGKLMTIVPLDEQLLIEA
FT                   KISPRDVAFIHPGQKSLVKITAYDYSIYGGLPGEVAVISPDTVQDEVRRDVYYYRVYIR
FT                   TFSNHLENKSKQQFPIFPGMVATVDIRTGKKSVLDYLLKPFNKAQEALRER"
FT   gene            604925..605257
FT                   /gene="ybbI"
FT                   /locus_tag="Z0636"
FT   CDS_pept        604925..605257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbI"
FT                   /locus_tag="Z0636"
FT                   /product="putative transcriptional regulator"
FT                   /function="putative regulator; Not classified"
FT                   /note="Residues 1 to 110 of 110 are 98.18 pct identical to
FT                   residues 26 to 135 of 135 from Escherichia coli K-12 Strain
FT                   MG1655: B0487"
FT                   /db_xref="EnsemblGenomes-Gn:Z0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54841"
FT                   /db_xref="GOA:Q8XD09"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD09"
FT                   /protein_id="AAG54841.1"
FT                   /translation="MTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLEESGELVNLF
FT                   NDPQRHSADVKRRTLEKVAEIERHIEELQSMRNQLLALANACPGDDSADCPIIENLSGC
FT                   CHHRAG"
FT   misc_feature    605258..607900
FT                   /note="O-island #29; Region of the EDL933 chromosome not
FT                   homologous to E. coli K-12 MG1655"
FT   gene            complement(605461..605883)
FT                   /locus_tag="Z0638"
FT   CDS_pept        complement(605461..605883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0638"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54842"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1JDK6"
FT                   /protein_id="AAG54842.1"
FT                   /translation="MMNSSIKSFSLLAVILLAGCSSPTSRIADCQAQGVSHDTCYLAEQ
FT                   QRQAAILSASEAQAFKNAEAAQHAQAAKKAIYKGFGMTFRMSSKNFAYLNDSLCAIDED
FT                   NKDATVYQSGLYNVIVYHHTGKVALMKEGQFVGYLK"
FT   gene            complement(605968..606984)
FT                   /locus_tag="Z0639"
FT   CDS_pept        complement(605968..606984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0639"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="Residues 2 to 338 of 338 are 23.03 pct identical to
FT                   residues 34 to 362 of 364 from GenPept 118 :
FT                   gi|7227256|gb|AAF42321.1| (AE002548) adhesin/invasin,
FT                   putative [Neisseria meningitidis MC58]"
FT                   /db_xref="EnsemblGenomes-Gn:Z0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54843"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C4B8"
FT                   /protein_id="AAG54843.1"
FT                   /translation="MKTVNVALLALIISATSSPVVLAGDTIEAAATELSAINSGMSQSE
FT                   IEQKITRFLERTDNSPAAYTYLTEHHYIPSETPDTTQTPTVQTDPDAGQKTVAATGDVQ
FT                   TTARYQSMINARQSAVTDAQQTQITEQQAQIVATQKTLAATGDTQNTAHYQEMINARLA
FT                   AQNEANQRTATEQGQKMNALTTDVAVQQQNERTQYDKQMQSLAQESAQAHEQIDSLSQD
FT                   VTQTHQQLTNTQKRVADNSQQINTLNNHFSSLKNEVDDNRKEANAGTASAIAIASQPQV
FT                   KTGDVMMVSAGAGTFNGESAVSVGTSFNAGTHTVLKAGISADTQSDFGAGVGVGYSF"
FT   gene            607351..607713
FT                   /locus_tag="Z0640"
FT   CDS_pept        607351..607713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Z0640"
FT                   /product="hypothetical protein"
FT                   /function="orf; Unknown function"
FT                   /note="No significant matches"
FT                   /db_xref="EnsemblGenomes-Gn:Z0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAG54844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4Q0C2D4"
FT                   /pr