(data stored in ACNUC7421 zone)

EMBL: AE005672

ID   AE005672; SV 3; circular; genomic DNA; STD; PRO; 2160842 BP.
AC   AE005672; AE007318-AE007511;
PR   Project:PRJNA277;
DT   27-JAN-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
DE   Streptococcus pneumoniae TIGR4, complete genome.
KW   .
OS   Streptococcus pneumoniae TIGR4
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
RN   [1]
RP   1-2160842
RX   DOI; 10.1126/science.1061217.
RX   PUBMED; 11463916.
RA   Tettelin H., Nelson K.E., Paulsen I.T., Eisen J.A., Read T.D., Peterson S.,
RA   Heidelberg J., DeBoy R.T., Haft D.H., Dodson R.J., Durkin A.S., Gwinn M.,
RA   Kolonay J.F., Nelson W.C., Peterson J.D., Umayam L.A., White O.,
RA   Salzberg S.L., Lewis M.R., Radune D., Holtzapple E., Khouri H., Wolf A.M.,
RA   Utterback T.R., Hansen C.L., McDonald L.A., Feldblyum T.V., Angiuoli S.,
RA   Dickinson T., Hickey E.K., Holt I.E., Loftus B.J., Yang F., Smith H.O.,
RA   Venter J.C., Dougherty B.A., Morrison D.A., Hollingshead S.K., Fraser C.M.;
RT   "Complete genome sequence of a virulent isolate of Streptococcus
RT   pneumoniae";
RL   Science, e1252229 293(5529):498-506(2001).
RN   [2]
RP   1-2160842
RA   Tettelin H., Nelson K.E., Paulsen I.T., Eisen J.A., Read T.D., Peterson S.,
RA   Heidelberg J., DeBoy R.T., Haft D.H., Dodson R.J., Durkin A.S., Gwinn M.,
RA   Kolonay J.F., Nelson W.C., Peterson J.D., Umayam L.A., White O.,
RA   Lewis M.R., Radune D., Holtzapple E., Khouri H., Wolf A.M., Utterback T.R.,
RA   Hansen C.L., McDonald L.A., Feldblyum T.V., Angiuoli S., Gesuwan P.,
RA   Hickey E.K., Holt I.E., Loftus B.J., Ujwal M.L., Yang F., Smith H.O.,
RA   Venter J.C., Dougherty B.A., Morrison D.A., Hollingshead S.K., Fraser C.M.;
RT   ;
RL   Submitted (29-JUN-2001) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
RN   [3]
RC   Sequence update by submitter
RP   1-2160842
RA   Shumway M., Schobel S., Koo H., Dodson R., Tettelin H.;
RT   ;
RL   Submitted (26-JAN-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
RN   [4]
RC   Sequence update by submitter
RP   1-2160842
RA   Tettelin H.;
RT   ;
RL   Submitted (03-JUL-2008) to the INSDC.
RL   Institute for Genome Sciences, Department of Microbiology and Immunology,
RL   University of Maryland School of Medicine, HSF-II, Room S245, 20 Penn
RL   Street, Rockville, MD 21201, USA
DR   MD5; 50086819690b19b94ce37f1d75a7e539.
DR   BioSample; SAMN02604002.
DR   EnsemblGenomes-Gn; EBG00001174193.
DR   EnsemblGenomes-Gn; EBG00001174194.
DR   EnsemblGenomes-Gn; EBG00001174195.
DR   EnsemblGenomes-Gn; EBG00001174196.
DR   EnsemblGenomes-Gn; EBG00001174197.
DR   EnsemblGenomes-Gn; EBG00001174198.
DR   EnsemblGenomes-Gn; EBG00001174199.
DR   EnsemblGenomes-Gn; EBG00001174200.
DR   EnsemblGenomes-Gn; EBG00001174201.
DR   EnsemblGenomes-Gn; EBG00001174202.
DR   EnsemblGenomes-Gn; EBG00001174203.
DR   EnsemblGenomes-Gn; EBG00001174204.
DR   EnsemblGenomes-Gn; EBG00001174205.
DR   EnsemblGenomes-Gn; EBG00001174206.
DR   EnsemblGenomes-Gn; EBG00001174207.
DR   EnsemblGenomes-Gn; EBG00001174208.
DR   EnsemblGenomes-Gn; EBG00001174209.
DR   EnsemblGenomes-Gn; EBG00001174210.
DR   EnsemblGenomes-Gn; EBG00001174211.
DR   EnsemblGenomes-Gn; EBG00001174212.
DR   EnsemblGenomes-Gn; EBG00001174213.
DR   EnsemblGenomes-Gn; EBG00001174214.
DR   EnsemblGenomes-Gn; EBG00001174215.
DR   EnsemblGenomes-Gn; EBG00001174216.
DR   EnsemblGenomes-Gn; EBG00001174217.
DR   EnsemblGenomes-Gn; EBG00001174218.
DR   EnsemblGenomes-Gn; EBG00001174219.
DR   EnsemblGenomes-Gn; EBG00001174220.
DR   EnsemblGenomes-Gn; EBG00001174221.
DR   EnsemblGenomes-Gn; EBG00001174222.
DR   EnsemblGenomes-Gn; EBG00001174223.
DR   EnsemblGenomes-Gn; EBG00001174224.
DR   EnsemblGenomes-Gn; EBG00001174225.
DR   EnsemblGenomes-Gn; EBG00001174226.
DR   EnsemblGenomes-Gn; EBG00001174227.
DR   EnsemblGenomes-Gn; EBG00001174228.
DR   EnsemblGenomes-Gn; EBG00001174229.
DR   EnsemblGenomes-Gn; EBG00001174230.
DR   EnsemblGenomes-Gn; EBG00001174231.
DR   EnsemblGenomes-Gn; EBG00001174232.
DR   EnsemblGenomes-Gn; EBG00001174233.
DR   EnsemblGenomes-Gn; EBG00001174234.
DR   EnsemblGenomes-Gn; EBG00001174235.
DR   EnsemblGenomes-Gn; EBG00001174236.
DR   EnsemblGenomes-Gn; EBG00001174237.
DR   EnsemblGenomes-Gn; EBG00001174238.
DR   EnsemblGenomes-Gn; EBG00001174239.
DR   EnsemblGenomes-Gn; EBG00001174240.
DR   EnsemblGenomes-Gn; EBG00001174241.
DR   EnsemblGenomes-Gn; EBG00001174242.
DR   EnsemblGenomes-Gn; EBG00001174243.
DR   EnsemblGenomes-Gn; EBG00001174244.
DR   EnsemblGenomes-Gn; EBG00001174245.
DR   EnsemblGenomes-Gn; EBG00001174246.
DR   EnsemblGenomes-Gn; EBG00001174247.
DR   EnsemblGenomes-Gn; EBG00001174248.
DR   EnsemblGenomes-Gn; EBG00001174249.
DR   EnsemblGenomes-Gn; EBG00001174250.
DR   EnsemblGenomes-Gn; EBG00001174251.
DR   EnsemblGenomes-Gn; EBG00001174252.
DR   EnsemblGenomes-Gn; EBG00001174253.
DR   EnsemblGenomes-Gn; EBG00001174254.
DR   EnsemblGenomes-Gn; EBG00001174255.
DR   EnsemblGenomes-Gn; EBG00001174256.
DR   EnsemblGenomes-Gn; EBG00001174257.
DR   EnsemblGenomes-Gn; EBG00001174258.
DR   EnsemblGenomes-Gn; EBG00001174259.
DR   EnsemblGenomes-Gn; EBG00001174260.
DR   EnsemblGenomes-Gn; EBG00001174261.
DR   EnsemblGenomes-Gn; EBG00001174262.
DR   EnsemblGenomes-Gn; EBG00001174263.
DR   EnsemblGenomes-Gn; EBG00001174264.
DR   EnsemblGenomes-Gn; EBG00001174265.
DR   EnsemblGenomes-Gn; EBG00001174266.
DR   EnsemblGenomes-Gn; EBG00001174267.
DR   EnsemblGenomes-Gn; EBG00001174268.
DR   EnsemblGenomes-Gn; EBG00001174269.
DR   EnsemblGenomes-Gn; EBG00001174270.
DR   EnsemblGenomes-Gn; EBG00001174271.
DR   EnsemblGenomes-Gn; EBG00001174272.
DR   EnsemblGenomes-Gn; EBG00001174273.
DR   EnsemblGenomes-Gn; EBG00001174274.
DR   EnsemblGenomes-Gn; EBG00001174275.
DR   EnsemblGenomes-Gn; EBG00001174276.
DR   EnsemblGenomes-Gn; EBG00001174277.
DR   EnsemblGenomes-Gn; EBG00001174278.
DR   EnsemblGenomes-Gn; EBG00001174279.
DR   EnsemblGenomes-Gn; EBG00001174280.
DR   EnsemblGenomes-Gn; EBG00001174281.
DR   EnsemblGenomes-Gn; EBG00001174282.
DR   EnsemblGenomes-Gn; EBG00001174283.
DR   EnsemblGenomes-Gn; EBG00001174284.
DR   EnsemblGenomes-Gn; EBG00001174285.
DR   EnsemblGenomes-Gn; EBG00001174286.
DR   EnsemblGenomes-Gn; EBG00001174287.
DR   EnsemblGenomes-Gn; EBG00001174288.
DR   EnsemblGenomes-Gn; EBG00001174289.
DR   EnsemblGenomes-Gn; EBG00001174290.
DR   EnsemblGenomes-Gn; EBG00001174291.
DR   EnsemblGenomes-Gn; EBG00001174292.
DR   EnsemblGenomes-Gn; EBG00001174293.
DR   EnsemblGenomes-Gn; EBG00001174294.
DR   EnsemblGenomes-Gn; EBG00001174295.
DR   EnsemblGenomes-Gn; EBG00001174296.
DR   EnsemblGenomes-Gn; EBG00001174297.
DR   EnsemblGenomes-Gn; EBG00001174298.
DR   EnsemblGenomes-Gn; EBG00001174299.
DR   EnsemblGenomes-Gn; EBG00001174300.
DR   EnsemblGenomes-Gn; EBG00001174301.
DR   EnsemblGenomes-Gn; EBG00001174302.
DR   EnsemblGenomes-Gn; EBG00001174303.
DR   EnsemblGenomes-Gn; EBG00001174304.
DR   EnsemblGenomes-Gn; EBG00001174305.
DR   EnsemblGenomes-Gn; EBG00001174306.
DR   EnsemblGenomes-Gn; EBG00001174307.
DR   EnsemblGenomes-Gn; SP_2242.
DR   EnsemblGenomes-Gn; SP_2243.
DR   EnsemblGenomes-Gn; SP_2244.
DR   EnsemblGenomes-Gn; SP_2245.
DR   EnsemblGenomes-Gn; SP_2246.
DR   EnsemblGenomes-Gn; SP_2247.
DR   EnsemblGenomes-Gn; SP_2248.
DR   EnsemblGenomes-Gn; SP_2249.
DR   EnsemblGenomes-Gn; SP_2250.
DR   EnsemblGenomes-Gn; SP_2251.
DR   EnsemblGenomes-Gn; SP_2252.
DR   EnsemblGenomes-Gn; SP_2253.
DR   EnsemblGenomes-Gn; SP_2254.
DR   EnsemblGenomes-Gn; SP_2255.
DR   EnsemblGenomes-Gn; SP_2256.
DR   EnsemblGenomes-Gn; SP_2257.
DR   EnsemblGenomes-Gn; SP_2258.
DR   EnsemblGenomes-Gn; SP_2259.
DR   EnsemblGenomes-Gn; SP_2260.
DR   EnsemblGenomes-Gn; SP_2261.
DR   EnsemblGenomes-Gn; SP_2262.
DR   EnsemblGenomes-Gn; SP_2263.
DR   EnsemblGenomes-Gn; SP_2264.
DR   EnsemblGenomes-Gn; SP_2265.
DR   EnsemblGenomes-Gn; SP_2266.
DR   EnsemblGenomes-Gn; SP_2267.
DR   EnsemblGenomes-Gn; SP_2268.
DR   EnsemblGenomes-Gn; SP_2269.
DR   EnsemblGenomes-Gn; SP_2270.
DR   EnsemblGenomes-Gn; SP_2271.
DR   EnsemblGenomes-Gn; SP_2272.
DR   EnsemblGenomes-Gn; SP_2273.
DR   EnsemblGenomes-Gn; SP_2274.
DR   EnsemblGenomes-Gn; SP_2275.
DR   EnsemblGenomes-Gn; SP_2276.
DR   EnsemblGenomes-Gn; SP_2277.
DR   EnsemblGenomes-Gn; SP_2278.
DR   EnsemblGenomes-Gn; SP_2279.
DR   EnsemblGenomes-Gn; SP_2280.
DR   EnsemblGenomes-Gn; SP_2281.
DR   EnsemblGenomes-Gn; SP_2282.
DR   EnsemblGenomes-Gn; SP_2283.
DR   EnsemblGenomes-Gn; SP_2284.
DR   EnsemblGenomes-Gn; SP_2285.
DR   EnsemblGenomes-Gn; SP_2286.
DR   EnsemblGenomes-Gn; SP_2287.
DR   EnsemblGenomes-Gn; SP_2288.
DR   EnsemblGenomes-Gn; SP_2289.
DR   EnsemblGenomes-Gn; SP_2290.
DR   EnsemblGenomes-Gn; SP_2291.
DR   EnsemblGenomes-Gn; SP_2292.
DR   EnsemblGenomes-Gn; SP_2293.
DR   EnsemblGenomes-Gn; SP_2294.
DR   EnsemblGenomes-Gn; SP_2295.
DR   EnsemblGenomes-Gn; SP_2296.
DR   EnsemblGenomes-Gn; SP_2297.
DR   EnsemblGenomes-Gn; SP_2298.
DR   EnsemblGenomes-Gn; SP_2299.
DR   EnsemblGenomes-Tr; EBT00001752475.
DR   EnsemblGenomes-Tr; EBT00001752476.
DR   EnsemblGenomes-Tr; EBT00001752477.
DR   EnsemblGenomes-Tr; EBT00001752478.
DR   EnsemblGenomes-Tr; EBT00001752479.
DR   EnsemblGenomes-Tr; EBT00001752480.
DR   EnsemblGenomes-Tr; EBT00001752481.
DR   EnsemblGenomes-Tr; EBT00001752482.
DR   EnsemblGenomes-Tr; EBT00001752483.
DR   EnsemblGenomes-Tr; EBT00001752484.
DR   EnsemblGenomes-Tr; EBT00001752485.
DR   EnsemblGenomes-Tr; EBT00001752486.
DR   EnsemblGenomes-Tr; EBT00001752487.
DR   EnsemblGenomes-Tr; EBT00001752488.
DR   EnsemblGenomes-Tr; EBT00001752489.
DR   EnsemblGenomes-Tr; EBT00001752490.
DR   EnsemblGenomes-Tr; EBT00001752491.
DR   EnsemblGenomes-Tr; EBT00001752492.
DR   EnsemblGenomes-Tr; EBT00001752493.
DR   EnsemblGenomes-Tr; EBT00001752494.
DR   EnsemblGenomes-Tr; EBT00001752495.
DR   EnsemblGenomes-Tr; EBT00001752496.
DR   EnsemblGenomes-Tr; EBT00001752497.
DR   EnsemblGenomes-Tr; EBT00001752498.
DR   EnsemblGenomes-Tr; EBT00001752499.
DR   EnsemblGenomes-Tr; EBT00001752500.
DR   EnsemblGenomes-Tr; EBT00001752501.
DR   EnsemblGenomes-Tr; EBT00001752502.
DR   EnsemblGenomes-Tr; EBT00001752503.
DR   EnsemblGenomes-Tr; EBT00001752504.
DR   EnsemblGenomes-Tr; EBT00001752505.
DR   EnsemblGenomes-Tr; EBT00001752506.
DR   EnsemblGenomes-Tr; EBT00001752507.
DR   EnsemblGenomes-Tr; EBT00001752508.
DR   EnsemblGenomes-Tr; EBT00001752509.
DR   EnsemblGenomes-Tr; EBT00001752510.
DR   EnsemblGenomes-Tr; EBT00001752511.
DR   EnsemblGenomes-Tr; EBT00001752512.
DR   EnsemblGenomes-Tr; EBT00001752513.
DR   EnsemblGenomes-Tr; EBT00001752514.
DR   EnsemblGenomes-Tr; EBT00001752515.
DR   EnsemblGenomes-Tr; EBT00001752516.
DR   EnsemblGenomes-Tr; EBT00001752517.
DR   EnsemblGenomes-Tr; EBT00001752518.
DR   EnsemblGenomes-Tr; EBT00001752519.
DR   EnsemblGenomes-Tr; EBT00001752520.
DR   EnsemblGenomes-Tr; EBT00001752521.
DR   EnsemblGenomes-Tr; EBT00001752522.
DR   EnsemblGenomes-Tr; EBT00001752523.
DR   EnsemblGenomes-Tr; EBT00001752524.
DR   EnsemblGenomes-Tr; EBT00001752525.
DR   EnsemblGenomes-Tr; EBT00001752526.
DR   EnsemblGenomes-Tr; EBT00001752527.
DR   EnsemblGenomes-Tr; EBT00001752528.
DR   EnsemblGenomes-Tr; EBT00001752529.
DR   EnsemblGenomes-Tr; EBT00001752530.
DR   EnsemblGenomes-Tr; EBT00001752531.
DR   EnsemblGenomes-Tr; EBT00001752532.
DR   EnsemblGenomes-Tr; EBT00001752533.
DR   EnsemblGenomes-Tr; EBT00001752534.
DR   EnsemblGenomes-Tr; EBT00001752535.
DR   EnsemblGenomes-Tr; EBT00001752536.
DR   EnsemblGenomes-Tr; EBT00001752537.
DR   EnsemblGenomes-Tr; EBT00001752538.
DR   EnsemblGenomes-Tr; EBT00001752539.
DR   EnsemblGenomes-Tr; EBT00001752540.
DR   EnsemblGenomes-Tr; EBT00001752541.
DR   EnsemblGenomes-Tr; EBT00001752542.
DR   EnsemblGenomes-Tr; EBT00001752543.
DR   EnsemblGenomes-Tr; EBT00001752544.
DR   EnsemblGenomes-Tr; EBT00001752545.
DR   EnsemblGenomes-Tr; EBT00001752546.
DR   EnsemblGenomes-Tr; EBT00001752547.
DR   EnsemblGenomes-Tr; EBT00001752548.
DR   EnsemblGenomes-Tr; EBT00001752549.
DR   EnsemblGenomes-Tr; EBT00001752550.
DR   EnsemblGenomes-Tr; EBT00001752551.
DR   EnsemblGenomes-Tr; EBT00001752552.
DR   EnsemblGenomes-Tr; EBT00001752553.
DR   EnsemblGenomes-Tr; EBT00001752554.
DR   EnsemblGenomes-Tr; EBT00001752555.
DR   EnsemblGenomes-Tr; EBT00001752556.
DR   EnsemblGenomes-Tr; EBT00001752557.
DR   EnsemblGenomes-Tr; EBT00001752558.
DR   EnsemblGenomes-Tr; EBT00001752559.
DR   EnsemblGenomes-Tr; EBT00001752560.
DR   EnsemblGenomes-Tr; EBT00001752561.
DR   EnsemblGenomes-Tr; EBT00001752562.
DR   EnsemblGenomes-Tr; EBT00001752563.
DR   EnsemblGenomes-Tr; EBT00001752564.
DR   EnsemblGenomes-Tr; EBT00001752565.
DR   EnsemblGenomes-Tr; EBT00001752566.
DR   EnsemblGenomes-Tr; EBT00001752567.
DR   EnsemblGenomes-Tr; EBT00001752568.
DR   EnsemblGenomes-Tr; EBT00001752569.
DR   EnsemblGenomes-Tr; EBT00001752570.
DR   EnsemblGenomes-Tr; EBT00001752571.
DR   EnsemblGenomes-Tr; EBT00001752572.
DR   EnsemblGenomes-Tr; EBT00001752573.
DR   EnsemblGenomes-Tr; EBT00001752574.
DR   EnsemblGenomes-Tr; EBT00001752575.
DR   EnsemblGenomes-Tr; EBT00001752576.
DR   EnsemblGenomes-Tr; EBT00001752577.
DR   EnsemblGenomes-Tr; EBT00001752578.
DR   EnsemblGenomes-Tr; EBT00001752579.
DR   EnsemblGenomes-Tr; EBT00001752580.
DR   EnsemblGenomes-Tr; EBT00001752581.
DR   EnsemblGenomes-Tr; EBT00001752582.
DR   EnsemblGenomes-Tr; EBT00001752583.
DR   EnsemblGenomes-Tr; EBT00001752584.
DR   EnsemblGenomes-Tr; EBT00001752585.
DR   EnsemblGenomes-Tr; EBT00001752586.
DR   EnsemblGenomes-Tr; EBT00001752587.
DR   EnsemblGenomes-Tr; EBT00001752588.
DR   EnsemblGenomes-Tr; EBT00001752589.
DR   EnsemblGenomes-Tr; SP_2242-1.
DR   EnsemblGenomes-Tr; SP_2243-1.
DR   EnsemblGenomes-Tr; SP_2244-1.
DR   EnsemblGenomes-Tr; SP_2245-1.
DR   EnsemblGenomes-Tr; SP_2246-1.
DR   EnsemblGenomes-Tr; SP_2247-1.
DR   EnsemblGenomes-Tr; SP_2248-1.
DR   EnsemblGenomes-Tr; SP_2249-1.
DR   EnsemblGenomes-Tr; SP_2250-1.
DR   EnsemblGenomes-Tr; SP_2251-1.
DR   EnsemblGenomes-Tr; SP_2252-1.
DR   EnsemblGenomes-Tr; SP_2253-1.
DR   EnsemblGenomes-Tr; SP_2254-1.
DR   EnsemblGenomes-Tr; SP_2255-1.
DR   EnsemblGenomes-Tr; SP_2256-1.
DR   EnsemblGenomes-Tr; SP_2257-1.
DR   EnsemblGenomes-Tr; SP_2258-1.
DR   EnsemblGenomes-Tr; SP_2259-1.
DR   EnsemblGenomes-Tr; SP_2260-1.
DR   EnsemblGenomes-Tr; SP_2261-1.
DR   EnsemblGenomes-Tr; SP_2262-1.
DR   EnsemblGenomes-Tr; SP_2263-1.
DR   EnsemblGenomes-Tr; SP_2264-1.
DR   EnsemblGenomes-Tr; SP_2265-1.
DR   EnsemblGenomes-Tr; SP_2266-1.
DR   EnsemblGenomes-Tr; SP_2267-1.
DR   EnsemblGenomes-Tr; SP_2268-1.
DR   EnsemblGenomes-Tr; SP_2269-1.
DR   EnsemblGenomes-Tr; SP_2270-1.
DR   EnsemblGenomes-Tr; SP_2271-1.
DR   EnsemblGenomes-Tr; SP_2272-1.
DR   EnsemblGenomes-Tr; SP_2273-1.
DR   EnsemblGenomes-Tr; SP_2274-1.
DR   EnsemblGenomes-Tr; SP_2275-1.
DR   EnsemblGenomes-Tr; SP_2276-1.
DR   EnsemblGenomes-Tr; SP_2277-1.
DR   EnsemblGenomes-Tr; SP_2278-1.
DR   EnsemblGenomes-Tr; SP_2279-1.
DR   EnsemblGenomes-Tr; SP_2280-1.
DR   EnsemblGenomes-Tr; SP_2281-1.
DR   EnsemblGenomes-Tr; SP_2282-1.
DR   EnsemblGenomes-Tr; SP_2283-1.
DR   EnsemblGenomes-Tr; SP_2284-1.
DR   EnsemblGenomes-Tr; SP_2285-1.
DR   EnsemblGenomes-Tr; SP_2286-1.
DR   EnsemblGenomes-Tr; SP_2287-1.
DR   EnsemblGenomes-Tr; SP_2288-1.
DR   EnsemblGenomes-Tr; SP_2289-1.
DR   EnsemblGenomes-Tr; SP_2290-1.
DR   EnsemblGenomes-Tr; SP_2291-1.
DR   EnsemblGenomes-Tr; SP_2292-1.
DR   EnsemblGenomes-Tr; SP_2293-1.
DR   EnsemblGenomes-Tr; SP_2294-1.
DR   EnsemblGenomes-Tr; SP_2295-1.
DR   EnsemblGenomes-Tr; SP_2296-1.
DR   EnsemblGenomes-Tr; SP_2297-1.
DR   EnsemblGenomes-Tr; SP_2298-1.
DR   EnsemblGenomes-Tr; SP_2299-1.
DR   EuropePMC; PMC1196152; 16109966.
DR   EuropePMC; PMC135229; 12142426.
DR   EuropePMC; PMC1360317; 16428766.
DR   EuropePMC; PMC141814; 12486041.
DR   EuropePMC; PMC1539626; 16861634.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC187332; 12933834.
DR   EuropePMC; PMC1951257; 17537936.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2151433; 17709462.
DR   EuropePMC; PMC2168654; 17675389.
DR   EuropePMC; PMC2168755; 17766420.
DR   EuropePMC; PMC2223752; 17981977.
DR   EuropePMC; PMC2446756; 18424523.
DR   EuropePMC; PMC2636762; 19171050.
DR   EuropePMC; PMC2648205; 19114491.
DR   EuropePMC; PMC2654543; 19325880.
DR   EuropePMC; PMC2657157; 19175920.
DR   EuropePMC; PMC2663135; 19139197.
DR   EuropePMC; PMC2678160; 19361343.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC3018475; 21264340.
DR   EuropePMC; PMC3043496; 21147955.
DR   EuropePMC; PMC3178606; 21966432.
DR   EuropePMC; PMC3187249; 21825065.
DR   EuropePMC; PMC3279804; 22347584.
DR   EuropePMC; PMC3318431; 22311922.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC3375284; 22719250.
DR   EuropePMC; PMC3535946; 23114782.
DR   EuropePMC; PMC3571320; 23264576.
DR   EuropePMC; PMC3578082; 23168398.
DR   EuropePMC; PMC3580495; 23158461.
DR   EuropePMC; PMC403657; 12799345.
DR   EuropePMC; PMC4070010; 24750294.
DR   EuropePMC; PMC4097588; 24816604.
DR   EuropePMC; PMC4187955; 25070090.
DR   EuropePMC; PMC4243769; 25163487.
DR   EuropePMC; PMC4331430; 25689507.
DR   EuropePMC; PMC4380333; 25826208.
DR   EuropePMC; PMC4424882; 25956132.
DR   EuropePMC; PMC4721534; 26363404.
DR   EuropePMC; PMC4907133; 27068094.
DR   EuropePMC; PMC5069739; 27822519.
DR   EuropePMC; PMC5215778; 28056108.
DR   EuropePMC; PMC5328485; 27993975.
DR   EuropePMC; PMC5526788; 28456649.
DR   EuropePMC; PMC5627049; 28931649.
DR   EuropePMC; PMC5662624; 29123510.
DR   EuropePMC; PMC5687919; 29152579.
DR   EuropePMC; PMC6001120; 29898666.
DR   EuropePMC; PMC6105882; 29891544.
DR   EuropePMC; PMC6177246; 30251911.
DR   EuropePMC; PMC6331587; 30643125.
DR   EuropePMC; PMC95544; 11717254.
DR   GOA; P0A3R3.
DR   InterPro; IPR000432; DNA_mismatch_repair_MutS_C.
DR   InterPro; IPR005748; DNA_mismatch_repair_MutS.
DR   InterPro; IPR007695; DNA_mismatch_repair_MutS-lik_N.
DR   InterPro; IPR007696; DNA_mismatch_repair_MutS_core.
DR   InterPro; IPR007860; DNA_mmatch_repair_MutS_con_dom.
DR   InterPro; IPR007861; DNA_mismatch_repair_MutS_clamp.
DR   InterPro; IPR016151; DNA_mismatch_repair_MutS_N.
DR   InterPro; IPR017261; DNA_mismatch_repair_MutS/MSH.
DR   InterPro; IPR036187; DNA_mismatch_repair_MutS_sf.
DR   InterPro; IPR036678; MutS_con_dom_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; AE005672.
DR   SILVA-SSU; AE005672.
DR   StrainInfo; 352345; 0.
DR   UniProtKB/Swiss-Prot; P0A3R3; HEXA_STRPN.
CC   On Jul 3, 2008 this sequence version replaced gi:85720550.
FH   Key             Location/Qualifiers
FT   source          1..2160842
FT                   /organism="Streptococcus pneumoniae TIGR4"
FT                   /strain="TIGR4; ATCC BAA-334"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:170187"
FT   gene            197..1558
FT                   /gene="dnaA"
FT                   /locus_tag="SP_0001"
FT   CDS_pept        197..1558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SP_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P35891; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74194"
FT                   /db_xref="GOA:O08397"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08397"
FT                   /protein_id="AAK74194.1"
FT   gene            1717..2853
FT                   /gene="dnaN"
FT                   /locus_tag="SP_0002"
FT   CDS_pept        1717..2853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SP_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74195"
FT                   /db_xref="GOA:O06672"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:2AWA"
FT                   /db_xref="UniProtKB/Swiss-Prot:O06672"
FT                   /protein_id="AAK74195.1"
FT   gene            2864..3112
FT                   /locus_tag="SP_0003"
FT   CDS_pept        2864..3112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0003"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74196"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY1"
FT                   /protein_id="AAK74196.1"
FT   gene            3196..4311
FT                   /locus_tag="SP_0004"
FT   CDS_pept        3196..4311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0004"
FT                   /product="GTP-binding protein"
FT                   /note="identified by similarity to EGAD:13306; match to
FT                   protein family HMM PF06071; match to protein family HMM
FT                   TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74197"
FT                   /db_xref="GOA:A0A0H2UMR5"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMR5"
FT                   /protein_id="AAK74197.1"
FT   gene            4382..4951
FT                   /gene="pth"
FT                   /locus_tag="SP_0005"
FT   CDS_pept        4382..4951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SP_0005"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74198"
FT                   /db_xref="GOA:Q97TD1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TD1"
FT                   /protein_id="AAK74198.1"
FT   gene            4952..8461
FT                   /gene="mfd"
FT                   /locus_tag="SP_0006"
FT   CDS_pept        4952..8461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SP_0006"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by similarity to EGAD:8856; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF02559; match to
FT                   protein family HMM PF03461; match to protein family HMM
FT                   PF04851; match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74199"
FT                   /db_xref="GOA:A0A0H2UMR6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMR6"
FT                   /protein_id="AAK74199.1"
FT                   NSI"
FT   gene            8519..8785
FT                   /locus_tag="SP_0007"
FT   CDS_pept        8519..8785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0007"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74200"
FT                   /db_xref="GOA:P64405"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64405"
FT                   /protein_id="AAK74200.1"
FT   gene            8778..9146
FT                   /locus_tag="SP_0008"
FT   CDS_pept        8778..9146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74201"
FT                   /db_xref="GOA:A0A0H2UMR4"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMR4"
FT                   /protein_id="AAK74201.1"
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            9151..9273
FT                   /locus_tag="SP_0009"
FT   CDS_pept        9151..9273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMU3"
FT                   /protein_id="AAK74202.1"
FT   gene            9266..10534
FT                   /locus_tag="SP_0010"
FT   CDS_pept        9266..10534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0010"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:137176"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74203"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY6"
FT                   /protein_id="AAK74203.1"
FT   gene            10531..11808
FT                   /gene="tilS"
FT                   /locus_tag="SP_0011"
FT   CDS_pept        10531..11808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="SP_0011"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by similarity to EGAD:164925; match to
FT                   protein family HMM PF01171; match to protein family HMM
FT                   TIGR02432; match to protein family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74204"
FT                   /db_xref="GOA:Q97TC5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TC5"
FT                   /protein_id="AAK74204.1"
FT   gene            11812..12354
FT                   /gene="hpt"
FT                   /locus_tag="SP_0012"
FT   CDS_pept        11812..12354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SP_0012"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:8043; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74205"
FT                   /db_xref="GOA:Q97TC4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TC4"
FT                   /protein_id="AAK74205.1"
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            12370..14328
FT                   /gene="ftsH"
FT                   /locus_tag="SP_0013"
FT   CDS_pept        12370..14328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SP_0013"
FT                   /product="cell division protein FtsH"
FT                   /note="identified by similarity to EGAD:13183; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF01434; match to protein family HMM PF06480; match to
FT                   protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74206"
FT                   /db_xref="GOA:O69076"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:O69076"
FT                   /protein_id="AAK74206.1"
FT                   SHALSYDEVKSKMNDEK"
FT   gene            14450..14929
FT                   /gene="comX1"
FT                   /locus_tag="SP_0014"
FT   CDS_pept        14450..14929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX1"
FT                   /locus_tag="SP_0014"
FT                   /product="transcriptional regulator ComX1"
FT                   /note="identified by similarity to GP:5739312"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74207"
FT                   /db_xref="GOA:A0A0H2UMS0"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMS0"
FT                   /protein_id="AAK74207.1"
FT   gene            15023..15094
FT                   /locus_tag="SP_2242"
FT   tRNA            15023..15094
FT                   /locus_tag="SP_2242"
FT                   /product="tRNA-Glu"
FT   gene            16945..17017
FT                   /locus_tag="SP_2243"
FT   tRNA            16945..17017
FT                   /locus_tag="SP_2243"
FT                   /product="tRNA-Ala"
FT   gene            20241..20314
FT                   /locus_tag="SP_2244"
FT   tRNA            20241..20314
FT                   /locus_tag="SP_2244"
FT                   /product="tRNA-Asn"
FT   gene            20404..20820
FT                   /locus_tag="SP_0015"
FT   CDS_pept        20404..20820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0015"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /note="identified by similarity to GP:4200438; match to
FT                   protein family HMM PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74208"
FT                   /db_xref="GOA:A0A0H2UMS1"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMS1"
FT                   /protein_id="AAK74208.1"
FT   gene            20929..21267
FT                   /locus_tag="SP_0016"
FT   CDS_pept        20929..21267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0016"
FT                   /product="IS630-Spn1, transposase Orf2"
FT                   /note="identified by similarity to GP:5019553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74209"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2URS2"
FT                   /protein_id="AAK74209.1"
FT                   FLSCSCFN"
FT   gene            complement(21302..22048)
FT                   /pseudo
FT                   /locus_tag="SP_0017"
FT                   /note="IS1167, transposase, degenerate; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by similarity to GP:2804700"
FT   gene            22359..22601
FT                   /locus_tag="SP_0018"
FT   CDS_pept        22359..22601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMV1"
FT                   /protein_id="AAK74210.1"
FT   gene            22832..24118
FT                   /gene="purA"
FT                   /locus_tag="SP_0019"
FT   CDS_pept        22832..24118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SP_0019"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74211"
FT                   /db_xref="GOA:P65887"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65887"
FT                   /protein_id="AAK74211.1"
FT   gene            24319..24786
FT                   /locus_tag="SP_0020"
FT   CDS_pept        24319..24786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0020"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74212"
FT                   /db_xref="GOA:A0A0H2UMZ1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ1"
FT                   /protein_id="AAK74212.1"
FT   gene            24973..25416
FT                   /locus_tag="SP_0021"
FT   CDS_pept        24973..25416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0021"
FT                   /product="putative deoxyuridine 5'triphosphate
FT                   nucleotidohydrolase"
FT                   /note="identified by similarity to EGAD:16349; match to
FT                   protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74213"
FT                   /db_xref="GOA:A0A0H2UMS4"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMS4"
FT                   /protein_id="AAK74213.1"
FT   gene            25418..25933
FT                   /locus_tag="SP_0022"
FT   CDS_pept        25418..25933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6453629; match to
FT                   protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74214"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMS6"
FT                   /protein_id="AAK74214.1"
FT                   VIECELEI"
FT   gene            25917..27308
FT                   /pseudo
FT                   /gene="radA"
FT                   /locus_tag="SP_0023"
FT                   /note="DNA repair protein RadA, authentic point mutation;
FT                   this gene contains a premature stop which is not the result
FT                   of sequencing error"
FT   gene            27381..27878
FT                   /locus_tag="SP_0024"
FT   CDS_pept        27381..27878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5689965; match to
FT                   protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74215"
FT                   /db_xref="GOA:A0A0H2UMS5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMS5"
FT                   /protein_id="AAK74215.1"
FT                   EL"
FT   gene            27903..28112
FT                   /locus_tag="SP_0025"
FT   CDS_pept        27903..28112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74216"
FT                   /db_xref="GOA:A0A0H2UMV6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMV6"
FT                   /protein_id="AAK74216.1"
FT   gene            28094..28717
FT                   /locus_tag="SP_0026"
FT   CDS_pept        28094..28717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74217"
FT                   /db_xref="GOA:A0A0H2UMZ6"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ6"
FT                   /protein_id="AAK74217.1"
FT   gene            28862..29830
FT                   /gene="prsA-1"
FT                   /locus_tag="SP_0027"
FT   CDS_pept        28862..29830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA-1"
FT                   /locus_tag="SP_0027"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74218"
FT                   /db_xref="GOA:P65239"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65239"
FT                   /protein_id="AAK74218.1"
FT   gene            complement(29964..30245)
FT                   /pseudo
FT                   /locus_tag="SP_0028"
FT                   /note="IS1167, transposase, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated;
FT                   identified by similarity to GP:2804700"
FT   gene            complement(30372..30605)
FT                   /locus_tag="SP_0029"
FT   CDS_pept        complement(30372..30605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74219"
FT                   /db_xref="GOA:A0A0H2UMS9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMS9"
FT                   /protein_id="AAK74219.1"
FT   gene            complement(30563..30889)
FT                   /gene="ccs16"
FT                   /locus_tag="SP_0030"
FT   CDS_pept        complement(30563..30889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccs16"
FT                   /locus_tag="SP_0030"
FT                   /product="competence-induced protein Ccs16"
FT                   /note="identified by similarity to GP:1469653"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMT1"
FT                   /protein_id="AAK74220.1"
FT                   NKSC"
FT   gene            complement(30929..31243)
FT                   /locus_tag="SP_0031"
FT   CDS_pept        complement(30929..31243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74221"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMT0"
FT                   /protein_id="AAK74221.1"
FT                   "
FT   gene            31535..34168
FT                   /gene="polA"
FT                   /locus_tag="SP_0032"
FT   CDS_pept        31535..34168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="SP_0032"
FT                   /product="DNA polymerase I"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:14065; match to
FT                   protein family HMM PF00476; match to protein family HMM
FT                   PF01367; match to protein family HMM PF02739; match to
FT                   protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74222"
FT                   /db_xref="GOA:P59199"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59199"
FT                   /protein_id="AAK74222.1"
FT                   TWYEAK"
FT   gene            34253..34690
FT                   /locus_tag="SP_0033"
FT   CDS_pept        34253..34690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:109076; match to
FT                   protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74223"
FT                   /db_xref="GOA:A0A0H2UMW1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMW1"
FT                   /protein_id="AAK74223.1"
FT   gene            complement(35009..36019)
FT                   /locus_tag="SP_0034"
FT   CDS_pept        complement(35009..36019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0034"
FT                   /product="membrane protein"
FT                   /note="identified by similarity to GP:6968434; match to
FT                   protein family HMM PF03601"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74224"
FT                   /db_xref="GOA:Q97TA9"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TA9"
FT                   /protein_id="AAK74224.1"
FT   gene            36168..37337
FT                   /gene="araT"
FT                   /locus_tag="SP_0035"
FT   CDS_pept        36168..37337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araT"
FT                   /locus_tag="SP_0035"
FT                   /product="aromatic amino acid aminotransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:6318592; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74225"
FT                   /db_xref="GOA:A0A0H2UN02"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN02"
FT                   /protein_id="AAK74225.1"
FT   gene            37334..38104
FT                   /locus_tag="SP_0036"
FT   CDS_pept        37334..38104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:30686; match to
FT                   protein family HMM PF02565; match to protein family HMM
FT                   TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74226"
FT                   /db_xref="GOA:Q97TA7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TA7"
FT                   /protein_id="AAK74226.1"
FT   gene            38101..39093
FT                   /gene="plsX"
FT                   /locus_tag="SP_0037"
FT   CDS_pept        38101..39093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SP_0037"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74227"
FT                   /db_xref="GOA:Q97TA6"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TA6"
FT                   /protein_id="AAK74227.1"
FT   gene            39099..39332
FT                   /locus_tag="SP_0038"
FT   CDS_pept        39099..39332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0038"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74228"
FT                   /db_xref="GOA:A0A0H2UMT4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMT4"
FT                   /protein_id="AAK74228.1"
FT   gene            39375..39668
FT                   /locus_tag="SP_0039"
FT   CDS_pept        39375..39668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0039"
FT                   /product="IS1381, transposase OrfB, truncation"
FT                   /note="identified by similarity to EGAD:33136"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75803"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XFI0"
FT                   /protein_id="ABC75803.1"
FT   gene            complement(39716..39841)
FT                   /locus_tag="SP_0040"
FT   CDS_pept        complement(39716..39841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0040"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMT6"
FT                   /protein_id="AAK74229.1"
FT   gene            39871..40101
FT                   /gene="blpU"
FT                   /locus_tag="SP_0041"
FT   CDS_pept        39871..40101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpU"
FT                   /locus_tag="SP_0041"
FT                   /product="bacteriocin BlpU"
FT                   /note="identified by similarity to GP:9798576; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74230"
FT                   /db_xref="GOA:A0A0H2UMT5"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMT5"
FT                   /protein_id="AAK74230.1"
FT   gene            40816..42969
FT                   /gene="comA"
FT                   /locus_tag="SP_0042"
FT   CDS_pept        40816..42969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="SP_0042"
FT                   /product="competence factor transporting
FT                   ATP-binding/permease protein ComA"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01193"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74231"
FT                   /db_xref="GOA:Q03727"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03727"
FT                   /protein_id="AAK74231.1"
FT   gene            42982..44331
FT                   /gene="comB"
FT                   /locus_tag="SP_0043"
FT   CDS_pept        42982..44331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comB"
FT                   /locus_tag="SP_0043"
FT                   /product="competence factor transport protein ComB"
FT                   /note="identified by similarity to EGAD:42454; match to
FT                   protein family HMM TIGR01000"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74232"
FT                   /db_xref="GOA:P36498"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36498"
FT                   /protein_id="AAK74232.1"
FT   gene            44501..45208
FT                   /gene="purC"
FT                   /locus_tag="SP_0044"
FT   CDS_pept        44501..45208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SP_0044"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74233"
FT                   /db_xref="GOA:Q07296"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="PDB:4FE2"
FT                   /db_xref="PDB:4FGR"
FT                   /db_xref="PDB:4NYE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07296"
FT                   /protein_id="AAK74233.1"
FT                   VYEIVWEKLQELK"
FT   gene            45410..49135
FT                   /locus_tag="SP_0045"
FT   CDS_pept        45410..49135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0045"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase"
FT                   /note="identified by similarity to EGAD:18021; match to
FT                   protein family HMM PF02769; match to protein family HMM
FT                   TIGR01857"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74234"
FT                   /db_xref="GOA:A0A0H2UMW6"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMW6"
FT                   /protein_id="AAK74234.1"
FT                   KDQHLFASAVKHFTGK"
FT   gene            49228..50670
FT                   /gene="purF"
FT                   /locus_tag="SP_0046"
FT   CDS_pept        49228..50670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SP_0046"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:7984; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   PF00310; match to protein family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74235"
FT                   /db_xref="GOA:A0A0H2UN09"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN09"
FT                   /protein_id="AAK74235.1"
FT   gene            50889..51911
FT                   /gene="purM"
FT                   /locus_tag="SP_0047"
FT   CDS_pept        50889..51911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SP_0047"
FT                   /product="phosphoribosylformylglycinamide cyclo-ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74236"
FT                   /db_xref="GOA:Q97TA2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TA2"
FT                   /protein_id="AAK74236.1"
FT                   "
FT   gene            51908..52453
FT                   /gene="purN"
FT                   /locus_tag="SP_0048"
FT   CDS_pept        51908..52453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SP_0048"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:18449; match to
FT                   protein family HMM PF00551; match to protein family HMM
FT                   TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74237"
FT                   /db_xref="GOA:A0A0H2UMT9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMT9"
FT                   /protein_id="AAK74237.1"
FT                   HEAEYRLYPEVVKALFTD"
FT   gene            52537..53046
FT                   /locus_tag="SP_0049"
FT   CDS_pept        52537..53046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0049"
FT                   /product="putative vanZ protein"
FT                   /note="identified by similarity to GP:6448500; match to
FT                   protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74238"
FT                   /db_xref="GOA:A0A0H2UMU1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMU1"
FT                   /protein_id="AAK74238.1"
FT                   LHLLSV"
FT   gene            53071..54618
FT                   /gene="purH"
FT                   /locus_tag="SP_0050"
FT   CDS_pept        53071..54618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SP_0050"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74239"
FT                   /db_xref="GOA:Q97T99"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T99"
FT                   /protein_id="AAK74239.1"
FT   gene            54740..56002
FT                   /gene="purD"
FT                   /locus_tag="SP_0051"
FT   CDS_pept        54740..56002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SP_0051"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q9ZF44; match to
FT                   protein family HMM PF01071; match to protein family HMM
FT                   PF02842; match to protein family HMM PF02843; match to
FT                   protein family HMM PF02844; match to protein family HMM
FT                   TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74240"
FT                   /db_xref="GOA:Q97T98"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T98"
FT                   /protein_id="AAK74240.1"
FT   gene            56259..56375
FT                   /locus_tag="SP_0052"
FT   CDS_pept        56259..56375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74241"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMU2"
FT                   /protein_id="AAK74241.1"
FT   gene            56405..56893
FT                   /gene="purE"
FT                   /locus_tag="SP_0053"
FT   CDS_pept        56405..56893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SP_0053"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:19627; match to
FT                   protein family HMM PF00731; match to protein family HMM
FT                   TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74242"
FT                   /db_xref="GOA:A0A0H2UMX2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMX2"
FT                   /protein_id="AAK74242.1"
FT   gene            56880..57971
FT                   /gene="purK"
FT                   /locus_tag="SP_0054"
FT   CDS_pept        56880..57971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SP_0054"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:12560; match to
FT                   protein family HMM PF02222; match to protein family HMM
FT                   TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74243"
FT                   /db_xref="GOA:A0A0H2UN14"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN14"
FT                   /protein_id="AAK74243.1"
FT   gene            57981..58208
FT                   /locus_tag="SP_0055"
FT   CDS_pept        57981..58208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0055"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74244"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMU5"
FT                   /protein_id="AAK74244.1"
FT   gene            58271..59569
FT                   /gene="purB"
FT                   /locus_tag="SP_0056"
FT   CDS_pept        58271..59569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SP_0056"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74245"
FT                   /db_xref="GOA:A0A0H2UMU6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMU6"
FT                   /protein_id="AAK74245.1"
FT   gene            complement(59624..63562)
FT                   /gene="strH"
FT                   /locus_tag="SP_0057"
FT   CDS_pept        complement(59624..63562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="strH"
FT                   /locus_tag="SP_0057"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:31948; match to
FT                   protein family HMM PF00728; match to protein family HMM
FT                   PF00746; match to protein family HMM PF04650; match to
FT                   protein family HMM PF07501; match to protein family HMM
FT                   TIGR01167; match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74246"
FT                   /db_xref="GOA:P49610"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="PDB:2LTJ"
FT                   /db_xref="PDB:2YL5"
FT                   /db_xref="PDB:2YL6"
FT                   /db_xref="PDB:2YL8"
FT                   /db_xref="PDB:2YL9"
FT                   /db_xref="PDB:2YLA"
FT                   /db_xref="PDB:2YLL"
FT                   /db_xref="PDB:4AZ5"
FT                   /db_xref="PDB:4AZ6"
FT                   /db_xref="PDB:4AZ7"
FT                   /db_xref="PDB:4AZB"
FT                   /db_xref="PDB:4AZC"
FT                   /db_xref="PDB:4AZG"
FT                   /db_xref="PDB:4AZH"
FT                   /db_xref="PDB:4AZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49610"
FT                   /protein_id="AAK74246.1"
FT   gene            complement(63890..64606)
FT                   /locus_tag="SP_0058"
FT   CDS_pept        complement(63890..64606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0058"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74247"
FT                   /db_xref="GOA:A0A0H2UMU7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMU7"
FT                   /protein_id="AAK74247.1"
FT                   RSDYYKIKFISCDRDH"
FT   gene            64593..64694
FT                   /locus_tag="SP_0059"
FT   CDS_pept        64593..64694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMX8"
FT                   /protein_id="AAK74248.1"
FT   gene            64955..66742
FT                   /locus_tag="SP_0060"
FT   CDS_pept        64955..66742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0060"
FT                   /product="glycosyl hydrolase, family 35"
FT                   /note="identified by similarity to EGAD:31916; match to
FT                   protein family HMM PF01301"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74249"
FT                   /db_xref="GOA:A0A0H2UN19"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026283"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="PDB:4E8C"
FT                   /db_xref="PDB:4E8D"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN19"
FT                   /protein_id="AAK74249.1"
FT   gene            66739..67215
FT                   /locus_tag="SP_0061"
FT   CDS_pept        66739..67215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0061"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by similarity to EGAD:9092; match to
FT                   protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74250"
FT                   /db_xref="GOA:A0A0H2UMU8"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMU8"
FT                   /protein_id="AAK74250.1"
FT   gene            67243..68148
FT                   /locus_tag="SP_0062"
FT   CDS_pept        67243..68148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0062"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by similarity to EGAD:14386; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74251"
FT                   /db_xref="GOA:A0A0H2UMV0"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMV0"
FT                   /protein_id="AAK74251.1"
FT   gene            68135..68950
FT                   /locus_tag="SP_0063"
FT   CDS_pept        68135..68950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0063"
FT                   /product="PTS system, IID component"
FT                   /note="identified by similarity to EGAD:91568; match to
FT                   protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74252"
FT                   /db_xref="GOA:A0A0H2UMV3"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMV3"
FT                   /protein_id="AAK74252.1"
FT   gene            68957..69361
FT                   /locus_tag="SP_0064"
FT   CDS_pept        68957..69361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0064"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by similarity to EGAD:7066; match to
FT                   protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74253"
FT                   /db_xref="GOA:A0A0H2UMY3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY3"
FT                   /protein_id="AAK74253.1"
FT   gene            69660..70826
FT                   /gene="agaS"
FT                   /locus_tag="SP_0065"
FT   CDS_pept        69660..70826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SP_0065"
FT                   /product="sugar isomerase domain protein AgaS"
FT                   /note="identified by similarity to EGAD:30961; match to
FT                   protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74254"
FT                   /db_xref="GOA:A0A0H2UN25"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="PDB:3I0Z"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN25"
FT                   /protein_id="AAK74254.1"
FT   gene            70942..71979
FT                   /gene="galM"
FT                   /locus_tag="SP_0066"
FT   CDS_pept        70942..71979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="SP_0066"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:7416; match to
FT                   protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74255"
FT                   /db_xref="GOA:A0A0H2UMV2"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMV2"
FT                   /protein_id="AAK74255.1"
FT                   ELVVK"
FT   gene            72141..72401
FT                   /locus_tag="SP_0067"
FT   CDS_pept        72141..72401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74256"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMV5"
FT                   /protein_id="AAK74256.1"
FT   gene            72456..72653
FT                   /locus_tag="SP_0068"
FT   CDS_pept        72456..72653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMV7"
FT                   /protein_id="AAK74257.1"
FT   gene            72674..73309
FT                   /gene="cbpI"
FT                   /locus_tag="SP_0069"
FT   CDS_pept        72674..73309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpI"
FT                   /locus_tag="SP_0069"
FT                   /product="choline binding protein I"
FT                   /note="identified by similarity to GP:9454356; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74258"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY8"
FT                   /protein_id="AAK74258.1"
FT   gene            73353..73454
FT                   /locus_tag="SP_0070"
FT   CDS_pept        73353..73454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN30"
FT                   /protein_id="AAK74259.1"
FT   gene            73761..79331
FT                   /gene="zmpC"
FT                   /locus_tag="SP_0071"
FT   CDS_pept        73761..79331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpC"
FT                   /locus_tag="SP_0071"
FT                   /product="zinc metalloprotease ZmpC"
FT                   /note="identified by similarity to GP:1870145; match to
FT                   protein family HMM PF04650; match to protein family HMM
FT                   PF05342; match to protein family HMM PF07501; match to
FT                   protein family HMM PF07580; match to protein family HMM
FT                   PF07581; match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74260"
FT                   /db_xref="GOA:Q97T80"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008006"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR011505"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T80"
FT                   /protein_id="AAK74260.1"
FT   gene            79434..79547
FT                   /locus_tag="SP_0072"
FT   CDS_pept        79434..79547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMV9"
FT                   /protein_id="AAK74261.1"
FT   gene            79687..80541
FT                   /locus_tag="SP_0073"
FT   CDS_pept        79687..80541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:45930; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74262"
FT                   /db_xref="GOA:A0A0H2UMW0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMW0"
FT                   /protein_id="AAK74262.1"
FT                   LAR"
FT   gene            80647..81204
FT                   /locus_tag="SP_0074"
FT   CDS_pept        80647..81204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0074"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="identified by similarity to SP:P77791"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74263"
FT                   /db_xref="GOA:A0A0H2UMW3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMW3"
FT                   /protein_id="AAK74263.1"
FT   gene            81481..82185
FT                   /locus_tag="SP_0075"
FT   CDS_pept        81481..82185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0075"
FT                   /product="phosphorylase, Pnp/Udp family"
FT                   /note="identified by match to protein family HMM PF01048"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74264"
FT                   /db_xref="GOA:A0A0H2UMZ4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ4"
FT                   /protein_id="AAK74264.1"
FT                   ALELSLASVHHL"
FT   gene            complement(82590..82682)
FT                   /locus_tag="SP_0076"
FT   CDS_pept        complement(82590..82682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN35"
FT                   /protein_id="AAK74265.1"
FT                   /translation="MIDVTIGQKSKTGAFNASYSICFSGENFSF"
FT   gene            82659..82817
FT                   /locus_tag="SP_0077"
FT   CDS_pept        82659..82817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74266"
FT                   /db_xref="GOA:A0A0H2UMW4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMW4"
FT                   /protein_id="AAK74266.1"
FT                   KHVIQII"
FT   gene            82798..84177
FT                   /locus_tag="SP_0078"
FT   CDS_pept        82798..84177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0078"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74267"
FT                   /db_xref="GOA:A0A0H2UMW5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMW5"
FT                   /protein_id="AAK74267.1"
FT                   G"
FT   gene            84191..84856
FT                   /locus_tag="SP_0079"
FT   CDS_pept        84191..84856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0079"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74268"
FT                   /db_xref="GOA:A0A0H2UMX0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMX0"
FT                   /protein_id="AAK74268.1"
FT   gene            84877..84984
FT                   /locus_tag="SP_0080"
FT   CDS_pept        84877..84984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ9"
FT                   /protein_id="AAK74269.1"
FT   gene            85166..86182
FT                   /pseudo
FT                   /locus_tag="SP_0081"
FT                   /note="glycosyl transferase, family 2, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:3550634"
FT   gene            86298..88871
FT                   /locus_tag="SP_0082"
FT   CDS_pept        86298..88871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0082"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74270"
FT                   /db_xref="GOA:A0A0H2UN40"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR021021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN40"
FT                   /protein_id="AAK74270.1"
FT   gene            89038..89736
FT                   /locus_tag="SP_0083"
FT   CDS_pept        89038..89736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0083"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74271"
FT                   /db_xref="GOA:A0A0H2UMW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMW8"
FT                   /protein_id="AAK74271.1"
FT                   YKIEKPRGQT"
FT   gene            89733..90785
FT                   /locus_tag="SP_0084"
FT   CDS_pept        89733..90785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0084"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74272"
FT                   /db_xref="GOA:A0A0H2UMW9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMW9"
FT                   /protein_id="AAK74272.1"
FT                   LNLSGSENKA"
FT   gene            90980..91591
FT                   /gene="rpsD"
FT                   /locus_tag="SP_0085"
FT   CDS_pept        90980..91591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="SP_0085"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by similarity to EGAD:13606; match to
FT                   protein family HMM PF00163; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74273"
FT                   /db_xref="GOA:P66565"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66565"
FT                   /protein_id="AAK74273.1"
FT   gene            91751..91927
FT                   /locus_tag="SP_0086"
FT   CDS_pept        91751..91927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0086"
FT                   /product="IS630-Spn1, transposase Orf1, truncation"
FT                   /note="identified by similarity to GP:5019554"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75794"
FT                   /db_xref="GOA:A0A0H2XDU8"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XDU8"
FT                   /protein_id="ABC75794.1"
FT                   KLKEKTGELNHQV"
FT   gene            complement(92025..92165)
FT                   /locus_tag="SP_0087"
FT   CDS_pept        complement(92025..92165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74274"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMX5"
FT                   /protein_id="AAK74274.1"
FT                   L"
FT   gene            92236..92505
FT                   /locus_tag="SP_0088"
FT   CDS_pept        92236..92505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN04"
FT                   /protein_id="AAK74275.1"
FT   gene            92585..92680
FT                   /locus_tag="SP_0089"
FT   CDS_pept        92585..92680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74276"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN45"
FT                   /protein_id="AAK74276.1"
FT                   /translation="MFLADEKGSEHTAAELIDNLKEVIAKLKANA"
FT   gene            92969..93928
FT                   /locus_tag="SP_0090"
FT   CDS_pept        92969..93928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0090"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by similarity to GP:9501759; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74277"
FT                   /db_xref="GOA:A0A0H2UMX3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMX3"
FT                   /protein_id="AAK74277.1"
FT   gene            93942..94865
FT                   /locus_tag="SP_0091"
FT   CDS_pept        93942..94865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0091"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:45710; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74278"
FT                   /db_xref="GOA:A0A0H2UMX4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMX4"
FT                   /protein_id="AAK74278.1"
FT   gene            95123..96598
FT                   /locus_tag="SP_0092"
FT   CDS_pept        95123..96598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0092"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74279"
FT                   /db_xref="GOA:A0A0H2UMY0"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="PDB:5MLT"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY0"
FT                   /protein_id="AAK74279.1"
FT   gene            complement(96628..96741)
FT                   /locus_tag="SP_0093"
FT   CDS_pept        complement(96628..96741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN10"
FT                   /protein_id="AAK74280.1"
FT   gene            96713..96820
FT                   /locus_tag="SP_0094"
FT   CDS_pept        96713..96820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74281"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN50"
FT                   /protein_id="AAK74281.1"
FT   gene            96870..97856
FT                   /locus_tag="SP_0095"
FT   CDS_pept        96870..97856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74282"
FT                   /db_xref="GOA:P67330"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67330"
FT                   /protein_id="AAK74282.1"
FT   gene            98131..98991
FT                   /locus_tag="SP_0096"
FT   CDS_pept        98131..98991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0096"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74283"
FT                   /db_xref="InterPro:IPR025387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMX7"
FT                   /protein_id="AAK74283.1"
FT                   LAQEK"
FT   gene            complement(99169..100233)
FT                   /locus_tag="SP_0097"
FT   CDS_pept        complement(99169..100233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0097"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:8953759"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74284"
FT                   /db_xref="GOA:A0A0H2UMX9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMX9"
FT                   /protein_id="AAK74284.1"
FT                   VALIGDYLRILAFL"
FT   gene            complement(100296..101207)
FT                   /locus_tag="SP_0098"
FT   CDS_pept        complement(100296..101207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0098"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74285"
FT                   /db_xref="GOA:A0A0H2UMY5"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY5"
FT                   /protein_id="AAK74285.1"
FT   gene            complement(101200..101793)
FT                   /locus_tag="SP_0099"
FT   CDS_pept        complement(101200..101793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74286"
FT                   /db_xref="GOA:A0A0H2UN16"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN16"
FT                   /protein_id="AAK74286.1"
FT   gene            complement(101780..102106)
FT                   /locus_tag="SP_0100"
FT   CDS_pept        complement(101780..102106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:173361; match to
FT                   protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74287"
FT                   /db_xref="GOA:A0A0H2UN55"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN55"
FT                   /protein_id="AAK74287.1"
FT                   HDKN"
FT   gene            complement(102245..103411)
FT                   /locus_tag="SP_0101"
FT   CDS_pept        complement(102245..103411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0101"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74288"
FT                   /db_xref="GOA:A0A0H2UMY2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY2"
FT                   /protein_id="AAK74288.1"
FT   gene            103562..104626
FT                   /locus_tag="SP_0102"
FT   CDS_pept        103562..104626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0102"
FT                   /product="glycosyl transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74289"
FT                   /db_xref="GOA:A0A0H2UMY4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY4"
FT                   /protein_id="AAK74289.1"
FT                   IYLDKISQINQNML"
FT   gene            104668..106518
FT                   /locus_tag="SP_0103"
FT   CDS_pept        104668..106518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0103"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein"
FT                   /note="identified by similarity to GP:6601348; match to
FT                   protein family HMM PF02719; match to protein family HMM
FT                   PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74290"
FT                   /db_xref="GOA:A0A0H2UMZ0"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ0"
FT                   /protein_id="AAK74290.1"
FT   gene            complement(106956..107588)
FT                   /locus_tag="SP_0104"
FT   CDS_pept        complement(106956..107588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0104"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74291"
FT                   /db_xref="GOA:A0A0H2UN22"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="PDB:2AH5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN22"
FT                   /protein_id="AAK74291.1"
FT   gene            complement(107610..108482)
FT                   /gene="sdhA"
FT                   /locus_tag="SP_0105"
FT   CDS_pept        complement(107610..108482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="SP_0105"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:154938; match to
FT                   protein family HMM PF03313; match to protein family HMM
FT                   TIGR00718"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74292"
FT                   /db_xref="GOA:A0A0H2UN60"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN60"
FT                   /protein_id="AAK74292.1"
FT                   RLQKEIFGE"
FT   gene            complement(108491..109162)
FT                   /gene="sdhB"
FT                   /locus_tag="SP_0106"
FT   CDS_pept        complement(108491..109162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="SP_0106"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00719"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74293"
FT                   /db_xref="GOA:A0A0H2UMY7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY7"
FT                   /protein_id="AAK74293.1"
FT                   K"
FT   gene            109404..109991
FT                   /locus_tag="SP_0107"
FT   CDS_pept        109404..109991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0107"
FT                   /product="LysM domain protein"
FT                   /note="identified by similarity to EGAD:154417; match to
FT                   protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74294"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMY9"
FT                   /protein_id="AAK74294.1"
FT   gene            complement(110043..110363)
FT                   /locus_tag="SP_0108"
FT   CDS_pept        complement(110043..110363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ5"
FT                   /protein_id="AAK74295.1"
FT                   ER"
FT   gene            110794..111081
FT                   /locus_tag="SP_0109"
FT   CDS_pept        110794..111081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0109"
FT                   /product="putative bacteriocin"
FT                   /note="identified by similarity to GP:3355782; match to
FT                   protein family HMM TIGR01653"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74296"
FT                   /db_xref="InterPro:IPR006540"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN27"
FT                   /protein_id="AAK74296.1"
FT   gene            111157..113241
FT                   /locus_tag="SP_0110"
FT   CDS_pept        111157..113241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74297"
FT                   /db_xref="GOA:A0A0H2UN66"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN66"
FT                   /protein_id="AAK74297.1"
FT                   "
FT   gene            113238..113879
FT                   /locus_tag="SP_0111"
FT   CDS_pept        113238..113879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0111"
FT                   /product="putative amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to EGAD:6883; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74298"
FT                   /db_xref="GOA:A0A0H2UMZ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ2"
FT                   /protein_id="AAK74298.1"
FT   gene            114086..114892
FT                   /locus_tag="SP_0112"
FT   CDS_pept        114086..114892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0112"
FT                   /product="putative amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="identified by similarity to EGAD:91736; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74299"
FT                   /db_xref="GOA:A0A0H2UMZ3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ3"
FT                   /protein_id="AAK74299.1"
FT   gene            114909..115328
FT                   /gene="argG"
FT                   /locus_tag="SP_0113"
FT   CDS_pept        114909..115328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SP_0113"
FT                   /product="argininosuccinate synthase, truncation"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:SP_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75801"
FT                   /db_xref="GOA:A0A0H2XDC4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XDC4"
FT                   /protein_id="ABC75801.1"
FT   gene            complement(115515..115835)
FT                   /locus_tag="SP_0114"
FT   CDS_pept        complement(115515..115835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN00"
FT                   /protein_id="AAK74300.1"
FT                   KL"
FT   gene            116593..116973
FT                   /locus_tag="SP_0115"
FT   CDS_pept        116593..116973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN32"
FT                   /protein_id="AAK74301.1"
FT   gene            117625..117870
FT                   /locus_tag="SP_0116"
FT   CDS_pept        117625..117870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN70"
FT                   /protein_id="AAK74302.1"
FT   gene            118423..120657
FT                   /gene="pspA"
FT                   /locus_tag="SP_0117"
FT   CDS_pept        118423..120657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="SP_0117"
FT                   /product="pneumococcal surface protein A"
FT                   /note="identified by similarity to GP:6752403; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74303"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ8"
FT                   /protein_id="AAK74303.1"
FT   gene            121058..122179
FT                   /gene="trmU"
FT                   /locus_tag="SP_0118"
FT   CDS_pept        121058..122179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="SP_0118"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74304"
FT                   /db_xref="GOA:Q97T38"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="PDB:2HMA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T38"
FT                   /protein_id="AAK74304.1"
FT   gene            122320..122775
FT                   /locus_tag="SP_0119"
FT   CDS_pept        122320..122775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0119"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by similarity to EGAD:16514; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74305"
FT                   /db_xref="GOA:A0A0H2UMZ7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="PDB:2PQV"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UMZ7"
FT                   /protein_id="AAK74305.1"
FT   gene            122785..124698
FT                   /gene="gidA"
FT                   /locus_tag="SP_0120"
FT   CDS_pept        122785..124698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SP_0120"
FT                   /product="glucose-inhibited division protein A"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74306"
FT                   /db_xref="GOA:Q97T36"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T36"
FT                   /protein_id="AAK74306.1"
FT                   SK"
FT   gene            complement(125051..126730)
FT                   /locus_tag="SP_0121"
FT   CDS_pept        complement(125051..126730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0121"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521; match to protein
FT                   family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74307"
FT                   /db_xref="GOA:A0A0H2UN05"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN05"
FT                   /protein_id="AAK74307.1"
FT   gene            complement(126732..126965)
FT                   /locus_tag="SP_0122"
FT   CDS_pept        complement(126732..126965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107894; match to
FT                   protein family HMM PF07288"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74308"
FT                   /db_xref="GOA:Q97T34"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T34"
FT                   /protein_id="AAK74308.1"
FT   gene            complement(127291..127536)
FT                   /gene="ccs1"
FT                   /locus_tag="SP_0123"
FT   CDS_pept        complement(127291..127536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccs1"
FT                   /locus_tag="SP_0123"
FT                   /product="competence-induced protein Ccs1"
FT                   /note="identified by similarity to EGAD:50614"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN37"
FT                   /protein_id="AAK74309.1"
FT   gene            complement(127783..127935)
FT                   /locus_tag="SP_0124"
FT   CDS_pept        complement(127783..127935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74310"
FT                   /db_xref="GOA:A0A0H2UN74"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN74"
FT                   /protein_id="AAK74310.1"
FT                   FGKSC"
FT   gene            complement(127937..128122)
FT                   /locus_tag="SP_0125"
FT   CDS_pept        complement(127937..128122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74311"
FT                   /db_xref="GOA:A0A0H2UN03"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN03"
FT                   /protein_id="AAK74311.1"
FT                   ALIGSGLAAGYFLGGD"
FT   gene            128097..128204
FT                   /locus_tag="SP_0126"
FT   CDS_pept        128097..128204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN01"
FT                   /protein_id="AAK74312.1"
FT   gene            128300..128983
FT                   /locus_tag="SP_0127"
FT   CDS_pept        128300..128983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3341437; match to
FT                   protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74313"
FT                   /db_xref="GOA:A0A0H2UN08"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN08"
FT                   /protein_id="AAK74313.1"
FT                   YIKRL"
FT   gene            128980..129417
FT                   /locus_tag="SP_0128"
FT   CDS_pept        128980..129417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0128"
FT                   /product="putative ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74314"
FT                   /db_xref="GOA:A0A0H2UN42"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN42"
FT                   /protein_id="AAK74314.1"
FT   gene            129407..130417
FT                   /locus_tag="SP_0129"
FT   CDS_pept        129407..130417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0129"
FT                   /product="glycoprotease family protein"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74315"
FT                   /db_xref="GOA:Q97T27"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T27"
FT                   /protein_id="AAK74315.1"
FT   gene            complement(130250..131763)
FT                   /pseudo
FT                   /locus_tag="SP_0130"
FT                   /note="Missing the proper stop codon.; IS1167, transposase,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:2804700"
FT   gene            complement(132039..132390)
FT                   /pseudo
FT                   /locus_tag="SP_0131"
FT                   /note="IS630-Spn1, transposase Orf2, degenerate; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:5019553"
FT   gene            complement(132603..132790)
FT                   /pseudo
FT                   /locus_tag="SP_0132"
FT                   /note="IS630-Spn1, transposase Orf1, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to GP:4200438"
FT   gene            133024..133587
FT                   /locus_tag="SP_0133"
FT   CDS_pept        133024..133587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74316"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN79"
FT                   /protein_id="AAK74316.1"
FT   gene            133565..133771
FT                   /locus_tag="SP_0134"
FT   CDS_pept        133565..133771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN07"
FT                   /protein_id="AAK74317.1"
FT   gene            133795..134238
FT                   /locus_tag="SP_0135"
FT   CDS_pept        133795..134238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0135"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74318"
FT                   /db_xref="GOA:A0A0H2UN06"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN06"
FT                   /protein_id="AAK74318.1"
FT   gene            134231..135106
FT                   /locus_tag="SP_0136"
FT   CDS_pept        134231..135106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0136"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74319"
FT                   /db_xref="GOA:A0A0H2UN13"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN13"
FT                   /protein_id="AAK74319.1"
FT                   EEKIFNEFLF"
FT   gene            135193..136809
FT                   /locus_tag="SP_0137"
FT   CDS_pept        135193..136809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0137"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74320"
FT                   /db_xref="GOA:A0A0H2UN47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN47"
FT                   /protein_id="AAK74320.1"
FT   gene            137031..137498
FT                   /locus_tag="SP_0138"
FT   CDS_pept        137031..137498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN83"
FT                   /protein_id="AAK74321.1"
FT   gene            137504..138259
FT                   /locus_tag="SP_0139"
FT   CDS_pept        137504..138259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0139"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:4689219; match to
FT                   protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74322"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN12"
FT                   /protein_id="AAK74322.1"
FT   gene            138272..139443
FT                   /pseudo
FT                   /gene="ugd"
FT                   /locus_tag="SP_0140"
FT                   /note="UDP-glucose 6-dehydrogenase, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:7319"
FT   gene            139839..140702
FT                   /locus_tag="SP_0141"
FT   CDS_pept        139839..140702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0141"
FT                   /product="transcriptional regulator"
FT                   /note="identified by similarity to GP:4102023; match to
FT                   protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74323"
FT                   /db_xref="GOA:A0A0H2UN11"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN11"
FT                   /protein_id="AAK74323.1"
FT                   YKELID"
FT   gene            140988..141221
FT                   /locus_tag="SP_0142"
FT   CDS_pept        140988..141221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0142"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN18"
FT                   /protein_id="AAK74324.1"
FT   gene            141243..141920
FT                   /locus_tag="SP_0143"
FT   CDS_pept        141243..141920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0143"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:107498; match to
FT                   protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74325"
FT                   /db_xref="GOA:A0A0H2UN53"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN53"
FT                   /protein_id="AAK74325.1"
FT                   FGY"
FT   gene            141932..142597
FT                   /locus_tag="SP_0144"
FT   CDS_pept        141932..142597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0144"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74326"
FT                   /db_xref="GOA:A0A0H2UN88"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN88"
FT                   /protein_id="AAK74326.1"
FT   gene            142669..143895
FT                   /locus_tag="SP_0145"
FT   CDS_pept        142669..143895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3582221; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74327"
FT                   /db_xref="GOA:A0A0H2UN17"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN17"
FT                   /protein_id="AAK74327.1"
FT                   MLLNIRESI"
FT   gene            144440..145096
FT                   /locus_tag="SP_0146"
FT   CDS_pept        144440..145096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:166577; match to
FT                   protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74328"
FT                   /db_xref="GOA:A0A0H2UN15"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN15"
FT                   /protein_id="AAK74328.1"
FT   gene            145086..145295
FT                   /locus_tag="SP_0147"
FT   CDS_pept        145086..145295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74329"
FT                   /db_xref="GOA:A0A0H2UN23"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN23"
FT                   /protein_id="AAK74329.1"
FT   gene            145513..146343
FT                   /locus_tag="SP_0148"
FT   CDS_pept        145513..146343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0148"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74330"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN58"
FT                   /protein_id="AAK74330.1"
FT   gene            146497..147351
FT                   /locus_tag="SP_0149"
FT   CDS_pept        146497..147351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0149"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74331"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN92"
FT                   /protein_id="AAK74331.1"
FT                   PVW"
FT   gene            147451..148824
FT                   /locus_tag="SP_0150"
FT   CDS_pept        147451..148824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0150"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74332"
FT                   /db_xref="GOA:A0A0H2UN21"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="PDB:2POK"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN21"
FT                   /protein_id="AAK74332.1"
FT   gene            148817..149878
FT                   /locus_tag="SP_0151"
FT   CDS_pept        148817..149878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0151"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74333"
FT                   /db_xref="GOA:Q97T09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T09"
FT                   /protein_id="AAK74333.1"
FT                   QAGVQLKVLKGVQ"
FT   gene            149880..150572
FT                   /locus_tag="SP_0152"
FT   CDS_pept        149880..150572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0152"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by similarity to GP:6165406; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74334"
FT                   /db_xref="GOA:A0A0H2UN20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN20"
FT                   /protein_id="AAK74334.1"
FT                   LTKKLSHK"
FT   gene            complement(150602..151171)
FT                   /locus_tag="SP_0153"
FT   CDS_pept        complement(150602..151171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0153"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74335"
FT                   /db_xref="GOA:A0A0H2UN28"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN28"
FT                   /protein_id="AAK74335.1"
FT   gene            151306..151920
FT                   /locus_tag="SP_0154"
FT   CDS_pept        151306..151920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74336"
FT                   /db_xref="GOA:A0A0H2UN63"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN63"
FT                   /protein_id="AAK74336.1"
FT   gene            151922..153568
FT                   /locus_tag="SP_0155"
FT   CDS_pept        151922..153568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0155"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by similarity to GP:5830535; match to
FT                   protein family HMM PF00672; match to protein family HMM
FT                   PF02518; match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74337"
FT                   /db_xref="GOA:A0A0H2UN97"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN97"
FT                   /protein_id="AAK74337.1"
FT   gene            153580..154866
FT                   /locus_tag="SP_0156"
FT   CDS_pept        153580..154866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0156"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74338"
FT                   /db_xref="GOA:A0A0H2UN24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN24"
FT                   /protein_id="AAK74338.1"
FT   gene            154870..155451
FT                   /locus_tag="SP_0157"
FT   CDS_pept        154870..155451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0157"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74339"
FT                   /db_xref="GOA:A0A0H2UN26"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN26"
FT                   /protein_id="AAK74339.1"
FT   gene            155529..155999
FT                   /locus_tag="SP_0158"
FT   CDS_pept        155529..155999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0158"
FT                   /product="NrdI family protein"
FT                   /note="identified by similarity to EGAD:35947; match to
FT                   protein family HMM PF07972"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74340"
FT                   /db_xref="GOA:Q97T03"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T03"
FT                   /protein_id="AAK74340.1"
FT   gene            complement(156292..157554)
FT                   /locus_tag="SP_0159"
FT   CDS_pept        complement(156292..157554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:176641"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74341"
FT                   /db_xref="GOA:A0A0H2UN33"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN33"
FT                   /protein_id="AAK74341.1"
FT   gene            complement(157864..158322)
FT                   /locus_tag="SP_0160"
FT   CDS_pept        complement(157864..158322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0160"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:6690328"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74342"
FT                   /db_xref="GOA:A0A0H2UN69"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN69"
FT                   /protein_id="AAK74342.1"
FT   gene            complement(158319..158759)
FT                   /locus_tag="SP_0161"
FT   CDS_pept        complement(158319..158759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0161"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74343"
FT                   /db_xref="GOA:A0A0H2UNA2"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA2"
FT                   /protein_id="AAK74343.1"
FT   gene            158849..158944
FT                   /locus_tag="SP_0162"
FT   CDS_pept        158849..158944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74344"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN29"
FT                   /protein_id="AAK74344.1"
FT                   /translation="MSMWRDWAPMWWSFSVLSEIWYNSTNQFLGK"
FT   gene            159192..160058
FT                   /locus_tag="SP_0163"
FT   CDS_pept        159192..160058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0163"
FT                   /product="putative transcriptional regulator PlcR"
FT                   /note="identified by similarity to EGAD:37797; match to
FT                   protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74345"
FT                   /db_xref="GOA:A0A0H2UN31"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN31"
FT                   /protein_id="AAK74345.1"
FT                   YIADITE"
FT   gene            160211..160339
FT                   /locus_tag="SP_0164"
FT   CDS_pept        160211..160339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN38"
FT                   /protein_id="AAK74346.1"
FT   gene            160384..160941
FT                   /locus_tag="SP_0165"
FT   CDS_pept        160384..160941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0165"
FT                   /product="flavoprotein"
FT                   /note="identified by similarity to EGAD:10889; match to
FT                   protein family HMM PF02441"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74347"
FT                   /db_xref="GOA:A0A0H2UN75"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN75"
FT                   /protein_id="AAK74347.1"
FT   gene            161162..162268
FT                   /locus_tag="SP_0166"
FT   CDS_pept        161162..162268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0166"
FT                   /product="pyridoxal-dependent decarboxylase, Orn/Lys/Arg
FT                   family"
FT                   /note="identified by match to protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74348"
FT                   /db_xref="GOA:A0A0H2UNA7"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA7"
FT                   /protein_id="AAK74348.1"
FT   gene            162244..163635
FT                   /locus_tag="SP_0167"
FT   CDS_pept        162244..163635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN34"
FT                   /protein_id="AAK74349.1"
FT                   DEVNR"
FT   gene            163632..164810
FT                   /locus_tag="SP_0168"
FT   CDS_pept        163632..164810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0168"
FT                   /product="putative macrolide efflux protein"
FT                   /note="identified by similarity to GP:1800301; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74350"
FT                   /db_xref="GOA:A0A0H2UN36"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN36"
FT                   /protein_id="AAK74350.1"
FT   gene            164991..165128
FT                   /pseudo
FT                   /locus_tag="SP_0169"
FT                   /note="lactose phosphotransferase system repressor,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts which are not the result of
FT                   sequencing error; identified by similarity to EGAD:16295"
FT   gene            165095..165211
FT                   /locus_tag="SP_0170"
FT   CDS_pept        165095..165211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN43"
FT                   /protein_id="AAK74351.1"
FT   gene            165235..165468
FT                   /locus_tag="SP_0171"
FT   CDS_pept        165235..165468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0171"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN80"
FT                   /protein_id="AAK74352.1"
FT   gene            165586..165690
FT                   /locus_tag="SP_0172"
FT   CDS_pept        165586..165690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB2"
FT                   /protein_id="AAK74353.1"
FT   gene            165751..167700
FT                   /gene="hexB"
FT                   /locus_tag="SP_0173"
FT   CDS_pept        165751..167700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hexB"
FT                   /locus_tag="SP_0173"
FT                   /product="DNA mismatch repair protein HexB"
FT                   /note="In low GC gram positive bacteria, this gene is
FT                   generally known as hexB; in other prokaryotes the
FT                   functional equivalent is known as mutL.; identified by
FT                   similarity to EGAD:20800; match to protein family HMM
FT                   PF01119; match to protein family HMM PF02518; match to
FT                   protein family HMM TIGR00585"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74354"
FT                   /db_xref="GOA:P0A3R1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3R1"
FT                   /protein_id="AAK74354.1"
FT                   IQENHTSLRELGKY"
FT   gene            complement(167836..167928)
FT                   /locus_tag="SP_0174"
FT   CDS_pept        complement(167836..167928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74355"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN39"
FT                   /protein_id="AAK74355.1"
FT                   /translation="MVKHNFDVTDKTGKISSKHCFEITDKTDVV"
FT   gene            complement(168025..168492)
FT                   /locus_tag="SP_0175"
FT   CDS_pept        complement(168025..168492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0175"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by similarity to EGAD:18389; match to
FT                   protein family HMM PF00885; match to protein family HMM
FT                   TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74356"
FT                   /db_xref="GOA:P66040"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66040"
FT                   /protein_id="AAK74356.1"
FT   gene            complement(168493..169698)
FT                   /gene="ribAB"
FT                   /locus_tag="SP_0176"
FT   CDS_pept        complement(168493..169698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribAB"
FT                   /locus_tag="SP_0176"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00925;
FT                   match to protein family HMM PF00926; match to protein
FT                   family HMM TIGR00505; match to protein family HMM
FT                   TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74357"
FT                   /db_xref="GOA:A0A0H2UN41"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="PDB:4FFJ"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN41"
FT                   /protein_id="AAK74357.1"
FT                   EK"
FT   gene            complement(169718..170353)
FT                   /gene="ribE"
FT                   /locus_tag="SP_0177"
FT   CDS_pept        complement(169718..170353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="SP_0177"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:14904; match to
FT                   protein family HMM PF00677; match to protein family HMM
FT                   TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74358"
FT                   /db_xref="GOA:A0A0H2UN48"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN48"
FT                   /protein_id="AAK74358.1"
FT   gene            complement(170338..171438)
FT                   /gene="ribD"
FT                   /locus_tag="SP_0178"
FT   CDS_pept        complement(170338..171438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SP_0178"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74359"
FT                   /db_xref="GOA:A0A0H2UN84"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN84"
FT                   /protein_id="AAK74359.1"
FT   gene            171843..172436
FT                   /gene="ruvA"
FT                   /locus_tag="SP_0179"
FT   CDS_pept        171843..172436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SP_0179"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="identified by similarity to EGAD:24056; match to
FT                   protein family HMM PF01330; match to protein family HMM
FT                   PF07499; match to protein family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74360"
FT                   /db_xref="GOA:Q97SY4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SY4"
FT                   /protein_id="AAK74360.1"
FT   gene            172473..173009
FT                   /gene="tag"
FT                   /locus_tag="SP_0180"
FT   CDS_pept        172473..173009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="SP_0180"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:6433; match to
FT                   protein family HMM PF03352"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74361"
FT                   /db_xref="GOA:A0A0H2UNB7"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB7"
FT                   /protein_id="AAK74361.1"
FT                   LVDDHENDCEWKGLK"
FT   gene            173006..173683
FT                   /locus_tag="SP_0181"
FT   CDS_pept        173006..173683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6470197; match to
FT                   protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74362"
FT                   /db_xref="GOA:A0A0H2UN44"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN44"
FT                   /protein_id="AAK74362.1"
FT                   IVK"
FT   gene            complement(173820..174851)
FT                   /locus_tag="SP_0182"
FT   CDS_pept        complement(173820..174851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0182"
FT                   /product="MccC family protein"
FT                   /note="identified by similarity to EGAD:135270; match to
FT                   protein family HMM PF02016"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74363"
FT                   /db_xref="GOA:A0A0H2UN46"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="PDB:4E94"
FT                   /db_xref="PDB:4EYS"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN46"
FT                   /protein_id="AAK74363.1"
FT                   YNK"
FT   gene            complement(175039..175134)
FT                   /locus_tag="SP_0183"
FT   CDS_pept        complement(175039..175134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0183"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74364"
FT                   /db_xref="GOA:A0A0H2UN52"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN52"
FT                   /protein_id="AAK74364.1"
FT                   /translation="MQDQHAIKNKKTIKATAGAVAFSLTFLSYIQ"
FT   gene            complement(175106..175810)
FT                   /locus_tag="SP_0184"
FT   CDS_pept        complement(175106..175810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74365"
FT                   /db_xref="GOA:A0A0H2UN91"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN91"
FT                   /protein_id="AAK74365.1"
FT                   RSASAGPTRYQE"
FT   gene            complement(175801..176745)
FT                   /locus_tag="SP_0185"
FT   CDS_pept        complement(175801..176745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0185"
FT                   /product="magnesium transporter, CorA family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74366"
FT                   /db_xref="GOA:A0A0H2UNC1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC1"
FT                   /protein_id="AAK74366.1"
FT   gene            176877..179708
FT                   /gene="uvrA"
FT                   /locus_tag="SP_0186"
FT   CDS_pept        176877..179708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SP_0186"
FT                   /product="excinuclease ABC, subunit A"
FT                   /note="identified by similarity to EGAD:6128; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74367"
FT                   /db_xref="GOA:P63384"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63384"
FT                   /protein_id="AAK74367.1"
FT                   YTGHYLKGKLHHE"
FT   gene            179701..180762
FT                   /locus_tag="SP_0187"
FT   CDS_pept        179701..180762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0187"
FT                   /product="peptidase M24 family protein"
FT                   /note="identified by match to protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74368"
FT                   /db_xref="GOA:A0A0H2UN49"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN49"
FT                   /protein_id="AAK74368.1"
FT                   ELLTLAPKELIVI"
FT   gene            180767..180859
FT                   /locus_tag="SP_0188"
FT   CDS_pept        180767..180859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN51"
FT                   /protein_id="AAK74369.1"
FT                   /translation="MSRKKYENDEKSQKKLKIGRKSDVFYGIID"
FT   gene            180894..181292
FT                   /locus_tag="SP_0189"
FT   CDS_pept        180894..181292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6650536; match to
FT                   protein family HMM PF03960; match to protein family HMM
FT                   TIGR01617"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74370"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN57"
FT                   /protein_id="AAK74370.1"
FT   gene            181261..181380
FT                   /locus_tag="SP_0190"
FT   CDS_pept        181261..181380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN96"
FT                   /protein_id="AAK74371.1"
FT   gene            181358..181927
FT                   /locus_tag="SP_0191"
FT   CDS_pept        181358..181927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74372"
FT                   /db_xref="PDB:2MVB"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC7"
FT                   /protein_id="AAK74372.1"
FT   gene            182014..182280
FT                   /locus_tag="SP_0192"
FT   CDS_pept        182014..182280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NT01BS3187; match
FT                   to protein family HMM PF06135"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74373"
FT                   /db_xref="GOA:Q97SX1"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SX1"
FT                   /protein_id="AAK74373.1"
FT   gene            182284..182703
FT                   /pseudo
FT                   /locus_tag="SP_0193"
FT                   /note="putative Holliday junction resolvase; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:110019;
FT                   match to protein family HMM PF03652; match to protein
FT                   family HMM TIGR00250"
FT   gene            182719..183024
FT                   /locus_tag="SP_0194"
FT   CDS_pept        182719..183024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:110017; match to
FT                   protein family HMM PF06949"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74374"
FT                   /db_xref="GOA:Q97SX0"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SX0"
FT                   /protein_id="AAK74374.1"
FT   gene            182990..183088
FT                   /locus_tag="SP_0195"
FT   CDS_pept        182990..183088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0195"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN54"
FT                   /protein_id="AAK74375.1"
FT                   /translation="MKKSSTALWRSDTVWETVSAQLPEMGKSWNVQ"
FT   gene            183073..183168
FT                   /locus_tag="SP_0196"
FT   CDS_pept        183073..183168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0196"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74376"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN56"
FT                   /protein_id="AAK74376.1"
FT                   /translation="MERPVNIFTPTPRNGEELERPVDVFSPYSHS"
FT   gene            183283..184533
FT                   /locus_tag="SP_0197"
FT   CDS_pept        183283..184533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0197"
FT                   /product="putative dihydrofolate synthetase"
FT                   /note="identified by similarity to EGAD:42028; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74377"
FT                   /db_xref="GOA:A0A0H2UN62"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN62"
FT                   /protein_id="AAK74377.1"
FT                   YFISEVRGYLLDREQIN"
FT   gene            184617..185075
FT                   /locus_tag="SP_0198"
FT   CDS_pept        184617..185075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0198"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74378"
FT                   /db_xref="InterPro:IPR020961"
FT                   /db_xref="InterPro:IPR027279"
FT                   /db_xref="PDB:3GE2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA1"
FT                   /protein_id="AAK74378.1"
FT   gene            185329..186753
FT                   /gene="cls"
FT                   /locus_tag="SP_0199"
FT   CDS_pept        185329..186753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="SP_0199"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by similarity to SP:O66043; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74379"
FT                   /db_xref="GOA:A0A0H2UND2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND2"
FT                   /protein_id="AAK74379.1"
FT                   YQKLVKEIAQLFAPIL"
FT   gene            187011..188306
FT                   /gene="ccs4"
FT                   /locus_tag="SP_0200"
FT   CDS_pept        187011..188306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccs4"
FT                   /locus_tag="SP_0200"
FT                   /product="competence-induced protein Ccs4"
FT                   /note="identified by similarity to EGAD:158150"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74380"
FT                   /db_xref="GOA:A0A0H2UN59"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN59"
FT                   /protein_id="AAK74380.1"
FT   gene            188284..188550
FT                   /locus_tag="SP_0201"
FT   CDS_pept        188284..188550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN61"
FT                   /protein_id="AAK74381.1"
FT   gene            188670..190877
FT                   /gene="nrdD"
FT                   /locus_tag="SP_0202"
FT   CDS_pept        188670..190877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="SP_0202"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:4098081; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF03477; match to protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74382"
FT                   /db_xref="GOA:A0A0H2UN67"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN67"
FT                   /protein_id="AAK74382.1"
FT   gene            190889..191029
FT                   /locus_tag="SP_0203"
FT   CDS_pept        190889..191029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA6"
FT                   /protein_id="AAK74383.1"
FT                   K"
FT   gene            191073..191579
FT                   /locus_tag="SP_0204"
FT   CDS_pept        191073..191579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0204"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74384"
FT                   /db_xref="GOA:A0A0H2UND8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND8"
FT                   /protein_id="AAK74384.1"
FT                   EVANE"
FT   gene            191572..192162
FT                   /gene="nrdG"
FT                   /locus_tag="SP_0205"
FT   CDS_pept        191572..192162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="SP_0205"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="identified by similarity to GP:4098082; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR02491"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74385"
FT                   /db_xref="GOA:A0A0H2UN65"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN65"
FT                   /protein_id="AAK74385.1"
FT   gene            192159..192461
FT                   /locus_tag="SP_0206"
FT   CDS_pept        192159..192461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74386"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN64"
FT                   /protein_id="AAK74386.1"
FT   gene            192437..192775
FT                   /locus_tag="SP_0207"
FT   CDS_pept        192437..192775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0207"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74387"
FT                   /db_xref="GOA:A0A0H2UN72"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN72"
FT                   /protein_id="AAK74387.1"
FT                   DKFDVKRT"
FT   gene            193042..193350
FT                   /gene="rpsJ"
FT                   /locus_tag="SP_0208"
FT   CDS_pept        193042..193350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SP_0208"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by similarity to EGAD:9141; match to
FT                   protein family HMM PF00338; match to protein family HMM
FT                   TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74388"
FT                   /db_xref="GOA:P66339"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66339"
FT                   /protein_id="AAK74388.1"
FT   gene            193567..194193
FT                   /gene="rplC"
FT                   /locus_tag="SP_0209"
FT   CDS_pept        193567..194193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SP_0209"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74389"
FT                   /db_xref="GOA:Q97SV5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV5"
FT                   /protein_id="AAK74389.1"
FT   gene            194218..194841
FT                   /gene="rplD"
FT                   /locus_tag="SP_0210"
FT   CDS_pept        194218..194841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SP_0210"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74390"
FT                   /db_xref="GOA:Q97SV4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV4"
FT                   /protein_id="AAK74390.1"
FT   gene            194841..195137
FT                   /gene="rplW"
FT                   /locus_tag="SP_0211"
FT   CDS_pept        194841..195137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SP_0211"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74391"
FT                   /db_xref="GOA:Q97SV3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV3"
FT                   /protein_id="AAK74391.1"
FT   gene            195155..195988
FT                   /gene="rplB"
FT                   /locus_tag="SP_0212"
FT   CDS_pept        195155..195988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SP_0212"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74392"
FT                   /db_xref="GOA:Q97SV2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV2"
FT                   /protein_id="AAK74392.1"
FT   gene            196092..196373
FT                   /gene="rpsS"
FT                   /locus_tag="SP_0213"
FT   CDS_pept        196092..196373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SP_0213"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by similarity to EGAD:19290; match to
FT                   protein family HMM PF00203; match to protein family HMM
FT                   TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74393"
FT                   /db_xref="GOA:P0A4B5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4B5"
FT                   /protein_id="AAK74393.1"
FT   gene            196385..196729
FT                   /gene="rplV"
FT                   /locus_tag="SP_0214"
FT   CDS_pept        196385..196729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SP_0214"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74394"
FT                   /db_xref="GOA:P61182"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61182"
FT                   /protein_id="AAK74394.1"
FT                   AHITVAVAEK"
FT   gene            196742..197395
FT                   /gene="rpsC"
FT                   /locus_tag="SP_0215"
FT   CDS_pept        196742..197395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SP_0215"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by similarity to EGAD:15155; match to
FT                   protein family HMM PF00189; match to protein family HMM
FT                   PF00417; match to protein family HMM PF07650; match to
FT                   protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74395"
FT                   /db_xref="GOA:P0A4C3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4C3"
FT                   /protein_id="AAK74395.1"
FT   gene            197399..197812
FT                   /gene="rplP"
FT                   /locus_tag="SP_0216"
FT   CDS_pept        197399..197812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SP_0216"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74396"
FT                   /db_xref="GOA:P0A475"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A475"
FT                   /protein_id="AAK74396.1"
FT   gene            197822..198028
FT                   /gene="rpmC"
FT                   /locus_tag="SP_0217"
FT   CDS_pept        197822..198028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SP_0217"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by similarity to EGAD:7111; match to
FT                   protein family HMM PF00831; match to protein family HMM
FT                   TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74397"
FT                   /db_xref="GOA:P0A483"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A483"
FT                   /protein_id="AAK74397.1"
FT   gene            198053..198313
FT                   /gene="rpsQ"
FT                   /locus_tag="SP_0218"
FT   CDS_pept        198053..198313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SP_0218"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74398"
FT                   /db_xref="GOA:P0A4B3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4B3"
FT                   /protein_id="AAK74398.1"
FT   gene            198339..198707
FT                   /gene="rplN"
FT                   /locus_tag="SP_0219"
FT   CDS_pept        198339..198707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SP_0219"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74399"
FT                   /db_xref="GOA:P0A473"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A473"
FT                   /protein_id="AAK74399.1"
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            198785..199090
FT                   /gene="rplX"
FT                   /locus_tag="SP_0220"
FT   CDS_pept        198785..199090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SP_0220"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by similarity to EGAD:12689; match to
FT                   protein family HMM PF00467; match to protein family HMM
FT                   TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74400"
FT                   /db_xref="GOA:P60629"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60629"
FT                   /protein_id="AAK74400.1"
FT   gene            199114..199656
FT                   /gene="rplE"
FT                   /locus_tag="SP_0221"
FT   CDS_pept        199114..199656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SP_0221"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by similarity to EGAD:13166; match to
FT                   protein family HMM PF00281; match to protein family HMM
FT                   PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74401"
FT                   /db_xref="GOA:Q97SV1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV1"
FT                   /protein_id="AAK74401.1"
FT                   DEESRALLTGLGMPFAK"
FT   gene            199674..199943
FT                   /gene="rpsN"
FT                   /locus_tag="SP_0222"
FT   CDS_pept        199674..199943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SP_0222"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by similarity to EGAD:13201; match to
FT                   protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74402"
FT                   /db_xref="GOA:P66419"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66419"
FT                   /protein_id="AAK74402.1"
FT   gene            complement(199910..200032)
FT                   /locus_tag="SP_0223"
FT   CDS_pept        complement(199910..200032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74403"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB0"
FT                   /protein_id="AAK74403.1"
FT   gene            200228..200626
FT                   /gene="rpsH"
FT                   /locus_tag="SP_0224"
FT   CDS_pept        200228..200626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SP_0224"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74404"
FT                   /db_xref="GOA:P66632"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66632"
FT                   /protein_id="AAK74404.1"
FT   gene            200818..201354
FT                   /gene="rplF"
FT                   /locus_tag="SP_0225"
FT   CDS_pept        200818..201354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SP_0225"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74405"
FT                   /db_xref="GOA:Q97SU7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU7"
FT                   /protein_id="AAK74405.1"
FT                   YVGEFVRRKEGKTGK"
FT   gene            201438..201794
FT                   /gene="rplR"
FT                   /locus_tag="SP_0226"
FT   CDS_pept        201438..201794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SP_0226"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74406"
FT                   /db_xref="GOA:Q97SU6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU6"
FT                   /protein_id="AAK74406.1"
FT                   KALADAARENGLKF"
FT   gene            201812..202306
FT                   /gene="rpsE"
FT                   /locus_tag="SP_0227"
FT   CDS_pept        201812..202306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SP_0227"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by similarity to EGAD:12973; match to
FT                   protein family HMM PF00333; match to protein family HMM
FT                   PF03719; match to protein family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74407"
FT                   /db_xref="GOA:P66581"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66581"
FT                   /protein_id="AAK74407.1"
FT                   A"
FT   gene            202320..202502
FT                   /gene="rpmD"
FT                   /locus_tag="SP_0228"
FT   CDS_pept        202320..202502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SP_0228"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by similarity to EGAD:13217; match to
FT                   protein family HMM PF00327; match to protein family HMM
FT                   TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74408"
FT                   /db_xref="GOA:Q97SU4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU4"
FT                   /protein_id="AAK74408.1"
FT                   MITAVSHLVTVEEVN"
FT   gene            202647..203087
FT                   /gene="rplO"
FT                   /locus_tag="SP_0229"
FT   CDS_pept        202647..203087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SP_0229"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by similarity to EGAD:9380; match to
FT                   protein family HMM PF00256; match to protein family HMM
FT                   PF01305; match to protein family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74409"
FT                   /db_xref="GOA:Q97SU3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU3"
FT                   /protein_id="AAK74409.1"
FT   gene            203100..204410
FT                   /gene="secY"
FT                   /locus_tag="SP_0230"
FT   CDS_pept        203100..204410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SP_0230"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74410"
FT                   /db_xref="GOA:A0A0H2UNE3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE3"
FT                   /protein_id="AAK74410.1"
FT   gene            204561..205199
FT                   /gene="adk"
FT                   /locus_tag="SP_0231"
FT   CDS_pept        204561..205199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SP_0231"
FT                   /product="adenylate kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:18646; match to
FT                   protein family HMM PF00406; match to protein family HMM
FT                   TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74411"
FT                   /db_xref="GOA:Q97SU1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU1"
FT                   /protein_id="AAK74411.1"
FT   gene            205316..205534
FT                   /gene="infA"
FT                   /locus_tag="SP_0232"
FT   CDS_pept        205316..205534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SP_0232"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74412"
FT                   /db_xref="GOA:P65121"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="PDB:4QL5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65121"
FT                   /protein_id="AAK74412.1"
FT   gene            205559..205675
FT                   /gene="rpmJ"
FT                   /locus_tag="SP_0233"
FT   CDS_pept        205559..205675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SP_0233"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by similarity to EGAD:7945; match to
FT                   protein family HMM PF00444; match to protein family HMM
FT                   TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74413"
FT                   /db_xref="GOA:P0A495"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A495"
FT                   /protein_id="AAK74413.1"
FT   gene            205693..206058
FT                   /gene="rpsM"
FT                   /locus_tag="SP_0234"
FT   CDS_pept        205693..206058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SP_0234"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by similarity to EGAD:23759; match to
FT                   protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74414"
FT                   /db_xref="GOA:P66392"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66392"
FT                   /protein_id="AAK74414.1"
FT                   NARTRKGKAVAIAGKKK"
FT   gene            206076..206459
FT                   /gene="rpsK"
FT                   /locus_tag="SP_0235"
FT   CDS_pept        206076..206459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SP_0235"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by similarity to EGAD:13090; match to
FT                   protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74415"
FT                   /db_xref="GOA:P66359"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66359"
FT                   /protein_id="AAK74415.1"
FT   gene            206502..207437
FT                   /gene="rpoA"
FT                   /locus_tag="SP_0236"
FT   CDS_pept        206502..207437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SP_0236"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74416"
FT                   /db_xref="GOA:P66708"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66708"
FT                   /protein_id="AAK74416.1"
FT   gene            207449..207835
FT                   /gene="rplQ"
FT                   /locus_tag="SP_0237"
FT   CDS_pept        207449..207835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SP_0237"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by similarity to EGAD:19865; match to
FT                   protein family HMM PF01196; match to protein family HMM
FT                   TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74417"
FT                   /db_xref="GOA:Q97ST6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ST6"
FT                   /protein_id="AAK74417.1"
FT   gene            208100..208366
FT                   /locus_tag="SP_0238"
FT   CDS_pept        208100..208366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0238"
FT                   /product="ACT domain protein"
FT                   /note="identified by similarity to PIR:E64494; match to
FT                   protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74418"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="PDB:1ZPV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67382"
FT                   /protein_id="AAK74418.1"
FT   gene            208376..209713
FT                   /locus_tag="SP_0239"
FT   CDS_pept        208376..209713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:7226903; match to
FT                   protein family HMM PF05167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74419"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="PDB:2HA9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ST4"
FT                   /protein_id="AAK74419.1"
FT   gene            209957..210649
FT                   /locus_tag="SP_0240"
FT   CDS_pept        209957..210649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0240"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74420"
FT                   /db_xref="GOA:A0A0H2UN71"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN71"
FT                   /protein_id="AAK74420.1"
FT                   EKMEEGSI"
FT   gene            complement(210752..212397)
FT                   /pseudo
FT                   /locus_tag="SP_0241"
FT                   /note="iron ABC transporter, permease protein, degenerate;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:2766195"
FT   gene            complement(212387..213478)
FT                   /locus_tag="SP_0242"
FT   CDS_pept        complement(212387..213478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0242"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GP:2766194; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74421"
FT                   /db_xref="GOA:A0A0H2UN68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN68"
FT                   /protein_id="AAK74421.1"
FT   gene            complement(213491..214507)
FT                   /locus_tag="SP_0243"
FT   CDS_pept        complement(213491..214507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0243"
FT                   /product="iron ABC transporter, iron-binding protein"
FT                   /note="identified by similarity to GP:6127225; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74422"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN78"
FT                   /protein_id="AAK74422.1"
FT   gene            complement(214812..214919)
FT                   /locus_tag="SP_0244"
FT   CDS_pept        complement(214812..214919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB5"
FT                   /protein_id="AAK74423.1"
FT   gene            complement(215094..215870)
FT                   /locus_tag="SP_0245"
FT   CDS_pept        complement(215094..215870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0245"
FT                   /product="putative pyruvate formate-lyase-activating
FT                   enzyme"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:38340; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR02494"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74424"
FT                   /db_xref="GOA:A0A0H2UNE7"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE7"
FT                   /protein_id="AAK74424.1"
FT   gene            215992..216738
FT                   /locus_tag="SP_0246"
FT   CDS_pept        215992..216738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0246"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74425"
FT                   /db_xref="GOA:A0A0H2UN76"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN76"
FT                   /protein_id="AAK74425.1"
FT   gene            216751..217731
FT                   /locus_tag="SP_0247"
FT   CDS_pept        216751..217731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0247"
FT                   /product="transcriptional regulator"
FT                   /note="identified by similarity to EGAD:6416; match to
FT                   protein family HMM PF04198"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74426"
FT                   /db_xref="GOA:A0A0H2UN73"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="PDB:2GNP"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN73"
FT                   /protein_id="AAK74426.1"
FT   gene            217926..218246
FT                   /locus_tag="SP_0248"
FT   CDS_pept        217926..218246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0248"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74427"
FT                   /db_xref="GOA:A0A0H2UN82"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN82"
FT                   /protein_id="AAK74427.1"
FT                   KK"
FT   gene            218292..218600
FT                   /locus_tag="SP_0249"
FT   CDS_pept        218292..218600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0249"
FT                   /product="PTS system, IIB component"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:18420; match to
FT                   protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74428"
FT                   /db_xref="GOA:A0A0H2UNC3"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC3"
FT                   /protein_id="AAK74428.1"
FT   gene            218593..219915
FT                   /locus_tag="SP_0250"
FT   CDS_pept        218593..219915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0250"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74429"
FT                   /db_xref="GOA:A0A0H2UNF2"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF2"
FT                   /protein_id="AAK74429.1"
FT   gene            220066..222504
FT                   /locus_tag="SP_0251"
FT   CDS_pept        220066..222504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0251"
FT                   /product="putative formate acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:20598; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF02901; match to protein family HMM TIGR01774"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74430"
FT                   /db_xref="GOA:A0A0H2UN81"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN81"
FT                   /protein_id="AAK74430.1"
FT                   "
FT   gene            222523..223191
FT                   /locus_tag="SP_0252"
FT   CDS_pept        222523..223191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0252"
FT                   /product="transaldolase family protein"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74431"
FT                   /db_xref="GOA:Q97SS2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR023001"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SS2"
FT                   /protein_id="AAK74431.1"
FT                   "
FT   gene            223209..224297
FT                   /gene="gldA"
FT                   /locus_tag="SP_0253"
FT   CDS_pept        223209..224297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="SP_0253"
FT                   /product="glycerol dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74432"
FT                   /db_xref="GOA:A0A0H2UN77"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN77"
FT                   /protein_id="AAK74432.1"
FT   gene            224752..227253
FT                   /gene="leuS"
FT                   /locus_tag="SP_0254"
FT   CDS_pept        224752..227253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SP_0254"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74433"
FT                   /db_xref="GOA:Q97SS0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SS0"
FT                   /protein_id="AAK74433.1"
FT   gene            227448..228143
FT                   /locus_tag="SP_0255"
FT   CDS_pept        227448..228143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0255"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74434"
FT                   /db_xref="GOA:A0A0H2UN87"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN87"
FT                   /protein_id="AAK74434.1"
FT                   RQHKSLREL"
FT   gene            228155..228571
FT                   /locus_tag="SP_0256"
FT   CDS_pept        228155..228571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0256"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74435"
FT                   /db_xref="GOA:A0A0H2UND0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:2ATR"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND0"
FT                   /protein_id="AAK74435.1"
FT   gene            229365..230621
FT                   /pseudo
FT                   /locus_tag="SP_0257"
FT                   /note="2 full length (1974 bp) copies fold into the
FT                   secondary structures expected for a group II intron. Left
FT                   end = TTTTTTGCGGTACGACGGGC. Right end =
FT                   GAGATTATCCCCTACTCGAT.; group II intron, maturase,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   EGAD:135254"
FT   gene            complement(231373..231465)
FT                   /locus_tag="SP_0258"
FT   CDS_pept        complement(231373..231465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74436"
FT                   /db_xref="GOA:A0A0H2UNF6"
FT                   /db_xref="InterPro:IPR025882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF6"
FT                   /protein_id="AAK74436.1"
FT                   /translation="MMELVLKTIIGPIVVGVVLRIVDKWLNKDK"
FT   gene            231600..232598
FT                   /gene="ruvB"
FT                   /locus_tag="SP_0259"
FT   CDS_pept        231600..232598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SP_0259"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="identified by similarity to EGAD:15420; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF05491; match to protein family HMM PF05496; match to
FT                   protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74437"
FT                   /db_xref="GOA:Q97SR6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SR6"
FT                   /protein_id="AAK74437.1"
FT   gene            232579..233151
FT                   /locus_tag="SP_0260"
FT   CDS_pept        232579..233151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:173606; match to
FT                   protein family HMM PF06042"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74438"
FT                   /db_xref="GOA:A0A0H2UN86"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="PDB:2LA3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN86"
FT                   /protein_id="AAK74438.1"
FT   gene            233382..234140
FT                   /gene="uppS"
FT                   /locus_tag="SP_0261"
FT   CDS_pept        233382..234140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SP_0261"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:O82827; match to
FT                   protein family HMM PF01255; match to protein family HMM
FT                   TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74439"
FT                   /db_xref="GOA:Q97SR4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="PDB:5KH2"
FT                   /db_xref="PDB:5KH4"
FT                   /db_xref="PDB:5KH5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SR4"
FT                   /protein_id="AAK74439.1"
FT   gene            234149..234952
FT                   /locus_tag="SP_0262"
FT   CDS_pept        234149..234952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0262"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="identified by similarity to EGAD:108469; match to
FT                   protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74440"
FT                   /db_xref="GOA:A0A0H2UN85"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN85"
FT                   /protein_id="AAK74440.1"
FT   gene            234974..236233
FT                   /gene="eep"
FT                   /locus_tag="SP_0263"
FT   CDS_pept        234974..236233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eep"
FT                   /locus_tag="SP_0263"
FT                   /product="eep protein"
FT                   /note="identified by similarity to GP:5714510; match to
FT                   protein family HMM PF02163; match to protein family HMM
FT                   TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74441"
FT                   /db_xref="GOA:Q97SR2"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SR2"
FT                   /protein_id="AAK74441.1"
FT   gene            236246..238099
FT                   /gene="proS"
FT                   /locus_tag="SP_0264"
FT   CDS_pept        236246..238099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SP_0264"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74442"
FT                   /db_xref="GOA:Q97SR1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SR1"
FT                   /protein_id="AAK74442.1"
FT   gene            238198..239577
FT                   /locus_tag="SP_0265"
FT   CDS_pept        238198..239577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0265"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74443"
FT                   /db_xref="GOA:A0A0H2UN93"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN93"
FT                   /protein_id="AAK74443.1"
FT                   F"
FT   gene            239770..241578
FT                   /gene="glmS"
FT                   /locus_tag="SP_0266"
FT   CDS_pept        239770..241578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SP_0266"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P39754; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF01380; match to protein family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74444"
FT                   /db_xref="GOA:Q97SQ9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SQ9"
FT                   /protein_id="AAK74444.1"
FT   gene            241697..242746
FT                   /locus_tag="SP_0267"
FT   CDS_pept        241697..242746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0267"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74445"
FT                   /db_xref="GOA:A0A0H2UND4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND4"
FT                   /protein_id="AAK74445.1"
FT                   RAYFAMKEA"
FT   gene            complement(242846..246688)
FT                   /locus_tag="SP_0268"
FT   CDS_pept        complement(242846..246688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0268"
FT                   /product="putative alkaline amylopullulanase"
FT                   /note="identified by similarity to EGAD:154567; match to
FT                   protein family HMM PF00128; match to protein family HMM
FT                   PF00746; match to protein family HMM PF02922; match to
FT                   protein family HMM PF03714; match to protein family HMM
FT                   PF04650; match to protein family HMM TIGR01167; match to
FT                   protein family HMM TIGR01168; match to protein family HMM
FT                   TIGR02102"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74446"
FT                   /db_xref="GOA:A0A0H2UNG0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011838"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR040806"
FT                   /db_xref="PDB:2J44"
FT                   /db_xref="PDB:2YA0"
FT                   /db_xref="PDB:2YA1"
FT                   /db_xref="PDB:2YA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG0"
FT                   /protein_id="AAK74446.1"
FT   gene            246875..246970
FT                   /locus_tag="SP_0269"
FT   CDS_pept        246875..246970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74447"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN89"
FT                   /protein_id="AAK74447.1"
FT                   /translation="MFSAIFIQKLISNITNKKEKYLDKQGKILLQ"
FT   gene            247026..247118
FT                   /locus_tag="SP_0270"
FT   CDS_pept        247026..247118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN90"
FT                   /protein_id="AAK74448.1"
FT                   /translation="MLQKYTQMISVTKCIITKNKKTQENVDAYN"
FT   gene            247105..247518
FT                   /gene="rpsL"
FT                   /locus_tag="SP_0271"
FT   CDS_pept        247105..247518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SP_0271"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74449"
FT                   /db_xref="GOA:P0A4A7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4A7"
FT                   /protein_id="AAK74449.1"
FT   gene            247538..248008
FT                   /gene="rpsG"
FT                   /locus_tag="SP_0272"
FT   CDS_pept        247538..248008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SP_0272"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74450"
FT                   /db_xref="GOA:Q97SQ4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SQ4"
FT                   /protein_id="AAK74450.1"
FT   gene            248433..250514
FT                   /gene="fusA"
FT                   /locus_tag="SP_0273"
FT   CDS_pept        248433..250514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SP_0273"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74451"
FT                   /db_xref="GOA:P64022"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64022"
FT                   /protein_id="AAK74451.1"
FT   gene            250618..255009
FT                   /locus_tag="SP_0274"
FT   CDS_pept        250618..255009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0274"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:14601; match to
FT                   protein family HMM PF00929; match to protein family HMM
FT                   PF01336; match to protein family HMM PF02231; match to
FT                   protein family HMM PF02811; match to protein family HMM
FT                   PF07733; match to protein family HMM TIGR00573; match to
FT                   protein family HMM TIGR01405"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74452"
FT                   /db_xref="GOA:Q97SQ2"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SQ2"
FT                   /protein_id="AAK74452.1"
FT                   LF"
FT   gene            255111..255374
FT                   /locus_tag="SP_0275"
FT   CDS_pept        255111..255374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:29477; match to
FT                   protein family HMM PF04221; match to protein family HMM
FT                   TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74453"
FT                   /db_xref="GOA:A0A0H2UN98"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN98"
FT                   /protein_id="AAK74453.1"
FT   gene            255367..255645
FT                   /locus_tag="SP_0276"
FT   CDS_pept        255367..255645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:166151; match to
FT                   protein family HMM PF05016; match to protein family HMM
FT                   TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74454"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND9"
FT                   /protein_id="AAK74454.1"
FT   gene            255666..255818
FT                   /locus_tag="SP_0277"
FT   CDS_pept        255666..255818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0277"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74455"
FT                   /db_xref="GOA:A0A0H2UNG5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG5"
FT                   /protein_id="AAK74455.1"
FT                   ALKEK"
FT   gene            255840..257081
FT                   /gene="pepS"
FT                   /locus_tag="SP_0278"
FT   CDS_pept        255840..257081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepS"
FT                   /locus_tag="SP_0278"
FT                   /product="aminopeptidase PepS"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by similarity to SP:Q9X4A7; match to
FT                   protein family HMM PF02073"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74456"
FT                   /db_xref="GOA:A0A0H2UN95"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="PDB:4ICQ"
FT                   /db_xref="PDB:4ICR"
FT                   /db_xref="PDB:4ICS"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN95"
FT                   /protein_id="AAK74456.1"
FT                   GTRVPLFRNGNWAN"
FT   gene            257091..257321
FT                   /locus_tag="SP_0279"
FT   CDS_pept        257091..257321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108076; match to
FT                   protein family HMM PF04226"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74457"
FT                   /db_xref="GOA:A0A0H2UN94"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN94"
FT                   /protein_id="AAK74457.1"
FT   gene            257589..258311
FT                   /gene="rsuA-1"
FT                   /locus_tag="SP_0280"
FT   CDS_pept        257589..258311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA-1"
FT                   /locus_tag="SP_0280"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /note="identified by similarity to EGAD:9371; match to
FT                   protein family HMM PF00849; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74458"
FT                   /db_xref="GOA:A0A0H2UNA4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA4"
FT                   /protein_id="AAK74458.1"
FT                   EWRRLTKEELEILRANII"
FT   gene            258529..259863
FT                   /gene="pepC"
FT                   /locus_tag="SP_0281"
FT   CDS_pept        258529..259863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="SP_0281"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.-"
FT                   /note="identified by similarity to EGAD:22583; match to
FT                   protein family HMM PF03051"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74459"
FT                   /db_xref="GOA:A0A0H2UNE1"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE1"
FT                   /protein_id="AAK74459.1"
FT   gene            complement(259919..260830)
FT                   /locus_tag="SP_0282"
FT   CDS_pept        complement(259919..260830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0282"
FT                   /product="PTS system, mannose-specific IID component"
FT                   /note="identified by similarity to EGAD:91568; match to
FT                   protein family HMM PF03613; match to protein family HMM
FT                   TIGR00828"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74460"
FT                   /db_xref="GOA:A0A0H2UNG8"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG8"
FT                   /protein_id="AAK74460.1"
FT   gene            complement(260854..261657)
FT                   /gene="manM"
FT                   /locus_tag="SP_0283"
FT   CDS_pept        complement(260854..261657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manM"
FT                   /locus_tag="SP_0283"
FT                   /product="PTS system, mannose-specific IIC component"
FT                   /note="identified by similarity to EGAD:14386; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74461"
FT                   /db_xref="GOA:A0A0H2UNA0"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA0"
FT                   /protein_id="AAK74461.1"
FT   gene            complement(261685..262683)
FT                   /gene="manL"
FT                   /locus_tag="SP_0284"
FT   CDS_pept        complement(261685..262683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="SP_0284"
FT                   /product="PTS system, mannose-specific IIAB components"
FT                   /note="identified by similarity to GP:5669855; match to
FT                   protein family HMM PF03610; match to protein family HMM
FT                   PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74462"
FT                   /db_xref="GOA:A0A0H2UN99"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UN99"
FT                   /protein_id="AAK74462.1"
FT   gene            complement(262907..263926)
FT                   /locus_tag="SP_0285"
FT   CDS_pept        complement(262907..263926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0285"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:15881; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74463"
FT                   /db_xref="GOA:A0A0H2UNB1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB1"
FT                   /protein_id="AAK74463.1"
FT   gene            complement(264266..265078)
FT                   /locus_tag="SP_0286"
FT   CDS_pept        complement(264266..265078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0286"
FT                   /product="Cof family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74464"
FT                   /db_xref="GOA:A0A0H2UNE6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE6"
FT                   /protein_id="AAK74464.1"
FT   gene            265214..266686
FT                   /locus_tag="SP_0287"
FT   CDS_pept        265214..266686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0287"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74465"
FT                   /db_xref="GOA:A0A0H2UNH2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH2"
FT                   /protein_id="AAK74465.1"
FT   gene            266754..267446
FT                   /locus_tag="SP_0288"
FT   CDS_pept        266754..267446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6470197; match to
FT                   protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74466"
FT                   /db_xref="GOA:A0A0H2UNA5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA5"
FT                   /protein_id="AAK74466.1"
FT                   SRTLGISV"
FT   gene            267571..268515
FT                   /locus_tag="SP_0289"
FT   CDS_pept        267571..268515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0289"
FT                   /product="dihydropteroate synthase"
FT                   /note="identified by similarity to EGAD:29516; match to
FT                   protein family HMM PF00809; match to protein family HMM
FT                   TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74467"
FT                   /db_xref="GOA:P05382"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05382"
FT                   /protein_id="AAK74467.1"
FT   gene            268517..269839
FT                   /gene="folC"
FT                   /locus_tag="SP_0290"
FT   CDS_pept        268517..269839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="SP_0290"
FT                   /product="dihydrofolate synthetase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:42028; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74468"
FT                   /db_xref="GOA:A0A0H2UNA3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA3"
FT                   /protein_id="AAK74468.1"
FT   gene            269820..270374
FT                   /gene="folE"
FT                   /locus_tag="SP_0291"
FT   CDS_pept        269820..270374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="SP_0291"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:42029; match to
FT                   protein family HMM PF01227; match to protein family HMM
FT                   TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74469"
FT                   /db_xref="GOA:P51595"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51595"
FT                   /protein_id="AAK74469.1"
FT   gene            270417..271229
FT                   /gene="sulD"
FT                   /locus_tag="SP_0292"
FT   CDS_pept        270417..271229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulD"
FT                   /locus_tag="SP_0292"
FT                   /product="bifunctional folate synthesis protein"
FT                   /note="identified by similarity to SP:P22291; match to
FT                   protein family HMM PF01288; match to protein family HMM
FT                   PF02152; match to protein family HMM TIGR00525; match to
FT                   protein family HMM TIGR00526; match to protein family HMM
FT                   TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74470"
FT                   /db_xref="GOA:P22291"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22291"
FT                   /protein_id="AAK74470.1"
FT   gene            complement(271379..271750)
FT                   /locus_tag="SP_0293"
FT   CDS_pept        complement(271379..271750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0293"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74471"
FT                   /db_xref="InterPro:IPR009303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB6"
FT                   /protein_id="AAK74471.1"
FT   gene            272052..272498
FT                   /gene="rplM"
FT                   /locus_tag="SP_0294"
FT   CDS_pept        272052..272498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SP_0294"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by similarity to EGAD:7868; match to
FT                   protein family HMM PF00572; match to protein family HMM
FT                   TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74472"
FT                   /db_xref="GOA:A0A0H2UNF0"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF0"
FT                   /protein_id="AAK74472.1"
FT   gene            272517..272909
FT                   /gene="rpsI"
FT                   /locus_tag="SP_0295"
FT   CDS_pept        272517..272909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SP_0295"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by similarity to EGAD:12856; match to
FT                   protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74473"
FT                   /db_xref="GOA:Q97SN4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SN4"
FT                   /protein_id="AAK74473.1"
FT   gene            complement(273172..273303)
FT                   /locus_tag="SP_0296"
FT   CDS_pept        complement(273172..273303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH8"
FT                   /protein_id="AAK74474.1"
FT   gene            complement(273502..273651)
FT                   /locus_tag="SP_0297"
FT   CDS_pept        complement(273502..273651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74475"
FT                   /db_xref="GOA:A0A0H2UNA9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA9"
FT                   /protein_id="AAK74475.1"
FT                   KDMN"
FT   gene            complement(273953..275161)
FT                   /locus_tag="SP_0298"
FT   CDS_pept        complement(273953..275161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74476"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNA8"
FT                   /protein_id="AAK74476.1"
FT                   LEK"
FT   gene            275290..275637
FT                   /locus_tag="SP_0299"
FT   CDS_pept        275290..275637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0299"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /note="identified by similarity to GP:5019554; match to
FT                   protein family HMM PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74477"
FT                   /db_xref="GOA:A0A0H2UNB9"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB9"
FT                   /protein_id="AAK74477.1"
FT                   GYTRKKEPHLL"
FT   gene            275816..276154
FT                   /locus_tag="SP_0300"
FT   CDS_pept        275816..276154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0300"
FT                   /product="IS630-Spn1, transposase Orf2"
FT                   /note="identified by similarity to GP:5019553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74478"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF5"
FT                   /protein_id="AAK74478.1"
FT                   LLSCSCFN"
FT   gene            276142..276234
FT                   /locus_tag="SP_0301"
FT   CDS_pept        276142..276234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0301"
FT                   /product="glycosyl hydrolase, family 1, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75786"
FT                   /db_xref="GOA:A0A0H2XDA7"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XDA7"
FT                   /protein_id="ABC75786.1"
FT                   /translation="MFQLTINRYKKKSFYWYKEVIESNGETLDN"
FT   gene            276283..276648
FT                   /locus_tag="SP_0302"
FT   CDS_pept        276283..276648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0302"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:9658050; match to
FT                   protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74479"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI3"
FT                   /protein_id="AAK74479.1"
FT                   DDSGMPESDKSFIDTGN"
FT   gene            276838..278274
FT                   /gene="bglA-1"
FT                   /locus_tag="SP_0303"
FT   CDS_pept        276838..278274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA-1"
FT                   /locus_tag="SP_0303"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:36677; match to
FT                   protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74480"
FT                   /db_xref="GOA:A0A0H2UNB4"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB4"
FT                   /protein_id="AAK74480.1"
FT   gene            278326..278565
FT                   /locus_tag="SP_0304"
FT   CDS_pept        278326..278565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:45124"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74481"
FT                   /db_xref="GOA:A0A0H2UNB3"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB3"
FT                   /protein_id="AAK74481.1"
FT   gene            278695..279009
FT                   /locus_tag="SP_0305"
FT   CDS_pept        278695..279009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0305"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74482"
FT                   /db_xref="GOA:A0A0H2UNC2"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC2"
FT                   /protein_id="AAK74482.1"
FT                   "
FT   gene            279127..280608
FT                   /locus_tag="SP_0306"
FT   CDS_pept        279127..280608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0306"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to EGAD:30181; match to
FT                   protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74483"
FT                   /db_xref="GOA:A0A0H2UNF9"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF9"
FT                   /protein_id="AAK74483.1"
FT   gene            280609..281106
FT                   /locus_tag="SP_0307"
FT   CDS_pept        280609..281106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0307"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74484"
FT                   /db_xref="GOA:A0A0H2UNI8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI8"
FT                   /protein_id="AAK74484.1"
FT                   IK"
FT   gene            281116..281430
FT                   /locus_tag="SP_0308"
FT   CDS_pept        281116..281430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0308"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74485"
FT                   /db_xref="GOA:A0A0H2UNC0"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC0"
FT                   /protein_id="AAK74485.1"
FT                   "
FT   gene            281461..281967
FT                   /locus_tag="SP_0309"
FT   CDS_pept        281461..281967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74486"
FT                   /db_xref="GOA:A0A0H2UNB8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB8"
FT                   /protein_id="AAK74486.1"
FT                   NSLSL"
FT   gene            282047..283393
FT                   /locus_tag="SP_0310"
FT   CDS_pept        282047..283393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0310"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74487"
FT                   /db_xref="GOA:A0A0H2UNC6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC6"
FT                   /protein_id="AAK74487.1"
FT   gene            283772..283948
FT                   /locus_tag="SP_0311"
FT   CDS_pept        283772..283948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG4"
FT                   /protein_id="AAK74488.1"
FT                   EKLRDEALALGMT"
FT   gene            284523..286562
FT                   /locus_tag="SP_0312"
FT   CDS_pept        284523..286562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0312"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74489"
FT                   /db_xref="GOA:A0A0H2UNJ3"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ3"
FT                   /protein_id="AAK74489.1"
FT   gene            complement(286784..287260)
FT                   /locus_tag="SP_0313"
FT   CDS_pept        complement(286784..287260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0313"
FT                   /product="glutathione peroxidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74490"
FT                   /db_xref="GOA:A0A0H2UNC4"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC4"
FT                   /protein_id="AAK74490.1"
FT   gene            287483..290683
FT                   /locus_tag="SP_0314"
FT   CDS_pept        287483..290683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0314"
FT                   /product="hyaluronidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:23003; match to
FT                   protein family HMM PF00746; match to protein family HMM
FT                   PF02018; match to protein family HMM PF02278; match to
FT                   protein family HMM PF02884; match to protein family HMM
FT                   PF08124; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74491"
FT                   /db_xref="GOA:Q54873"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023295"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="PDB:1C82"
FT                   /db_xref="PDB:1EGU"
FT                   /db_xref="PDB:1F9G"
FT                   /db_xref="PDB:1LOH"
FT                   /db_xref="PDB:1LXK"
FT                   /db_xref="PDB:1N7N"
FT                   /db_xref="PDB:1N7O"
FT                   /db_xref="PDB:1N7P"
FT                   /db_xref="PDB:1N7Q"
FT                   /db_xref="PDB:1N7R"
FT                   /db_xref="PDB:1OJM"
FT                   /db_xref="PDB:1OJN"
FT                   /db_xref="PDB:1OJO"
FT                   /db_xref="PDB:1OJP"
FT                   /db_xref="PDB:1W3Y"
FT                   /db_xref="PDB:2BRP"
FT                   /db_xref="PDB:2BRV"
FT                   /db_xref="PDB:2BRW"
FT                   /db_xref="PDB:4D0Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q54873"
FT                   /protein_id="AAK74491.1"
FT                   LGFLLLGAFYLFRRGKNN"
FT   gene            291067..291687
FT                   /pseudo
FT                   /locus_tag="SP_0315"
FT                   /note="This gene is interrupted by an RUP element. L20670.1
FT                   GI:437704; IS200S, transposase, interruption; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:14951"
FT   gene            complement(291700..291807)
FT                   /locus_tag="SP_0316"
FT   CDS_pept        complement(291700..291807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC5"
FT                   /protein_id="AAK74492.1"
FT   gene            complement(291831..292460)
FT                   /locus_tag="SP_0317"
FT   CDS_pept        complement(291831..292460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0317"
FT                   /product="4-hydroxy-2-oxoglutarate
FT                   aldolase/2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:37718; match to
FT                   protein family HMM PF01081; match to protein family HMM
FT                   TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74493"
FT                   /db_xref="GOA:A0A0H2UNC8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC8"
FT                   /protein_id="AAK74493.1"
FT   gene            complement(292470..293471)
FT                   /locus_tag="SP_0318"
FT   CDS_pept        complement(292470..293471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0318"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74494"
FT                   /db_xref="GOA:A0A0H2UNG9"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG9"
FT                   /protein_id="AAK74494.1"
FT   gene            complement(293502..294143)
FT                   /locus_tag="SP_0319"
FT   CDS_pept        complement(293502..294143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0319"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:3282092; match to
FT                   protein family HMM PF06562"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74495"
FT                   /db_xref="GOA:A0A0H2UNJ8"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="PDB:2PPW"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ8"
FT                   /protein_id="AAK74495.1"
FT   gene            complement(294162..294977)
FT                   /locus_tag="SP_0320"
FT   CDS_pept        complement(294162..294977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0320"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74496"
FT                   /db_xref="GOA:A0A0H2UNC9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNC9"
FT                   /protein_id="AAK74496.1"
FT   gene            295248..295682
FT                   /locus_tag="SP_0321"
FT   CDS_pept        295248..295682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0321"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by similarity to EGAD:151768; match to
FT                   protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74497"
FT                   /db_xref="GOA:A0A0H2UND1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND1"
FT                   /protein_id="AAK74497.1"
FT   gene            295694..296884
FT                   /locus_tag="SP_0322"
FT   CDS_pept        295694..296884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0322"
FT                   /product="glucuronyl hydrolase"
FT                   /note="identified by similarity to GP:5869507; match to
FT                   protein family HMM PF07470"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74498"
FT                   /db_xref="GOA:A0A0H2UND5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND5"
FT                   /protein_id="AAK74498.1"
FT   gene            296895..297386
FT                   /locus_tag="SP_0323"
FT   CDS_pept        296895..297386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0323"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74499"
FT                   /db_xref="GOA:A0A0H2UNH3"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH3"
FT                   /protein_id="AAK74499.1"
FT                   "
FT   gene            297401..298180
FT                   /locus_tag="SP_0324"
FT   CDS_pept        297401..298180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0324"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74500"
FT                   /db_xref="GOA:A0A0H2UNK3"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK3"
FT                   /protein_id="AAK74500.1"
FT   gene            298167..298985
FT                   /locus_tag="SP_0325"
FT   CDS_pept        298167..298985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0325"
FT                   /product="PTS system, IID component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74501"
FT                   /db_xref="GOA:A0A0H2UND3"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND3"
FT                   /protein_id="AAK74501.1"
FT   gene            298985..299278
FT                   /gene="yajC-1"
FT                   /locus_tag="SP_0326"
FT   CDS_pept        298985..299278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC-1"
FT                   /locus_tag="SP_0326"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699;
FT                   match to protein family HMM TIGR00739"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74502"
FT                   /db_xref="GOA:A0A0H2UND6"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND6"
FT                   /protein_id="AAK74502.1"
FT   gene            299300..300940
FT                   /locus_tag="SP_0327"
FT   CDS_pept        299300..300940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0327"
FT                   /product="hypothetical protein"
FT                   /note="This hypothetical gene is interrupted by an
FT                   IS1380-Spn1 element in the type 4 strain, but not in the
FT                   Cp5500 strain (GP:1524347).; identified by Glimmer2;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74503"
FT                   /db_xref="GOA:A0A0H2UNE0"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE0"
FT                   /protein_id="AAK74503.1"
FT   gene            301056..302402
FT                   /locus_tag="SP_0328"
FT   CDS_pept        301056..302402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0328"
FT                   /product="IS1380-Spn1, transposase"
FT                   /note="identified by similarity to GP:8163721; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74504"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2US47"
FT                   /protein_id="AAK74504.1"
FT   gene            302580..302909
FT                   /locus_tag="SP_0329"
FT   CDS_pept        302580..302909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0329"
FT                   /product="hypothetical protein"
FT                   /note="This hypothetical gene is interrupted by an
FT                   IS1380-Spn1 element in the type 4 strain, but not in the
FT                   Cp5500 strain (GP:1524347).; identified by Glimmer2;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK8"
FT                   /protein_id="AAK74505.1"
FT                   IRLQC"
FT   gene            302969..303970
FT                   /gene="regR"
FT                   /locus_tag="SP_0330"
FT   CDS_pept        302969..303970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="SP_0330"
FT                   /product="sugar binding transcriptional regulator RegR"
FT                   /note="identified by similarity to GP:1536958; match to
FT                   protein family HMM PF00356; match to protein family HMM
FT                   PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74506"
FT                   /db_xref="GOA:A0A0H2UND7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UND7"
FT                   /protein_id="AAK74506.1"
FT   gene            complement(304080..304472)
FT                   /locus_tag="SP_2241"
FT   CDS_pept        complement(304080..304472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_2241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_2241"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75798"
FT                   /db_xref="GOA:A0A0H2XFH7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XFH7"
FT                   /protein_id="ABC75798.1"
FT   gene            complement(304426..304668)
FT                   /pseudo
FT                   /locus_tag="SP_0331"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by Glimmer2; putative"
FT   gene            complement(304679..305221)
FT                   /locus_tag="SP_0332"
FT   CDS_pept        complement(304679..305221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74507"
FT                   /db_xref="GOA:A0A0H2UNE4"
FT                   /db_xref="InterPro:IPR021697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE4"
FT                   /protein_id="AAK74507.1"
FT                   FLISRRIAKTKKNQDED"
FT   gene            complement(305237..305431)
FT                   /locus_tag="SP_0333"
FT   CDS_pept        complement(305237..305431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0333"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74508"
FT                   /db_xref="GOA:A0A0H2UNE5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE5"
FT                   /protein_id="AAK74508.1"
FT   gene            305597..306547
FT                   /gene="yllC"
FT                   /locus_tag="SP_0334"
FT   CDS_pept        305597..306547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yllC"
FT                   /locus_tag="SP_0334"
FT                   /product="yllC protein"
FT                   /note="identified by similarity to GP:4009486; match to
FT                   protein family HMM PF01795; match to protein family HMM
FT                   TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74509"
FT                   /db_xref="GOA:P0CB58"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB58"
FT                   /protein_id="AAK74509.1"
FT   gene            306559..306876
FT                   /gene="ftsL"
FT                   /locus_tag="SP_0335"
FT   CDS_pept        306559..306876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SP_0335"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by similarity to GP:1524351; match to
FT                   protein family HMM TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74510"
FT                   /db_xref="GOA:A0A0H2UNI0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI0"
FT                   /protein_id="AAK74510.1"
FT                   E"
FT   gene            306880..309132
FT                   /gene="pbpX"
FT                   /locus_tag="SP_0336"
FT   CDS_pept        306880..309132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="SP_0336"
FT                   /product="penicillin-binding protein 2X"
FT                   /note="identified by similarity to EGAD:7962; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF03717; match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74511"
FT                   /db_xref="GOA:P14677"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="PDB:1PMD"
FT                   /db_xref="PDB:1QME"
FT                   /db_xref="PDB:1QMF"
FT                   /db_xref="PDB:1RP5"
FT                   /db_xref="PDB:2Z2L"
FT                   /db_xref="PDB:2Z2M"
FT                   /db_xref="PDB:2ZC3"
FT                   /db_xref="PDB:2ZC4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14677"
FT                   /protein_id="AAK74511.1"
FT   gene            309134..310114
FT                   /gene="mraY"
FT                   /locus_tag="SP_0337"
FT   CDS_pept        309134..310114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SP_0337"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q9ZHA5; match to
FT                   protein family HMM PF00953; match to protein family HMM
FT                   TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74512"
FT                   /db_xref="GOA:P0CB59"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB59"
FT                   /protein_id="AAK74512.1"
FT   gene            310723..312828
FT                   /locus_tag="SP_0338"
FT   CDS_pept        310723..312828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0338"
FT                   /product="putative ATP-dependent Clp protease, ATP-binding
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74513"
FT                   /db_xref="GOA:A0A0H2UNL3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL3"
FT                   /protein_id="AAK74513.1"
FT                   LVIREKV"
FT   gene            312935..313057
FT                   /pseudo
FT                   /locus_tag="SP_0339"
FT                   /note="Although this gene is truncated, 2 full length (1974
FT                   bp) copies fold into the secondary structures expected for
FT                   a group II intron. Left end = TTTTTTGCGGTACGACGGGC. Right
FT                   end = GAGATTATCCCCTACTCGAT.; group II intron, maturase,
FT                   truncation; comparison of this gene to its homologs
FT                   suggests this gene has been truncated; identified by
FT                   similarity to GP:2804734"
FT   gene            complement(313124..313606)
FT                   /gene="luxS"
FT                   /locus_tag="SP_0340"
FT   CDS_pept        complement(313124..313606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SP_0340"
FT                   /product="autoinducer-2 production protein"
FT                   /note="identified by similarity to SP:P45578; match to
FT                   protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74514"
FT                   /db_xref="GOA:P65334"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65334"
FT                   /protein_id="AAK74514.1"
FT   gene            complement(313701..315185)
FT                   /locus_tag="SP_0341"
FT   CDS_pept        complement(313701..315185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74515"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SJ8"
FT                   /protein_id="AAK74515.1"
FT   gene            315338..316945
FT                   /gene="dexB"
FT                   /locus_tag="SP_0342"
FT   CDS_pept        315338..316945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dexB"
FT                   /locus_tag="SP_0342"
FT                   /product="glucan 1,6-alpha-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:3320387; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74516"
FT                   /db_xref="GOA:Q54796"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q54796"
FT                   /protein_id="AAK74516.1"
FT                   VLEKQVLAPWDAFCVELL"
FT   gene            complement(317355..318701)
FT                   /locus_tag="SP_0343"
FT   CDS_pept        complement(317355..318701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0343"
FT                   /product="IS1380-Spn1, transposase"
FT                   /note="identified by similarity to GP:8163721; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74517"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2US47"
FT                   /protein_id="AAK74517.1"
FT   gene            complement(318978..319316)
FT                   /locus_tag="SP_0344"
FT   CDS_pept        complement(318978..319316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0344"
FT                   /product="IS630-Spn1, transposase Orf2"
FT                   /note="identified by similarity to GP:5019553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74518"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE8"
FT                   /protein_id="AAK74518.1"
FT                   LLSCSCFN"
FT   gene            complement(319495..319842)
FT                   /locus_tag="SP_0345"
FT   CDS_pept        complement(319495..319842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0345"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /note="identified by similarity to GP:4200438; match to
FT                   protein family HMM PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75784"
FT                   /db_xref="GOA:A0A0H2UNB9"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNB9"
FT                   /protein_id="ABC75784.1"
FT                   GYTRKKEPHLL"
FT   gene            320077..321522
FT                   /gene="cps4A"
FT                   /locus_tag="SP_0346"
FT   CDS_pept        320077..321522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4A"
FT                   /locus_tag="SP_0346"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4A"
FT                   /note="identified by match to protein family HMM PF02916;
FT                   match to protein family HMM PF03816; match to protein
FT                   family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74519"
FT                   /db_xref="GOA:A0A0H2UNF1"
FT                   /db_xref="InterPro:IPR004190"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF1"
FT                   /protein_id="AAK74519.1"
FT   gene            321524..322255
FT                   /gene="cps4B"
FT                   /locus_tag="SP_0347"
FT   CDS_pept        321524..322255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4B"
FT                   /locus_tag="SP_0347"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4B"
FT                   /note="identified by similarity to GP:3550628; match to
FT                   protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74520"
FT                   /db_xref="GOA:Q9AHD4"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PDB:2WJD"
FT                   /db_xref="PDB:2WJE"
FT                   /db_xref="PDB:2WJF"
FT                   /db_xref="PDB:3QY8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AHD4"
FT                   /protein_id="AAK74520.1"
FT   gene            322264..322956
FT                   /gene="cps4C"
FT                   /locus_tag="SP_0348"
FT   CDS_pept        322264..322956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4C"
FT                   /locus_tag="SP_0348"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4C"
FT                   /note="identified by similarity to EGAD:15994; match to
FT                   protein family HMM PF02706; match to protein family HMM
FT                   TIGR01006"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74521"
FT                   /db_xref="GOA:Q97SJ6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SJ6"
FT                   /protein_id="AAK74521.1"
FT                   VPNLGKLK"
FT   gene            322966..323649
FT                   /gene="cps4D"
FT                   /locus_tag="SP_0349"
FT   CDS_pept        322966..323649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4D"
FT                   /locus_tag="SP_0349"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4D"
FT                   /note="identified by similarity to EGAD:19337; match to
FT                   protein family HMM TIGR01007"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74522"
FT                   /db_xref="GOA:Q9AHD2"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AHD2"
FT                   /protein_id="AAK74522.1"
FT                   NYGKK"
FT   gene            323990..324625
FT                   /gene="cps4E"
FT                   /locus_tag="SP_0350"
FT   CDS_pept        323990..324625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4E"
FT                   /locus_tag="SP_0350"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4E"
FT                   /note="identified by similarity to GP:3411126; match to
FT                   protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74523"
FT                   /db_xref="GOA:A0A0H2UNI5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI5"
FT                   /protein_id="AAK74523.1"
FT   gene            324634..325863
FT                   /gene="cps4F"
FT                   /locus_tag="SP_0351"
FT   CDS_pept        324634..325863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4F"
FT                   /locus_tag="SP_0351"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4F"
FT                   /note="identified by similarity to GP:1657651; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74524"
FT                   /db_xref="GOA:A0A0H2UNL7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL7"
FT                   /protein_id="AAK74524.1"
FT                   TCLERESKKE"
FT   gene            325868..326944
FT                   /gene="cps4G"
FT                   /locus_tag="SP_0352"
FT   CDS_pept        325868..326944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4G"
FT                   /locus_tag="SP_0352"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4G"
FT                   /note="identified by similarity to GP:1657647"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74525"
FT                   /db_xref="GOA:A0A0H2UNE9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNE9"
FT                   /protein_id="AAK74525.1"
FT                   KTEIELEKRILSLRKKND"
FT   gene            326937..328055
FT                   /gene="cps4H"
FT                   /locus_tag="SP_0353"
FT   CDS_pept        326937..328055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4H"
FT                   /locus_tag="SP_0353"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4H"
FT                   /note="identified by similarity to GP:9996704; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74526"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF4"
FT                   /protein_id="AAK74526.1"
FT   gene            328056..329456
FT                   /locus_tag="SP_0354"
FT   CDS_pept        328056..329456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0354"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74527"
FT                   /db_xref="GOA:A0A0H2UNF7"
FT                   /db_xref="InterPro:IPR029468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF7"
FT                   /protein_id="AAK74527.1"
FT                   FIFRRLKK"
FT   gene            329456..330538
FT                   /locus_tag="SP_0355"
FT   CDS_pept        329456..330538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74528"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ0"
FT                   /protein_id="AAK74528.1"
FT   gene            330528..331769
FT                   /locus_tag="SP_0356"
FT   CDS_pept        330528..331769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0356"
FT                   /product="putative polysaccharide transporter"
FT                   /note="identified by similarity to EGAD:8775; match to
FT                   protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74529"
FT                   /db_xref="GOA:A0A0H2UNM3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM3"
FT                   /protein_id="AAK74529.1"
FT                   LIYFKNRSLFVRSK"
FT   gene            331774..332871
FT                   /gene="cps4I"
FT                   /locus_tag="SP_0357"
FT   CDS_pept        331774..332871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4I"
FT                   /locus_tag="SP_0357"
FT                   /product="UDP-N-acetylglucosamine-2-epimerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02350;
FT                   match to protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74530"
FT                   /db_xref="GOA:A0A0H2UNF3"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF3"
FT                   /protein_id="AAK74530.1"
FT   gene            332875..333930
FT                   /gene="cap4J"
FT                   /locus_tag="SP_0358"
FT   CDS_pept        332875..333930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap4J"
FT                   /locus_tag="SP_0358"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4J"
FT                   /note="identified by similarity to GP:1657644; match to
FT                   protein family HMM PF02719; match to protein family HMM
FT                   PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74531"
FT                   /db_xref="GOA:A0A0H2UNF8"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNF8"
FT                   /protein_id="AAK74531.1"
FT                   AIRDMVADEEM"
FT   gene            334030..335259
FT                   /gene="cps4K"
FT                   /locus_tag="SP_0359"
FT   CDS_pept        334030..335259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4K"
FT                   /locus_tag="SP_0359"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4K"
FT                   /note="identified by similarity to GP:1773345; match to
FT                   protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74532"
FT                   /db_xref="GOA:A0A0H2UNG2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG2"
FT                   /protein_id="AAK74532.1"
FT                   PDTFFEQVEK"
FT   gene            335260..336444
FT                   /gene="cps4L"
FT                   /locus_tag="SP_0360"
FT   CDS_pept        335260..336444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4L"
FT                   /locus_tag="SP_0360"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02350;
FT                   match to protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74533"
FT                   /db_xref="GOA:A0A0H2UNJ4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ4"
FT                   /protein_id="AAK74533.1"
FT   gene            complement(336639..336740)
FT                   /locus_tag="SP_0361"
FT   CDS_pept        complement(336639..336740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0361"
FT                   /product="IS1167, transposase, truncation"
FT                   /note="identified by similarity to GP:2804700"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75799"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XDV4"
FT                   /protein_id="ABC75799.1"
FT   gene            complement(336807..337914)
FT                   /pseudo
FT                   /locus_tag="SP_0362"
FT                   /note="This gene has an N-terminal truncation, and is
FT                   interrupted by an RUP element. IRleft =
FT                   family element, Orf3, degenerate; this gene contains a
FT                   frame shift which is not the result of sequencing error;
FT                   identified by similarity to GP:6009427"
FT   gene            337984..338250
FT                   /locus_tag="SP_0363"
FT   CDS_pept        337984..338250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0363"
FT                   /product="transposase family protein, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75796"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XDB7"
FT                   /protein_id="ABC75796.1"
FT   gene            complement(338273..338728)
FT                   /pseudo
FT                   /locus_tag="SP_0364"
FT                   /note="An RUP element disrupts the C-terminus of this gene.
FT                   IRleft = GTAAGCGCGTCATAACAAGG. IRright =
FT                   GTAACCGCCCAATAACGAAG.; IS66 family element, Orf2,
FT                   interruption; this gene contains a premature stop which is
FT                   not the result of sequencing error; identified by
FT                   similarity to GP:6009406"
FT   gene            complement(338709..338946)
FT                   /pseudo
FT                   /locus_tag="SP_0365"
FT                   /note="Gene assignment is based on location within inverted
FT                   repeats which also flank genes (Orf2 and Orf3-5) that
FT                   resemble IS679. IRleft = GTAAGCGCGTCATAACAAGG. IRright =
FT                   GTAACCGCCCAATAACGAAG.; IS66 family element, Orf1, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            339096..341081
FT                   /gene="aliA"
FT                   /locus_tag="SP_0366"
FT   CDS_pept        339096..341081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aliA"
FT                   /locus_tag="SP_0366"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein AliA"
FT                   /note="identified by similarity to SP:P35592; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74534"
FT                   /db_xref="GOA:P35592"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35592"
FT                   /protein_id="AAK74534.1"
FT   gene            341229..341348
FT                   /locus_tag="SP_0367"
FT   CDS_pept        341229..341348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74535"
FT                   /db_xref="GOA:A0A0H2UNM9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM9"
FT                   /protein_id="AAK74535.1"
FT   gene            341383..346686
FT                   /locus_tag="SP_0368"
FT   CDS_pept        341383..346686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0368"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by similarity to GP:1658320; match to
FT                   protein family HMM PF00397; match to protein family HMM
FT                   PF00746; match to protein family HMM PF00754; match to
FT                   protein family HMM PF04650; match to protein family HMM
FT                   TIGR01167; match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75807"
FT                   /db_xref="GOA:Q2MGH6"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025706"
FT                   /db_xref="InterPro:IPR035364"
FT                   /db_xref="InterPro:IPR040502"
FT                   /db_xref="InterPro:IPR040575"
FT                   /db_xref="InterPro:IPR040633"
FT                   /db_xref="PDB:5A55"
FT                   /db_xref="PDB:5A56"
FT                   /db_xref="PDB:5A57"
FT                   /db_xref="PDB:5A58"
FT                   /db_xref="PDB:5A59"
FT                   /db_xref="PDB:5A5A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2MGH6"
FT                   /protein_id="ABC75807.1"
FT                   SALFVVKTKKD"
FT   gene            complement(346853..349012)
FT                   /gene="pbp1A"
FT                   /locus_tag="SP_0369"
FT   CDS_pept        complement(346853..349012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1A"
FT                   /locus_tag="SP_0369"
FT                   /product="penicillin-binding protein 1A"
FT                   /note="identified by similarity to SP:Q04707; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912; match to protein family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74536"
FT                   /db_xref="GOA:Q04707"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="PDB:2ZC5"
FT                   /db_xref="PDB:2ZC6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04707"
FT                   /protein_id="AAK74536.1"
FT   gene            complement(349009..349605)
FT                   /gene="recU"
FT                   /locus_tag="SP_0370"
FT   CDS_pept        complement(349009..349605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SP_0370"
FT                   /product="recombination protein U"
FT                   /note="identified by similarity to EGAD:24099; match to
FT                   protein family HMM PF03838; match to protein family HMM
FT                   TIGR00648"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74537"
FT                   /db_xref="GOA:P0A455"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A455"
FT                   /protein_id="AAK74537.1"
FT   gene            349671..350198
FT                   /locus_tag="SP_0371"
FT   CDS_pept        349671..350198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:37709; match to
FT                   protein family HMM PF06908"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74538"
FT                   /db_xref="GOA:Q97SJ0"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SJ0"
FT                   /protein_id="AAK74538.1"
FT                   ELNELAENFSEN"
FT   gene            350268..350597
FT                   /locus_tag="SP_0372"
FT   CDS_pept        350268..350597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:37710; match to
FT                   protein family HMM PF05103"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74539"
FT                   /db_xref="GOA:Q97SI9"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SI9"
FT                   /protein_id="AAK74539.1"
FT                   DNSDF"
FT   gene            351083..352240
FT                   /locus_tag="SP_0373"
FT   CDS_pept        351083..352240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:48783; match to
FT                   protein family HMM PF01170"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74540"
FT                   /db_xref="GOA:A0A0H2UNG1"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG1"
FT                   /protein_id="AAK74540.1"
FT   gene            352253..353647
FT                   /locus_tag="SP_0374"
FT   CDS_pept        352253..353647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0374"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74541"
FT                   /db_xref="GOA:A0A0H2UNG3"
FT                   /db_xref="InterPro:IPR030858"
FT                   /db_xref="InterPro:IPR040532"
FT                   /db_xref="InterPro:IPR041295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG3"
FT                   /protein_id="AAK74541.1"
FT                   ADDLDY"
FT   gene            353723..355147
FT                   /gene="gnd"
FT                   /locus_tag="SP_0375"
FT   CDS_pept        353723..355147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="SP_0375"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:37374; match to
FT                   protein family HMM PF00393; match to protein family HMM
FT                   PF03446; match to protein family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74542"
FT                   /db_xref="GOA:A0A0H2UNG6"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG6"
FT                   /protein_id="AAK74542.1"
FT                   RKDKEGTFHYSWYDEK"
FT   gene            355159..355848
FT                   /locus_tag="SP_0376"
FT   CDS_pept        355159..355848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0376"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74543"
FT                   /db_xref="GOA:A0A0H2UNK2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK2"
FT                   /protein_id="AAK74543.1"
FT                   VGYTMQE"
FT   gene            355947..356969
FT                   /gene="cbpC"
FT                   /locus_tag="SP_0377"
FT   CDS_pept        355947..356969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpC"
FT                   /locus_tag="SP_0377"
FT                   /product="choline binding protein C"
FT                   /note="identified by similarity to GP:1914875; similarity
FT                   to GP:9454354; match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74544"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN3"
FT                   /protein_id="AAK74544.1"
FT                   "
FT   gene            356987..357985
FT                   /gene="cbpJ"
FT                   /locus_tag="SP_0378"
FT   CDS_pept        356987..357985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpJ"
FT                   /locus_tag="SP_0378"
FT                   /product="choline binding protein J"
FT                   /note="identified by similarity to GP:9454358; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74545"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="PDB:6JYX"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH0"
FT                   /protein_id="AAK74545.1"
FT   gene            complement(358103..359335)
FT                   /locus_tag="SP_0379"
FT   CDS_pept        complement(358103..359335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3582221; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74546"
FT                   /db_xref="GOA:A0A0H2UNG7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNG7"
FT                   /protein_id="AAK74546.1"
FT                   CQWLVKFNTHN"
FT   gene            complement(359378..360253)
FT                   /locus_tag="SP_0380"
FT   CDS_pept        complement(359378..360253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74547"
FT                   /db_xref="GOA:A0A0H2UNH1"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH1"
FT                   /protein_id="AAK74547.1"
FT                   IGSMGYIGVY"
FT   gene            361318..362196
FT                   /gene="mvaK1"
FT                   /locus_tag="SP_0381"
FT   CDS_pept        361318..362196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /locus_tag="SP_0381"
FT                   /product="mevalonate kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:9937407; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   TIGR00549"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74548"
FT                   /db_xref="GOA:A0A0H2UNK6"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="PDB:2OI2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK6"
FT                   /protein_id="AAK74548.1"
FT                   KGAVQTWIESL"
FT   gene            362178..363131
FT                   /gene="mvaD"
FT                   /locus_tag="SP_0382"
FT   CDS_pept        362178..363131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SP_0382"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /note="identified by similarity to GP:9937408; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   TIGR01240"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74549"
FT                   /db_xref="GOA:A0A0H2UNP0"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP0"
FT                   /protein_id="AAK74549.1"
FT   gene            363118..364125
FT                   /gene="mvaK2"
FT                   /locus_tag="SP_0383"
FT   CDS_pept        363118..364125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="SP_0383"
FT                   /product="phosphomevalonate kinase"
FT                   /note="identified by similarity to GP:9937409; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   TIGR01220"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74550"
FT                   /db_xref="GOA:A0A0H2UNH6"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH6"
FT                   /protein_id="AAK74550.1"
FT   gene            364109..365119
FT                   /locus_tag="SP_0384"
FT   CDS_pept        364109..365119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0384"
FT                   /product="FMN-dependent dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF01070;
FT                   match to protein family HMM TIGR02151"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74551"
FT                   /db_xref="GOA:Q97SH8"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SH8"
FT                   /protein_id="AAK74551.1"
FT   gene            365196..365894
FT                   /locus_tag="SP_0385"
FT   CDS_pept        365196..365894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108483"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74552"
FT                   /db_xref="GOA:A0A0H2UNH4"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH4"
FT                   /protein_id="AAK74552.1"
FT                   MIGDVEVVRG"
FT   gene            365891..366886
FT                   /locus_tag="SP_0386"
FT   CDS_pept        365891..366886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0386"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by similarity to GP:5830526; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74553"
FT                   /db_xref="GOA:A0A0H2UNH7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH7"
FT                   /protein_id="AAK74553.1"
FT   gene            366900..367532
FT                   /locus_tag="SP_0387"
FT   CDS_pept        366900..367532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0387"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74554"
FT                   /db_xref="GOA:A0A0H2UNL2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL2"
FT                   /protein_id="AAK74554.1"
FT   gene            367636..368301
FT                   /pseudo
FT                   /locus_tag="SP_0388"
FT                   /note="This gene is interrupted by a BOX element which is
FT                   present in many copies in this genome.; conserved
FT                   hypothetical protein; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   similarity to GP:8977912"
FT   gene            368451..368690
FT                   /locus_tag="SP_0389"
FT   CDS_pept        368451..368690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0389"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP5"
FT                   /protein_id="AAK74555.1"
FT   gene            368735..369592
FT                   /gene="cbpG"
FT                   /locus_tag="SP_0390"
FT   CDS_pept        368735..369592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpG"
FT                   /locus_tag="SP_0390"
FT                   /product="choline binding protein G"
FT                   /note="identified by similarity to GP:9454353; match to
FT                   protein family HMM PF00089; match to protein family HMM
FT                   PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74556"
FT                   /db_xref="GOA:A0A0H2UNI2"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI2"
FT                   /protein_id="AAK74556.1"
FT                   GEWI"
FT   gene            369611..370633
FT                   /gene="cbpF"
FT                   /locus_tag="SP_0391"
FT   CDS_pept        369611..370633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpF"
FT                   /locus_tag="SP_0391"
FT                   /product="choline binding protein F"
FT                   /note="identified by similarity to GP:9454354; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74557"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNH9"
FT                   /protein_id="AAK74557.1"
FT                   "
FT   gene            complement(370761..371592)
FT                   /pseudo
FT                   /locus_tag="SP_0392"
FT                   /note="IS3-Spn1, transposase, degenerate; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:8163693"
FT   gene            complement(371592..372101)
FT                   /pseudo
FT                   /locus_tag="SP_0393"
FT                   /note="IS3-Spn1, hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:8163692"
FT   gene            372310..374079
FT                   /locus_tag="SP_0394"
FT   CDS_pept        372310..374079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0394"
FT                   /product="PTS system, mannitol-specific IIBC components"
FT                   /note="identified by similarity to EGAD:37996; match to
FT                   protein family HMM PF02302; match to protein family HMM
FT                   PF02378; match to protein family HMM TIGR00851"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74558"
FT                   /db_xref="GOA:Q97SH4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SH4"
FT                   /protein_id="AAK74558.1"
FT                   TPEYDKMAARMYK"
FT   gene            374103..376058
FT                   /locus_tag="SP_0395"
FT   CDS_pept        374103..376058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0395"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to GP:3025455"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74559"
FT                   /db_xref="GOA:A0A0H2UNI1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI1"
FT                   /protein_id="AAK74559.1"
FT                   QMLNTIFNEKIKKLEN"
FT   gene            376060..376497
FT                   /gene="mtlF"
FT                   /locus_tag="SP_0396"
FT   CDS_pept        376060..376497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="SP_0396"
FT                   /product="PTS system, mannitol-specific IIA component"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:14326; match to
FT                   protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74560"
FT                   /db_xref="GOA:A0A0H2UNL8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL8"
FT                   /protein_id="AAK74560.1"
FT   gene            376559..377695
FT                   /gene="mtlD"
FT                   /locus_tag="SP_0397"
FT   CDS_pept        376559..377695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="SP_0397"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:16282; match to
FT                   protein family HMM PF01232; match to protein family HMM
FT                   PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74561"
FT                   /db_xref="GOA:Q97SH1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SH1"
FT                   /protein_id="AAK74561.1"
FT   gene            377853..378011
FT                   /locus_tag="SP_0398"
FT   CDS_pept        377853..378011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP8"
FT                   /protein_id="AAK74562.1"
FT                   FLLRLSF"
FT   gene            378019..378177
FT                   /pseudo
FT                   /locus_tag="SP_0399"
FT                   /note="glutamine ABC transporter, ATP-binding protein,
FT                   truncation; comparison of this gene to its homologs
FT                   suggests this gene has been truncated; identified by
FT                   similarity to EGAD:40185"
FT   gene            378481..379764
FT                   /gene="tig"
FT                   /locus_tag="SP_0400"
FT   CDS_pept        378481..379764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SP_0400"
FT                   /product="trigger factor"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74563"
FT                   /db_xref="GOA:Q97SG9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SG9"
FT                   /protein_id="AAK74563.1"
FT   gene            complement(379812..382178)
FT                   /locus_tag="SP_0401"
FT   CDS_pept        complement(379812..382178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0401"
FT                   /product="putative helicase"
FT                   /note="identified by match to protein family HMM TIGR01448"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74564"
FT                   /db_xref="GOA:A0A0H2UNJ2"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ2"
FT                   /protein_id="AAK74564.1"
FT   gene            complement(382457..383071)
FT                   /gene="spi"
FT                   /locus_tag="SP_0402"
FT   CDS_pept        complement(382457..383071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spi"
FT                   /locus_tag="SP_0402"
FT                   /product="signal peptidase I"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:O07344; match to
FT                   protein family HMM PF00717; match to protein family HMM
FT                   TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74565"
FT                   /db_xref="GOA:O07344"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07344"
FT                   /protein_id="AAK74565.1"
FT   gene            complement(383075..383956)
FT                   /gene="rnhC"
FT                   /locus_tag="SP_0403"
FT   CDS_pept        complement(383075..383956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /locus_tag="SP_0403"
FT                   /product="ribonuclease HIII"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:O07874; match to
FT                   protein family HMM PF01351; match to protein family HMM
FT                   TIGR00716"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74566"
FT                   /db_xref="GOA:O07874"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07874"
FT                   /protein_id="AAK74566.1"
FT                   KNTEKAKKRLER"
FT   gene            384034..384345
FT                   /locus_tag="SP_0404"
FT   CDS_pept        384034..384345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74567"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI4"
FT                   /protein_id="AAK74567.1"
FT   gene            384342..384890
FT                   /locus_tag="SP_0405"
FT   CDS_pept        384342..384890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107723; match to
FT                   protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74568"
FT                   /db_xref="GOA:A0A0H2UNI6"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI6"
FT                   /protein_id="AAK74568.1"
FT   gene            384994..387330
FT                   /locus_tag="SP_0406"
FT   CDS_pept        384994..387330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0406"
FT                   /product="MutS2 family protein"
FT                   /note="Function of MutS2 is unknown. It should not be
FT                   considered a DNA mismatch repair protein. It is likely a
FT                   DNA mismatch binding protein of unknown cellular function.;
FT                   identified by match to protein family HMM PF00488; match to
FT                   protein family HMM PF01713; match to protein family HMM
FT                   TIGR01069"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74569"
FT                   /db_xref="GOA:Q97SG5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SG5"
FT                   /protein_id="AAK74569.1"
FT   gene            complement(387451..387552)
FT                   /locus_tag="SP_0407"
FT   CDS_pept        complement(387451..387552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM2"
FT                   /protein_id="AAK74570.1"
FT   gene            387673..388995
FT                   /locus_tag="SP_0408"
FT   CDS_pept        387673..388995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0408"
FT                   /product="sodium:alanine symporter family protein"
FT                   /note="identified by match to protein family HMM PF01235;
FT                   match to protein family HMM TIGR00835"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74571"
FT                   /db_xref="GOA:A0A0H2UNQ2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ2"
FT                   /protein_id="AAK74571.1"
FT   gene            389213..389761
FT                   /locus_tag="SP_0409"
FT   CDS_pept        389213..389761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:175822; match to
FT                   protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74572"
FT                   /db_xref="GOA:A0A0H2UNJ6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ6"
FT                   /protein_id="AAK74572.1"
FT   gene            389871..390770
FT                   /locus_tag="SP_0410"
FT   CDS_pept        389871..390770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0410"
FT                   /product="putative exfoliative toxin"
FT                   /note="identified by similarity to GP:9757655"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74573"
FT                   /db_xref="GOA:A0A0H2UNI7"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI7"
FT                   /protein_id="AAK74573.1"
FT                   TILFFVLGAYLIWLRKKV"
FT   gene            complement(390795..392069)
FT                   /gene="serS"
FT                   /locus_tag="SP_0411"
FT   CDS_pept        complement(390795..392069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SP_0411"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74574"
FT                   /db_xref="GOA:Q97SG0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SG0"
FT                   /protein_id="AAK74574.1"
FT   gene            complement(392282..392653)
FT                   /locus_tag="SP_0412"
FT   CDS_pept        complement(392282..392653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5669858; match to
FT                   protein family HMM PF06115"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74575"
FT                   /db_xref="GOA:A0A0H2UNI9"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNI9"
FT                   /protein_id="AAK74575.1"
FT   gene            complement(392656..394020)
FT                   /locus_tag="SP_0413"
FT   CDS_pept        complement(392656..394020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0413"
FT                   /product="aspartate kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:9487; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF01842; match to protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74576"
FT                   /db_xref="GOA:A0A0H2UNM5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM5"
FT                   /protein_id="AAK74576.1"
FT   gene            complement(394104..394208)
FT                   /locus_tag="SP_0414"
FT   CDS_pept        complement(394104..394208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0414"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74577"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ7"
FT                   /protein_id="AAK74577.1"
FT   gene            394345..395130
FT                   /locus_tag="SP_0415"
FT   CDS_pept        394345..395130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0415"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74578"
FT                   /db_xref="GOA:A0A0H2UNJ9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ9"
FT                   /protein_id="AAK74578.1"
FT   gene            395224..395658
FT                   /locus_tag="SP_0416"
FT   CDS_pept        395224..395658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0416"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74579"
FT                   /db_xref="GOA:A0A0H2UNJ1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ1"
FT                   /protein_id="AAK74579.1"
FT   gene            395658..396632
FT                   /gene="fabH"
FT                   /locus_tag="SP_0417"
FT   CDS_pept        395658..396632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="SP_0417"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:23257; match to
FT                   protein family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74580"
FT                   /db_xref="GOA:P0A3C5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3C5"
FT                   /protein_id="AAK74580.1"
FT   gene            396692..396916
FT                   /gene="acpP"
FT                   /locus_tag="SP_0418"
FT   CDS_pept        396692..396916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="SP_0418"
FT                   /product="acyl carrier protein"
FT                   /note="identified by similarity to EGAD:37837; match to
FT                   protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74581"
FT                   /db_xref="GOA:P0A2W0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2W0"
FT                   /protein_id="AAK74581.1"
FT   gene            397035..398009
FT                   /gene="fabK"
FT                   /locus_tag="SP_0419"
FT   CDS_pept        397035..398009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabK"
FT                   /locus_tag="SP_0419"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:9789231; match to
FT                   protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74582"
FT                   /db_xref="GOA:A0A0H2UNJ5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ5"
FT                   /protein_id="AAK74582.1"
FT   gene            398002..398922
FT                   /gene="fabD"
FT                   /locus_tag="SP_0420"
FT   CDS_pept        398002..398922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SP_0420"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P25715; match to
FT                   protein family HMM PF00698; match to protein family HMM
FT                   TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74583"
FT                   /db_xref="GOA:A0A0H2UNN0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN0"
FT                   /protein_id="AAK74583.1"
FT   gene            398956..399687
FT                   /gene="fabG"
FT                   /locus_tag="SP_0421"
FT   CDS_pept        398956..399687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SP_0421"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:108288; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   PF07993; match to protein family HMM TIGR01830"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74584"
FT                   /db_xref="GOA:A0A0H2UNR2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR2"
FT                   /protein_id="AAK74584.1"
FT   gene            399709..400944
FT                   /gene="fabF"
FT                   /locus_tag="SP_0422"
FT   CDS_pept        399709..400944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SP_0422"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P39435; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74585"
FT                   /db_xref="GOA:A0A0H2UNK4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK4"
FT                   /protein_id="AAK74585.1"
FT                   NAVLAFKRWENR"
FT   gene            400947..401432
FT                   /gene="accB"
FT                   /locus_tag="SP_0423"
FT   CDS_pept        400947..401432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SP_0423"
FT                   /product="acetyl-CoA carboxylase, bitoin carboxyl carrier
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM TIGR00531"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74586"
FT                   /db_xref="GOA:A0A0H2UNJ7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNJ7"
FT                   /protein_id="AAK74586.1"
FT   gene            401429..401851
FT                   /gene="fabZ"
FT                   /locus_tag="SP_0424"
FT   CDS_pept        401429..401851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SP_0424"
FT                   /product="(3R)-hydroxymyristoyl-(acyl-carrier-protein)
FT                   dehydratase"
FT                   /note="identified by similarity to EGAD:12613; match to
FT                   protein family HMM PF03061; match to protein family HMM
FT                   PF07977; match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74587"
FT                   /db_xref="GOA:P59201"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59201"
FT                   /protein_id="AAK74587.1"
FT   gene            401863..403230
FT                   /gene="accC"
FT                   /locus_tag="SP_0425"
FT   CDS_pept        401863..403230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SP_0425"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:17503; match to
FT                   protein family HMM PF00289; match to protein family HMM
FT                   PF02785; match to protein family HMM PF02786; match to
FT                   protein family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74588"
FT                   /db_xref="GOA:A0A0H2UNK1"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK1"
FT                   /protein_id="AAK74588.1"
FT   gene            403267..404133
FT                   /gene="accD"
FT                   /locus_tag="SP_0426"
FT   CDS_pept        403267..404133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="SP_0426"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74589"
FT                   /db_xref="GOA:P0CC08"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CC08"
FT                   /protein_id="AAK74589.1"
FT                   LHGGSPR"
FT   gene            404130..404897
FT                   /gene="accA"
FT                   /locus_tag="SP_0427"
FT   CDS_pept        404130..404897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SP_0427"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74590"
FT                   /db_xref="GOA:Q9FBB7"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBB7"
FT                   /protein_id="AAK74590.1"
FT   gene            404908..405015
FT                   /locus_tag="SP_0428"
FT   CDS_pept        404908..405015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN5"
FT                   /protein_id="AAK74591.1"
FT   gene            405056..405241
FT                   /locus_tag="SP_0429"
FT   CDS_pept        405056..405241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74592"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR8"
FT                   /protein_id="AAK74592.1"
FT                   ALNSYIDAWKYGFRAG"
FT   gene            405214..405732
FT                   /locus_tag="SP_0430"
FT   CDS_pept        405214..405732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74593"
FT                   /db_xref="GOA:A0A0H2UNK9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK9"
FT                   /protein_id="AAK74593.1"
FT                   GYFMNTFFP"
FT   gene            405745..405981
FT                   /locus_tag="SP_0431"
FT   CDS_pept        405745..405981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0431"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74594"
FT                   /db_xref="GOA:A0A0H2UNK0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK0"
FT                   /protein_id="AAK74594.1"
FT   gene            406163..407469
FT                   /pseudo
FT                   /locus_tag="SP_0432"
FT                   /note="IS1167, transposase, interruption; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:2804700"
FT   gene            complement(407504..407926)
FT                   /gene="nusB"
FT                   /locus_tag="SP_0433"
FT   CDS_pept        complement(407504..407926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SP_0433"
FT                   /product="N utilization substance protein B"
FT                   /note="identified by similarity to EGAD:24212; match to
FT                   protein family HMM PF01029; match to protein family HMM
FT                   TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74595"
FT                   /db_xref="GOA:P65582"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65582"
FT                   /protein_id="AAK74595.1"
FT   gene            complement(407919..408308)
FT                   /locus_tag="SP_0434"
FT   CDS_pept        complement(407919..408308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:40949; similarity
FT                   to EGAD:45861; match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74596"
FT                   /db_xref="GOA:A0A0H2UNK7"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK7"
FT                   /protein_id="AAK74596.1"
FT   gene            complement(408330..408890)
FT                   /gene="efp"
FT                   /locus_tag="SP_0435"
FT   CDS_pept        complement(408330..408890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="SP_0435"
FT                   /product="translation elongation factor P"
FT                   /note="identified by similarity to SP:P33398; match to
FT                   protein family HMM PF01132; match to protein family HMM
FT                   PF08207; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74597"
FT                   /db_xref="GOA:P64042"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64042"
FT                   /protein_id="AAK74597.1"
FT   gene            complement(409019..410461)
FT                   /gene="gatB"
FT                   /locus_tag="SP_0436"
FT   CDS_pept        complement(409019..410461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="SP_0436"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74598"
FT                   /db_xref="GOA:Q97SE7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SE7"
FT                   /protein_id="AAK74598.1"
FT   gene            complement(410461..411927)
FT                   /gene="gatA"
FT                   /locus_tag="SP_0437"
FT   CDS_pept        complement(410461..411927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="SP_0437"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74599"
FT                   /db_xref="GOA:Q97SE6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SE6"
FT                   /protein_id="AAK74599.1"
FT   gene            complement(411927..412229)
FT                   /gene="gatC"
FT                   /locus_tag="SP_0438"
FT   CDS_pept        complement(411927..412229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SP_0438"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74600"
FT                   /db_xref="GOA:Q97SE5"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SE5"
FT                   /protein_id="AAK74600.1"
FT   gene            412442..413986
FT                   /gene="prfC"
FT                   /locus_tag="SP_0439"
FT   CDS_pept        412442..413986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="SP_0439"
FT                   /product="peptide chain release factor 3"
FT                   /note="identified by similarity to SP:P33998; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM TIGR00231; match to
FT                   protein family HMM TIGR00503"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74601"
FT                   /db_xref="GOA:Q97SE4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SE4"
FT                   /protein_id="AAK74601.1"
FT   gene            414269..414753
FT                   /pseudo
FT                   /locus_tag="SP_0440"
FT                   /note="glycosyl transferase, degenerate; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by similarity to GP:6760462"
FT   gene            414869..415057
FT                   /gene="rpmB"
FT                   /locus_tag="SP_0441"
FT   CDS_pept        414869..415057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SP_0441"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by similarity to EGAD:21484; match to
FT                   protein family HMM PF00830; match to protein family HMM
FT                   TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74602"
FT                   /db_xref="GOA:P66155"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66155"
FT                   /protein_id="AAK74602.1"
FT                   KVWASARALKSGKVERV"
FT   gene            415214..415579
FT                   /locus_tag="SP_0442"
FT   CDS_pept        415214..415579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:40949; similarity
FT                   to EGAD:108275; match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74603"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN8"
FT                   /protein_id="AAK74603.1"
FT                   TAQTVNVYIQNIKVVGE"
FT   gene            415582..417249
FT                   /locus_tag="SP_0443"
FT   CDS_pept        415582..417249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108277; match to
FT                   protein family HMM PF02734"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74604"
FT                   /db_xref="GOA:A0A0H2UNS2"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS2"
FT                   /protein_id="AAK74604.1"
FT   gene            complement(417236..417337)
FT                   /locus_tag="SP_0444"
FT   CDS_pept        complement(417236..417337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL4"
FT                   /protein_id="AAK74605.1"
FT   gene            417449..419149
FT                   /gene="ilvB"
FT                   /locus_tag="SP_0445"
FT   CDS_pept        417449..419149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SP_0445"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02776; match to protein
FT                   family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74606"
FT                   /db_xref="GOA:A0A0H2UNK5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNK5"
FT                   /protein_id="AAK74606.1"
FT   gene            419142..419618
FT                   /gene="ilvN"
FT                   /locus_tag="SP_0446"
FT   CDS_pept        419142..419618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="SP_0446"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74607"
FT                   /db_xref="GOA:A0A0H2UNL0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL0"
FT                   /protein_id="AAK74607.1"
FT   gene            419696..420706
FT                   /gene="ilvC"
FT                   /locus_tag="SP_0447"
FT   CDS_pept        419696..420706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SP_0447"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:13826; match to
FT                   protein family HMM PF01450; match to protein family HMM
FT                   PF07991; match to protein family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74608"
FT                   /db_xref="GOA:Q97SD7"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SD7"
FT                   /protein_id="AAK74608.1"
FT   gene            420783..421049
FT                   /locus_tag="SP_0448"
FT   CDS_pept        420783..421049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0448"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP2"
FT                   /protein_id="AAK74609.1"
FT   gene            421287..421643
FT                   /locus_tag="SP_0449"
FT   CDS_pept        421287..421643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS7"
FT                   /protein_id="AAK74610.1"
FT                   HKYHESVTEVFGDE"
FT   gene            421693..422943
FT                   /gene="ilvA"
FT                   /locus_tag="SP_0450"
FT   CDS_pept        421693..422943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="SP_0450"
FT                   /product="threonine dehydratase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37946; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   PF00585; match to protein family HMM TIGR02079"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74611"
FT                   /db_xref="GOA:A0A0H2UNL9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL9"
FT                   /protein_id="AAK74611.1"
FT                   PAYINLNGNETLYNMLV"
FT   gene            423678..423893
FT                   /locus_tag="SP_0451"
FT   CDS_pept        423678..423893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL1"
FT                   /protein_id="AAK74612.1"
FT   gene            complement(424002..424742)
FT                   /locus_tag="SP_0452"
FT   CDS_pept        complement(424002..424742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0452"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P27675; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74613"
FT                   /db_xref="GOA:A0A0H2UNL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL6"
FT                   /protein_id="AAK74613.1"
FT   gene            complement(424742..426307)
FT                   /locus_tag="SP_0453"
FT   CDS_pept        complement(424742..426307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0453"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein/permease protein"
FT                   /note="identified by similarity to EGAD:9064; match to
FT                   protein family HMM PF00497; match to protein family HMM
FT                   PF00528; match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74614"
FT                   /db_xref="GOA:A0A0H2UNP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP9"
FT                   /protein_id="AAK74614.1"
FT                   EDLK"
FT   gene            426442..428334
FT                   /locus_tag="SP_0454"
FT   CDS_pept        426442..428334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74615"
FT                   /db_xref="GOA:A0A0H2UNT1"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT1"
FT                   /protein_id="AAK74615.1"
FT   gene            complement(428331..428501)
FT                   /locus_tag="SP_0455"
FT   CDS_pept        complement(428331..428501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74616"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM4"
FT                   /protein_id="AAK74616.1"
FT                   YHTFSVYGSSL"
FT   gene            complement(428528..429652)
FT                   /pseudo
FT                   /locus_tag="SP_0456"
FT                   /note="Edited sequence gives a weak match to PF01548 and a
FT                   strong match to PF02371, which are often found together.;
FT                   transposase, IS116/IS110/IS902 family, degenerate; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:9965290"
FT   gene            429907..430752
FT                   /gene="bacA"
FT                   /locus_tag="SP_0457"
FT   CDS_pept        429907..430752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SP_0457"
FT                   /product="bacitracin resistance protein"
FT                   /note="identified by similarity to EGAD:37519; match to
FT                   protein family HMM PF02673"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74617"
FT                   /db_xref="GOA:P60934"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60934"
FT                   /protein_id="AAK74617.1"
FT                   "
FT   gene            complement(430899..431933)
FT                   /gene="dinP"
FT                   /locus_tag="SP_0458"
FT   CDS_pept        complement(430899..431933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="SP_0458"
FT                   /product="DNA-damage inducible protein P"
FT                   /note="identified by similarity to GP:9946826; match to
FT                   protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74618"
FT                   /db_xref="GOA:Q97SC7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SC7"
FT                   /protein_id="AAK74618.1"
FT                   MTGF"
FT   gene            432308..434632
FT                   /gene="pfl"
FT                   /locus_tag="SP_0459"
FT   CDS_pept        432308..434632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="SP_0459"
FT                   /product="formate acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:40969; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF02901; match to protein family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74619"
FT                   /db_xref="GOA:A0A0H2UNL5"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNL5"
FT                   /protein_id="AAK74619.1"
FT   gene            complement(434770..436038)
FT                   /locus_tag="SP_0460"
FT   CDS_pept        complement(434770..436038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0460"
FT                   /product="IS1167, transposase"
FT                   /note="identified by similarity to GP:2804700; match to
FT                   protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74620"
FT                   /db_xref="GOA:A0A0H2UNM1"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM1"
FT                   /protein_id="AAK74620.1"
FT   gene            complement(436303..437832)
FT                   /locus_tag="SP_0461"
FT   CDS_pept        complement(436303..437832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0461"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to GP:1289510; match to
FT                   protein family HMM PF07003"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74621"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ4"
FT                   /protein_id="AAK74621.1"
FT   gene            438327..441008
FT                   /locus_tag="SP_0462"
FT   CDS_pept        438327..441008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0462"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by similarity to GP:4927374; match to
FT                   protein family HMM PF00092; match to protein family HMM
FT                   PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74622"
FT                   /db_xref="GOA:A0A0H2UNT6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="PDB:2WW8"
FT                   /db_xref="PDB:5MKC"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT6"
FT                   /protein_id="AAK74622.1"
FT   gene            441232..443229
FT                   /locus_tag="SP_0463"
FT   CDS_pept        441232..443229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0463"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05738; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74623"
FT                   /db_xref="GOA:A0A0H2UNM7"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032332"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="PDB:2L4O"
FT                   /db_xref="PDB:2X9W"
FT                   /db_xref="PDB:2X9X"
FT                   /db_xref="PDB:2X9Y"
FT                   /db_xref="PDB:2X9Z"
FT                   /db_xref="PDB:2Y1V"
FT                   /db_xref="PDB:3RPK"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM7"
FT                   /protein_id="AAK74623.1"
FT   gene            443276..444457
FT                   /locus_tag="SP_0464"
FT   CDS_pept        443276..444457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0464"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by similarity to EGAD:33100; match to
FT                   protein family HMM PF05738; match to protein family HMM
FT                   TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74624"
FT                   /db_xref="GOA:A0A0H2UNM0"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="PDB:4OQ1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM0"
FT                   /protein_id="AAK74624.1"
FT   gene            complement(444676..444807)
FT                   /locus_tag="SP_0465"
FT   CDS_pept        complement(444676..444807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0465"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM8"
FT                   /protein_id="AAK74625.1"
FT   gene            444858..445697
FT                   /locus_tag="SP_0466"
FT   CDS_pept        444858..445697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0466"
FT                   /product="putative sortase"
FT                   /note="identified by similarity to GP:3036999; match to
FT                   protein family HMM PF04203; match to protein family HMM
FT                   TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74626"
FT                   /db_xref="GOA:A0A0H2UNQ9"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="PDB:2W1J"
FT                   /db_xref="PDB:2WTS"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ9"
FT                   /protein_id="AAK74626.1"
FT   gene            445792..446577
FT                   /locus_tag="SP_0467"
FT   CDS_pept        445792..446577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0467"
FT                   /product="putative sortase"
FT                   /note="identified by similarity to GP:3036999; match to
FT                   protein family HMM PF04203; match to protein family HMM
FT                   TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74627"
FT                   /db_xref="GOA:A0A0H2UNU0"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU0"
FT                   /protein_id="AAK74627.1"
FT   gene            446564..447415
FT                   /locus_tag="SP_0468"
FT   CDS_pept        446564..447415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0468"
FT                   /product="putative sortase"
FT                   /note="identified by similarity to GP:3036999; match to
FT                   protein family HMM PF04203; match to protein family HMM
FT                   TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74628"
FT                   /db_xref="GOA:A0A0H2UNN1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN1"
FT                   /protein_id="AAK74628.1"
FT                   GK"
FT   gene            complement(447488..448764)
FT                   /pseudo
FT                   /locus_tag="SP_0469"
FT                   /note="IS1167, transposase, interruption; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:2804700"
FT   gene            complement(448879..449028)
FT                   /locus_tag="SP_0470"
FT   CDS_pept        complement(448879..449028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNM6"
FT                   /protein_id="AAK74629.1"
FT                   FMAL"
FT   gene            complement(449021..449305)
FT                   /locus_tag="SP_0471"
FT   CDS_pept        complement(449021..449305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:35678"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74630"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN4"
FT                   /protein_id="AAK74630.1"
FT   gene            449697..449870
FT                   /locus_tag="SP_0472"
FT   CDS_pept        449697..449870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0472"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR6"
FT                   /protein_id="AAK74631.1"
FT                   VLEKILSIEFFK"
FT   gene            complement(450739..451962)
FT                   /locus_tag="SP_0473"
FT   CDS_pept        complement(450739..451962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0473"
FT                   /product="putative regulator"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74632"
FT                   /db_xref="GOA:A0A0H2UNU1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU1"
FT                   /protein_id="AAK74632.1"
FT                   VLQDIISP"
FT   gene            452130..453452
FT                   /locus_tag="SP_0474"
FT   CDS_pept        452130..453452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0474"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /note="identified by similarity to EGAD:14179; match to
FT                   protein family HMM PF02378; match to protein family HMM
FT                   TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74633"
FT                   /db_xref="GOA:A0A0H2UNN6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN6"
FT                   /protein_id="AAK74633.1"
FT   gene            453400..455340
FT                   /locus_tag="SP_0475"
FT   CDS_pept        453400..455340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74634"
FT                   /db_xref="InterPro:IPR032287"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN2"
FT                   /protein_id="AAK74634.1"
FT                   EVAKNYAGFHL"
FT   gene            455508..455852
FT                   /gene="lacF-1"
FT                   /locus_tag="SP_0476"
FT   CDS_pept        455508..455852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacF-1"
FT                   /locus_tag="SP_0476"
FT                   /product="PTS system, lactose-specific IIA component"
FT                   /note="identified by similarity to SP:P23532; match to
FT                   protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74635"
FT                   /db_xref="GOA:A0A0H2UNP1"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP1"
FT                   /protein_id="AAK74635.1"
FT                   RKIEEHIGLQ"
FT   gene            455862..457274
FT                   /gene="lacG-1"
FT                   /locus_tag="SP_0477"
FT   CDS_pept        455862..457274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacG-1"
FT                   /locus_tag="SP_0477"
FT                   /product="6-phospho-beta-galactosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:17554; match to
FT                   protein family HMM PF00232; match to protein family HMM
FT                   TIGR01233"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74636"
FT                   /db_xref="GOA:Q97SA9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR005928"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SA9"
FT                   /protein_id="AAK74636.1"
FT                   KSALWVKGLKRN"
FT   gene            457343..459022
FT                   /gene="lacE-1"
FT                   /locus_tag="SP_0478"
FT   CDS_pept        457343..459022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacE-1"
FT                   /locus_tag="SP_0478"
FT                   /product="PTS system, lactose-specific IIBC components"
FT                   /note="identified by similarity to EGAD:15299; match to
FT                   protein family HMM PF02302; match to protein family HMM
FT                   PF02378; match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74637"
FT                   /db_xref="GOA:A0A0H2UNS1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR041713"
FT                   /db_xref="PDB:3NBM"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS1"
FT                   /protein_id="AAK74637.1"
FT   gene            complement(459148..460587)
FT                   /locus_tag="SP_0479"
FT   CDS_pept        complement(459148..460587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0479"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by similarity to EGAD:46463; match to
FT                   protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74638"
FT                   /db_xref="GOA:A0A0H2UNU3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU3"
FT                   /protein_id="AAK74638.1"
FT   gene            complement(460591..461940)
FT                   /locus_tag="SP_0480"
FT   CDS_pept        complement(460591..461940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0480"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by similarity to EGAD:16153; match to
FT                   protein family HMM PF02080; match to protein family HMM
FT                   PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74639"
FT                   /db_xref="GOA:A0A0H2UNN9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN9"
FT                   /protein_id="AAK74639.1"
FT   gene            462101..462976
FT                   /locus_tag="SP_0481"
FT   CDS_pept        462101..462976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:89137; match to
FT                   protein family HMM PF01887"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74640"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNN7"
FT                   /protein_id="AAK74640.1"
FT                   WTIEIKKIEG"
FT   gene            462991..463539
FT                   /locus_tag="SP_0482"
FT   CDS_pept        462991..463539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6165407; match to
FT                   protein family HMM PF07155"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74641"
FT                   /db_xref="GOA:Q97SA4"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SA4"
FT                   /protein_id="AAK74641.1"
FT   gene            463905..465587
FT                   /locus_tag="SP_0483"
FT   CDS_pept        463905..465587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0483"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GP:8250594; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74642"
FT                   /db_xref="GOA:Q97SA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SA3"
FT                   /protein_id="AAK74642.1"
FT   gene            465572..466402
FT                   /locus_tag="SP_0484"
FT   CDS_pept        465572..466402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0484"
FT                   /product="cobalt transport protein"
FT                   /note="identified by similarity to EGAD:108344; match to
FT                   protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74643"
FT                   /db_xref="GOA:A0A0H2UNP6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP6"
FT                   /protein_id="AAK74643.1"
FT   gene            466595..467098
FT                   /locus_tag="SP_0486"
FT   CDS_pept        466595..467098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0486"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74644"
FT                   /db_xref="GOA:A0A0H2UNS5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS5"
FT                   /protein_id="AAK74644.1"
FT                   DKLK"
FT   gene            complement(467295..467513)
FT                   /locus_tag="SP_0487"
FT   CDS_pept        complement(467295..467513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0487"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74645"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU5"
FT                   /protein_id="AAK74645.1"
FT   gene            467551..468114
FT                   /locus_tag="SP_0488"
FT   CDS_pept        467551..468114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:37721"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74646"
FT                   /db_xref="GOA:A0A0H2UNP3"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP3"
FT                   /protein_id="AAK74646.1"
FT   gene            468104..468754
FT                   /locus_tag="SP_0489"
FT   CDS_pept        468104..468754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0489"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74647"
FT                   /db_xref="GOA:A0A0H2UNP4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNP4"
FT                   /protein_id="AAK74647.1"
FT   gene            468782..469171
FT                   /locus_tag="SP_0490"
FT   CDS_pept        468782..469171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0490"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74648"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ1"
FT                   /protein_id="AAK74648.1"
FT   gene            469176..469331
FT                   /locus_tag="SP_0491"
FT   CDS_pept        469176..469331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT0"
FT                   /protein_id="AAK74649.1"
FT                   LFGSAW"
FT   gene            469303..469626
FT                   /locus_tag="SP_0492"
FT   CDS_pept        469303..469626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0492"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:18596"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74650"
FT                   /db_xref="GOA:A0A0H2UNU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU7"
FT                   /protein_id="AAK74650.1"
FT                   ELV"
FT   gene            469739..470341
FT                   /locus_tag="SP_0493"
FT   CDS_pept        469739..470341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0493"
FT                   /product="putative DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /note="identified by similarity to EGAD:12294; match to
FT                   protein family HMM PF05066"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74651"
FT                   /db_xref="GOA:P66717"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66717"
FT                   /protein_id="AAK74651.1"
FT   gene            470731..472338
FT                   /gene="pyrG"
FT                   /locus_tag="SP_0494"
FT   CDS_pept        470731..472338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SP_0494"
FT                   /product="CTP synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74652"
FT                   /db_xref="GOA:Q97S93"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S93"
FT                   /protein_id="AAK74652.1"
FT                   RPEELYTAFVTAAVENSN"
FT   gene            complement(472994..474340)
FT                   /locus_tag="SP_0495"
FT   CDS_pept        complement(472994..474340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0495"
FT                   /product="IS1380-Spn1, transposase"
FT                   /note="identified by similarity to GP:8163721; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74653"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2US47"
FT                   /protein_id="AAK74653.1"
FT   gene            complement(474605..476236)
FT                   /locus_tag="SP_0496"
FT   CDS_pept        complement(474605..476236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0496"
FT                   /product="Na/Pi cotransporter II-related protein"
FT                   /note="identified by match to protein family HMM PF02690;
FT                   match to protein family HMM TIGR00704"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74654"
FT                   /db_xref="GOA:A0A0H2UNQ0"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ0"
FT                   /protein_id="AAK74654.1"
FT   gene            476438..476548
FT                   /locus_tag="SP_0497"
FT   CDS_pept        476438..476548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ6"
FT                   /protein_id="AAK74655.1"
FT   gene            476529..481508
FT                   /locus_tag="SP_0498"
FT   CDS_pept        476529..481508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0498"
FT                   /product="putative endo-beta-N-acetylglucosaminidase"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF00754; match to protein
FT                   family HMM PF03644; match to protein family HMM PF04650;
FT                   match to protein family HMM PF07501; match to protein
FT                   family HMM PF07523; match to protein family HMM TIGR01167;
FT                   match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74656"
FT                   /db_xref="GOA:A0A0H2UNT5"
FT                   /db_xref="InterPro:IPR005201"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR032979"
FT                   /db_xref="PDB:2L7Y"
FT                   /db_xref="PDB:2XQX"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT5"
FT                   /protein_id="AAK74656.1"
FT   gene            481598..482794
FT                   /gene="pgk"
FT                   /locus_tag="SP_0499"
FT   CDS_pept        481598..482794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SP_0499"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74657"
FT                   /db_xref="GOA:Q97S89"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S89"
FT                   /protein_id="AAK74657.1"
FT   gene            482930..483457
FT                   /locus_tag="SP_0500"
FT   CDS_pept        482930..483457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0500"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74658"
FT                   /db_xref="GOA:A0A0H2UNU9"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU9"
FT                   /protein_id="AAK74658.1"
FT                   DRIRLFLEKKEK"
FT   gene            483534..483890
FT                   /locus_tag="SP_0501"
FT   CDS_pept        483534..483890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0501"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74659"
FT                   /db_xref="GOA:A0A0H2UNQ3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ3"
FT                   /protein_id="AAK74659.1"
FT                   QGRFASVQSPFGRG"
FT   gene            483927..485273
FT                   /gene="glnA"
FT                   /locus_tag="SP_0502"
FT   CDS_pept        483927..485273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SP_0502"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P12425; match to
FT                   protein family HMM PF00120; match to protein family HMM
FT                   PF03951; match to protein family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74660"
FT                   /db_xref="GOA:A0A0H2UNQ5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ5"
FT                   /protein_id="AAK74660.1"
FT   gene            complement(485369..485488)
FT                   /locus_tag="SP_0503"
FT   CDS_pept        complement(485369..485488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR0"
FT                   /protein_id="AAK74661.1"
FT   gene            485746..485883
FT                   /locus_tag="SP_0504"
FT   CDS_pept        485746..485883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0504"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT8"
FT                   /protein_id="AAK74662.1"
FT                   "
FT   gene            486054..487334
FT                   /locus_tag="SP_0505"
FT   CDS_pept        486054..487334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0505"
FT                   /product="putative type I restriction-modification system,
FT                   S subunit"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74663"
FT                   /db_xref="GOA:A0A0H2UNV3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV3"
FT                   /protein_id="AAK74663.1"
FT   gene            487391..488188
FT                   /locus_tag="SP_0506"
FT   CDS_pept        487391..488188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0506"
FT                   /product="integrase/recombinase, phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74664"
FT                   /db_xref="GOA:A0A0H2UNQ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNQ8"
FT                   /protein_id="AAK74664.1"
FT   gene            488259..488798
FT                   /locus_tag="SP_0507"
FT   CDS_pept        488259..488798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0507"
FT                   /product="putative type I restriction-modification system,
FT                   S subunit"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74665"
FT                   /db_xref="GOA:A0A0H2UNR1"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR1"
FT                   /protein_id="AAK74665.1"
FT                   LITQKVEKLFEKVNQL"
FT   gene            complement(488752..490320)
FT                   /gene="hsdS"
FT                   /locus_tag="SP_0508"
FT   CDS_pept        complement(488752..490320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="SP_0508"
FT                   /product="type I restriction-modification system, S
FT                   subunit"
FT                   /note="identified by similarity to SP:P19704; match to
FT                   protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74666"
FT                   /db_xref="GOA:A0A0H2UNR3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR3"
FT                   /protein_id="AAK74666.1"
FT                   SQLFE"
FT   gene            complement(490320..491783)
FT                   /gene="hsdM"
FT                   /locus_tag="SP_0509"
FT   CDS_pept        complement(490320..491783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="SP_0509"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to EGAD:20905; match to
FT                   protein family HMM PF02384; match to protein family HMM
FT                   PF02506"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74667"
FT                   /db_xref="GOA:A0A0H2UNU2"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU2"
FT                   /protein_id="AAK74667.1"
FT   gene            complement(491796..494129)
FT                   /gene="hsdR"
FT                   /locus_tag="SP_0510"
FT   CDS_pept        complement(491796..494129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="SP_0510"
FT                   /product="type I restriction-modification system, R
FT                   subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:12840; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF04313; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74668"
FT                   /db_xref="GOA:A0A0H2UNV7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV7"
FT                   /protein_id="AAK74668.1"
FT   gene            complement(494480..494608)
FT                   /locus_tag="SP_0511"
FT   CDS_pept        complement(494480..494608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74669"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR4"
FT                   /protein_id="AAK74669.1"
FT   gene            494592..494702
FT                   /locus_tag="SP_0512"
FT   CDS_pept        494592..494702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0512"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74670"
FT                   /db_xref="GOA:A0A0H2UNR5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR5"
FT                   /protein_id="AAK74670.1"
FT   gene            494737..494928
FT                   /locus_tag="SP_0513"
FT   CDS_pept        494737..494928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74671"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR7"
FT                   /protein_id="AAK74671.1"
FT                   QPDDVIYRIYDSRFLKKV"
FT   gene            494900..495247
FT                   /locus_tag="SP_0514"
FT   CDS_pept        494900..495247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74672"
FT                   /db_xref="GOA:A0A0H2UNU4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU4"
FT                   /protein_id="AAK74672.1"
FT                   FRLKRKYRVDE"
FT   gene            495411..496445
FT                   /gene="hrcA"
FT                   /locus_tag="SP_0515"
FT   CDS_pept        495411..496445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SP_0515"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by match to protein family HMM PF01628;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74673"
FT                   /db_xref="GOA:Q9X4R2"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X4R2"
FT                   /protein_id="AAK74673.1"
FT                   YEVH"
FT   gene            496472..496996
FT                   /gene="grpE"
FT                   /locus_tag="SP_0516"
FT   CDS_pept        496472..496996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SP_0516"
FT                   /product="heat shock protein GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74674"
FT                   /db_xref="GOA:Q97S73"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S73"
FT                   /protein_id="AAK74674.1"
FT                   ILRPAMVVVYN"
FT   gene            497485..499308
FT                   /gene="dnaK"
FT                   /locus_tag="SP_0517"
FT   CDS_pept        497485..499308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SP_0517"
FT                   /product="dnaK protein"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74675"
FT                   /db_xref="GOA:P95829"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95829"
FT                   /protein_id="AAK74675.1"
FT   gene            499310..499456
FT                   /locus_tag="SP_0518"
FT   CDS_pept        499310..499456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW1"
FT                   /protein_id="AAK74676.1"
FT                   ELY"
FT   gene            500067..501203
FT                   /gene="dnaJ"
FT                   /locus_tag="SP_0519"
FT   CDS_pept        500067..501203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SP_0519"
FT                   /product="dnaJ protein"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74677"
FT                   /db_xref="GOA:P95830"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95830"
FT                   /protein_id="AAK74677.1"
FT   gene            complement(501893..502180)
FT                   /locus_tag="SP_0520"
FT   CDS_pept        complement(501893..502180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNR9"
FT                   /protein_id="AAK74678.1"
FT   gene            complement(502190..502600)
FT                   /locus_tag="SP_0521"
FT   CDS_pept        complement(502190..502600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0521"
FT                   /product="HIT family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74679"
FT                   /db_xref="GOA:A0A0H2UNS0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS0"
FT                   /protein_id="AAK74679.1"
FT   gene            502668..503399
FT                   /locus_tag="SP_0522"
FT   CDS_pept        502668..503399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0522"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to EGAD:37771; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74680"
FT                   /db_xref="GOA:A0A0H2UNS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS3"
FT                   /protein_id="AAK74680.1"
FT   gene            503396..504445
FT                   /locus_tag="SP_0523"
FT   CDS_pept        503396..504445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0523"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:35133; match to
FT                   protein family HMM PF05975"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74681"
FT                   /db_xref="GOA:A0A0H2UNU6"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU6"
FT                   /protein_id="AAK74681.1"
FT                   YQVKRQMQD"
FT   gene            complement(504613..504942)
FT                   /gene="blpT"
FT                   /locus_tag="SP_0524"
FT   CDS_pept        complement(504613..504942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpT"
FT                   /locus_tag="SP_0524"
FT                   /product="BlpT protein, fusion"
FT                   /note="C-terminus is fused with an incomplete box element.;
FT                   identified by similarity to GP:9798558"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW6"
FT                   /protein_id="AAK74682.1"
FT                   NQRAN"
FT   gene            505218..505556
FT                   /gene="blpS"
FT                   /locus_tag="SP_0525"
FT   CDS_pept        505218..505556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpS"
FT                   /locus_tag="SP_0525"
FT                   /product="BlpS protein"
FT                   /note="identified by similarity to GP:9798559; match to
FT                   protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74683"
FT                   /db_xref="GOA:A0A0H2UNS6"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR012405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS6"
FT                   /protein_id="AAK74683.1"
FT                   QKWLKEGE"
FT   gene            505561..506298
FT                   /gene="blpR"
FT                   /locus_tag="SP_0526"
FT   CDS_pept        505561..506298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpR"
FT                   /locus_tag="SP_0526"
FT                   /product="response regulator BlpR"
FT                   /note="identified by similarity to GP:5830550; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74684"
FT                   /db_xref="GOA:A0A0H2UNS4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS4"
FT                   /protein_id="AAK74684.1"
FT   gene            506312..507652
FT                   /gene="blpH"
FT                   /locus_tag="SP_0527"
FT   CDS_pept        506312..507652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpH"
FT                   /locus_tag="SP_0527"
FT                   /product="putative sensor histidine kinase BlpH"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74685"
FT                   /db_xref="GOA:A0A0H2UNS8"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS8"
FT                   /protein_id="AAK74685.1"
FT   gene            complement(507723..507851)
FT                   /gene="blpC"
FT                   /locus_tag="SP_0528"
FT   CDS_pept        complement(507723..507851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpC"
FT                   /locus_tag="SP_0528"
FT                   /product="peptide pheromone BlpC"
FT                   /note="identified by similarity to GP:9798562; match to
FT                   protein family HMM PF08128; match to protein family HMM
FT                   TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74686"
FT                   /db_xref="GOA:A0A0H2UNU8"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNU8"
FT                   /protein_id="AAK74686.1"
FT   gene            complement(507908..509269)
FT                   /gene="blpB"
FT                   /locus_tag="SP_0529"
FT   CDS_pept        complement(507908..509269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpB"
FT                   /locus_tag="SP_0529"
FT                   /product="BlpC ABC transporter"
FT                   /note="identified by similarity to GP:9798563; match to
FT                   protein family HMM TIGR01000"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74687"
FT                   /db_xref="GOA:A0A0H2UNX0"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX0"
FT                   /protein_id="AAK74687.1"
FT   gene            complement(509280..511437)
FT                   /pseudo
FT                   /gene="blpA"
FT                   /locus_tag="SP_0530"
FT                   /note="BlpC ABC transporter, ATP-binding protein,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:9798564"
FT   gene            511719..511916
FT                   /gene="blpI"
FT                   /locus_tag="SP_0531"
FT   CDS_pept        511719..511916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpI"
FT                   /locus_tag="SP_0531"
FT                   /product="bacteriocin BlpI"
FT                   /note="identified by similarity to GP:9798565"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74688"
FT                   /db_xref="GOA:A0A0H2UNT2"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT2"
FT                   /protein_id="AAK74688.1"
FT   gene            512383..512652
FT                   /gene="blpJ"
FT                   /locus_tag="SP_0532"
FT   CDS_pept        512383..512652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpJ"
FT                   /locus_tag="SP_0532"
FT                   /product="bacteriocin BlpJ"
FT                   /note="identified by similarity to GP:9798566; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74689"
FT                   /db_xref="GOA:A0A0H2UNS9"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNS9"
FT                   /protein_id="AAK74689.1"
FT   gene            512721..512951
FT                   /gene="blpK"
FT                   /locus_tag="SP_0533"
FT   CDS_pept        512721..512951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpK"
FT                   /locus_tag="SP_0533"
FT                   /product="bacteriocin BlpK"
FT                   /note="identified by similarity to GP:9798567; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74690"
FT                   /db_xref="GOA:A0A0H2UNT4"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT4"
FT                   /protein_id="AAK74690.1"
FT   gene            513186..513302
FT                   /locus_tag="SP_0534"
FT   CDS_pept        513186..513302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74691"
FT                   /db_xref="GOA:A0A0H2UNV0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV0"
FT                   /protein_id="AAK74691.1"
FT   gene            513370..513534
FT                   /locus_tag="SP_0535"
FT   CDS_pept        513370..513534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74692"
FT                   /db_xref="GOA:A0A0H2UNX5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX5"
FT                   /protein_id="AAK74692.1"
FT                   INKKKGEKK"
FT   gene            513531..513935
FT                   /gene="blpL"
FT                   /locus_tag="SP_0536"
FT   CDS_pept        513531..513935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpL"
FT                   /locus_tag="SP_0536"
FT                   /product="immunity protein BlpL"
FT                   /note="identified by similarity to GP:9798568"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74693"
FT                   /db_xref="GOA:A0A0H2UNT7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT7"
FT                   /protein_id="AAK74693.1"
FT   gene            514138..514527
FT                   /locus_tag="SP_0537"
FT   CDS_pept        514138..514527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0537"
FT                   /product="IS1381, transposase OrfA"
FT                   /note="IRleft, upstream of the start site, is interrupted
FT                   by an RUP element.; identified by similarity to EGAD:33136"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74694"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT3"
FT                   /protein_id="AAK74694.1"
FT   gene            514553..514942
FT                   /locus_tag="SP_0538"
FT   CDS_pept        514553..514942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0538"
FT                   /product="IS1381, transposase OrfB"
FT                   /note="identified by similarity to EGAD:33136; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74695"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNT9"
FT                   /protein_id="AAK74695.1"
FT   gene            515092..515346
FT                   /gene="blpM"
FT                   /locus_tag="SP_0539"
FT   CDS_pept        515092..515346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpM"
FT                   /locus_tag="SP_0539"
FT                   /product="bacteriocin BlpM"
FT                   /note="identified by similarity to GP:9798569; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74696"
FT                   /db_xref="GOA:A0A0H2UNX8"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX8"
FT                   /protein_id="AAK74696.1"
FT   gene            515362..515565
FT                   /gene="blpN"
FT                   /locus_tag="SP_0540"
FT   CDS_pept        515362..515565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpN"
FT                   /locus_tag="SP_0540"
FT                   /product="BlpN protein"
FT                   /note="identified by similarity to GP:9798570"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74697"
FT                   /db_xref="GOA:A0A0H2UP08"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP08"
FT                   /protein_id="AAK74697.1"
FT   gene            515809..515958
FT                   /gene="blpO"
FT                   /locus_tag="SP_0541"
FT   CDS_pept        515809..515958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpO"
FT                   /locus_tag="SP_0541"
FT                   /product="bacteriocin BlpO"
FT                   /note="identified by similarity to GP:9798571; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74698"
FT                   /db_xref="GOA:A0A0H2UNV4"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV4"
FT                   /protein_id="AAK74698.1"
FT                   ATTV"
FT   gene            515940..516059
FT                   /locus_tag="SP_0542"
FT   CDS_pept        515940..516059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0542"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV2"
FT                   /protein_id="AAK74699.1"
FT   gene            516700..516867
FT                   /locus_tag="SP_0543"
FT   CDS_pept        516700..516867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74700"
FT                   /db_xref="GOA:A0A0H2UNV1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV1"
FT                   /protein_id="AAK74700.1"
FT                   CLSRFCSCGA"
FT   gene            516952..517350
FT                   /gene="blpX"
FT                   /locus_tag="SP_0544"
FT   CDS_pept        516952..517350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpX"
FT                   /locus_tag="SP_0544"
FT                   /product="immunity protein BlpX"
FT                   /note="identified by similarity to GP:9798572"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74701"
FT                   /db_xref="GOA:A0A0H2UNY2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY2"
FT                   /protein_id="AAK74701.1"
FT   gene            517402..518091
FT                   /gene="blpY"
FT                   /locus_tag="SP_0545"
FT   CDS_pept        517402..518091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpY"
FT                   /locus_tag="SP_0545"
FT                   /product="immunity protein BlpY"
FT                   /note="identified by similarity to EGAD:151936; match to
FT                   protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74702"
FT                   /db_xref="GOA:A0A0H2UP13"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP13"
FT                   /protein_id="AAK74702.1"
FT                   FLHRVLG"
FT   gene            518133..518366
FT                   /gene="blpZ"
FT                   /locus_tag="SP_0546"
FT   CDS_pept        518133..518366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpZ"
FT                   /locus_tag="SP_0546"
FT                   /product="BlpZ protein, fusion"
FT                   /note="C-terminus is fused with an incomplete BOX element.;
FT                   identified by similarity to GP:9798574"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74703"
FT                   /db_xref="GOA:A0A0H2UNV8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV8"
FT                   /protein_id="AAK74703.1"
FT   gene            518517..519128
FT                   /locus_tag="SP_0547"
FT   CDS_pept        518517..519128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0547"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:6470197; similarity
FT                   to EGAD:107498; match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74704"
FT                   /db_xref="GOA:A0A0H2UNV6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV6"
FT                   /protein_id="AAK74704.1"
FT   gene            complement(519222..519344)
FT                   /locus_tag="SP_0548"
FT   CDS_pept        complement(519222..519344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74705"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV5"
FT                   /protein_id="AAK74705.1"
FT   gene            519352..520083
FT                   /locus_tag="SP_0549"
FT   CDS_pept        519352..520083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:7328278"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74706"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY6"
FT                   /protein_id="AAK74706.1"
FT   gene            520080..520715
FT                   /locus_tag="SP_0550"
FT   CDS_pept        520080..520715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108171; match to
FT                   protein family HMM PF02390; match to protein family HMM
FT                   TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74707"
FT                   /db_xref="GOA:P67506"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:1YZH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67506"
FT                   /protein_id="AAK74707.1"
FT   gene            520841..521320
FT                   /locus_tag="SP_0552"
FT   CDS_pept        520841..521320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0552"
FT                   /product="SP14.3 protein"
FT                   /note="identified by similarity to EGAD:9796; match to
FT                   protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74708"
FT                   /db_xref="GOA:Q97S61"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="PDB:1IB8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S61"
FT                   /protein_id="AAK74708.1"
FT   gene            521364..522500
FT                   /gene="nusA"
FT                   /locus_tag="SP_0553"
FT   CDS_pept        521364..522500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SP_0553"
FT                   /product="N utilization substance protein A"
FT                   /note="identified by similarity to EGAD:8525; match to
FT                   protein family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74709"
FT                   /db_xref="GOA:A0A0H2UP18"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP18"
FT                   /protein_id="AAK74709.1"
FT   gene            522522..522815
FT                   /locus_tag="SP_0554"
FT   CDS_pept        522522..522815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:8543; match to
FT                   protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74710"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="PDB:1G2R"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW2"
FT                   /protein_id="AAK74710.1"
FT   gene            522808..523107
FT                   /locus_tag="SP_0555"
FT   CDS_pept        522808..523107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0555"
FT                   /product="ribosomal protein L7A family"
FT                   /note="identified by similarity to EGAD:11014; match to
FT                   protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74711"
FT                   /db_xref="GOA:A0A0H2UNV9"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039107"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNV9"
FT                   /protein_id="AAK74711.1"
FT   gene            523124..526000
FT                   /gene="infB"
FT                   /locus_tag="SP_0556"
FT   CDS_pept        523124..526000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SP_0556"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by similarity to EGAD:10255; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM PF04760; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74712"
FT                   /db_xref="GOA:Q97S57"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S57"
FT                   /protein_id="AAK74712.1"
FT   gene            526251..526601
FT                   /gene="rbfA"
FT                   /locus_tag="SP_0557"
FT   CDS_pept        526251..526601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SP_0557"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by similarity to GP:3947715; match to
FT                   protein family HMM PF02033; match to protein family HMM
FT                   TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74713"
FT                   /db_xref="GOA:Q97S56"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S56"
FT                   /protein_id="AAK74713.1"
FT                   KIDEMLRNLDKN"
FT   gene            526844..527659
FT                   /locus_tag="SP_0558"
FT   CDS_pept        526844..527659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3483031"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74714"
FT                   /db_xref="GOA:A0A0H2UNW0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW0"
FT                   /protein_id="AAK74714.1"
FT   gene            527661..527843
FT                   /locus_tag="SP_0559"
FT   CDS_pept        527661..527843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0559"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ0"
FT                   /protein_id="AAK74715.1"
FT                   LMDTARWLIKPEERE"
FT   gene            complement(527796..528029)
FT                   /locus_tag="SP_0560"
FT   CDS_pept        complement(527796..528029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0560"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74716"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP23"
FT                   /protein_id="AAK74716.1"
FT   gene            528291..528536
FT                   /locus_tag="SP_0561"
FT   CDS_pept        528291..528536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0561"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:104317"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74717"
FT                   /db_xref="GOA:A0A0H2UNW5"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW5"
FT                   /protein_id="AAK74717.1"
FT   gene            528536..529870
FT                   /locus_tag="SP_0562"
FT   CDS_pept        528536..529870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:104321; match to
FT                   protein family HMM PF04282"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74718"
FT                   /db_xref="GOA:A0A0H2UNW3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW3"
FT                   /protein_id="AAK74718.1"
FT   gene            529880..530134
FT                   /locus_tag="SP_0563"
FT   CDS_pept        529880..530134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0563"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74719"
FT                   /db_xref="GOA:A0A0H2UNW4"
FT                   /db_xref="InterPro:IPR015026"
FT                   /db_xref="InterPro:IPR038024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW4"
FT                   /protein_id="AAK74719.1"
FT   gene            530230..530625
FT                   /locus_tag="SP_0564"
FT   CDS_pept        530230..530625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74720"
FT                   /db_xref="GOA:A0A0H2UNZ4"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ4"
FT                   /protein_id="AAK74720.1"
FT   gene            531038..531487
FT                   /locus_tag="SP_0565"
FT   CDS_pept        531038..531487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0565"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:8927331"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74721"
FT                   /db_xref="GOA:A0A0H2UP27"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP27"
FT                   /protein_id="AAK74721.1"
FT   gene            531474..532034
FT                   /locus_tag="SP_0566"
FT   CDS_pept        531474..532034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0566"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74722"
FT                   /db_xref="GOA:A0A0H2UNW8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW8"
FT                   /protein_id="AAK74722.1"
FT   gene            532019..532612
FT                   /locus_tag="SP_0567"
FT   CDS_pept        532019..532612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0567"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW7"
FT                   /protein_id="AAK74723.1"
FT   gene            532605..535256
FT                   /gene="valS"
FT                   /locus_tag="SP_0568"
FT   CDS_pept        532605..535256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SP_0568"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74724"
FT                   /db_xref="GOA:Q97S45"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S45"
FT                   /protein_id="AAK74724.1"
FT                   VARIDEMKKLVK"
FT   gene            535337..535501
FT                   /locus_tag="SP_0569"
FT   CDS_pept        535337..535501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0569"
FT                   /product="type II DNA modification methyltransferase,
FT                   truncation"
FT                   /note="identified by similarity to EGAD:8482"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75785"
FT                   /db_xref="GOA:A0A0H2XF91"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XF91"
FT                   /protein_id="ABC75785.1"
FT                   PEVSVIDME"
FT   gene            535552..537156
FT                   /locus_tag="SP_0570"
FT   CDS_pept        535552..537156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0570"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:2687741"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74725"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNW9"
FT                   /protein_id="AAK74725.1"
FT                   PESSMFQCIKEKLEALF"
FT   gene            537536..538339
FT                   /locus_tag="SP_0571"
FT   CDS_pept        537536..538339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0571"
FT                   /product="cell filamentation protein Fic-related protein"
FT                   /note="identified by similarity to GP:9106717; match to
FT                   protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74726"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ6"
FT                   /protein_id="AAK74726.1"
FT   gene            complement(538454..539654)
FT                   /pseudo
FT                   /locus_tag="SP_0572"
FT                   /note="IS1167, transposase, degenerate; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by similarity to EGAD:42453"
FT   gene            539917..540078
FT                   /locus_tag="SP_0573"
FT   CDS_pept        539917..540078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP32"
FT                   /protein_id="AAK74727.1"
FT                   EFFLCIAF"
FT   gene            540202..541032
FT                   /locus_tag="SP_0574"
FT   CDS_pept        540202..541032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0574"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74728"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX3"
FT                   /protein_id="AAK74728.1"
FT   gene            541218..542864
FT                   /locus_tag="SP_0575"
FT   CDS_pept        541218..542864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0575"
FT                   /product="putative helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74729"
FT                   /db_xref="GOA:A0A0H2UNX1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX1"
FT                   /protein_id="AAK74729.1"
FT   gene            543164..544003
FT                   /gene="licT"
FT                   /locus_tag="SP_0576"
FT   CDS_pept        543164..544003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /locus_tag="SP_0576"
FT                   /product="transcription antiterminator Lict"
FT                   /note="identified by similarity to SP:P39805; match to
FT                   protein family HMM PF00874; match to protein family HMM
FT                   PF03123"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74730"
FT                   /db_xref="GOA:A0A0H2UNX2"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX2"
FT                   /protein_id="AAK74730.1"
FT   gene            544021..545859
FT                   /locus_tag="SP_0577"
FT   CDS_pept        544021..545859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0577"
FT                   /product="PTS system, beta-glucosides-specific IIABC
FT                   components"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00830;
FT                   match to protein family HMM TIGR01995"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74731"
FT                   /db_xref="GOA:A0A0H2UP00"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP00"
FT                   /protein_id="AAK74731.1"
FT   gene            545872..547287
FT                   /gene="bglA-2"
FT                   /locus_tag="SP_0578"
FT   CDS_pept        545872..547287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA-2"
FT                   /locus_tag="SP_0578"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P40740; match to
FT                   protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74732"
FT                   /db_xref="GOA:A0A0H2UP35"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="PDB:4IPL"
FT                   /db_xref="PDB:4IPN"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP35"
FT                   /protein_id="AAK74732.1"
FT                   KEVIESNGESLFK"
FT   gene            547769..548815
FT                   /gene="pheS"
FT                   /locus_tag="SP_0579"
FT   CDS_pept        547769..548815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="SP_0579"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74733"
FT                   /db_xref="GOA:Q97S36"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S36"
FT                   /protein_id="AAK74733.1"
FT                   VRFSEQFK"
FT   gene            548815..549324
FT                   /locus_tag="SP_0580"
FT   CDS_pept        548815..549324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0580"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74734"
FT                   /db_xref="GOA:A0A0H2UNX6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX6"
FT                   /protein_id="AAK74734.1"
FT                   LRKKLR"
FT   gene            549401..551806
FT                   /gene="pheT"
FT                   /locus_tag="SP_0581"
FT   CDS_pept        549401..551806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="SP_0581"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03147; match to protein
FT                   family HMM PF03483; match to protein family HMM PF03484;
FT                   match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74735"
FT                   /db_xref="GOA:Q97S34"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S34"
FT                   /protein_id="AAK74735.1"
FT   gene            complement(551874..552875)
FT                   /locus_tag="SP_0582"
FT   CDS_pept        complement(551874..552875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74736"
FT                   /db_xref="GOA:A0A0H2UNX4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX4"
FT                   /protein_id="AAK74736.1"
FT   gene            553031..553449
FT                   /pseudo
FT                   /locus_tag="SP_0583"
FT                   /note="putative IS1239, transposase, degenerate; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:19448"
FT   gene            553626..553838
FT                   /locus_tag="SP_0584"
FT   CDS_pept        553626..553838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0584"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to EGAD:97130; match to
FT                   protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74737"
FT                   /db_xref="GOA:A0A0H2UNX7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX7"
FT                   /protein_id="AAK74737.1"
FT   gene            554099..556348
FT                   /gene="metE"
FT                   /locus_tag="SP_0585"
FT   CDS_pept        554099..556348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SP_0585"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P05694; match to
FT                   protein family HMM PF01717; match to protein family HMM
FT                   TIGR01371"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74738"
FT                   /db_xref="GOA:Q97S31"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S31"
FT                   /protein_id="AAK74738.1"
FT   gene            556412..557278
FT                   /locus_tag="SP_0586"
FT   CDS_pept        556412..557278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0586"
FT                   /product="putative 5,10-methylenetetrahydrofolate
FT                   reductase"
FT                   /note="identified by similarity to EGAD:20689; match to
FT                   protein family HMM PF02219; match to protein family HMM
FT                   TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74739"
FT                   /db_xref="GOA:A0A0H2UP04"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP04"
FT                   /protein_id="AAK74739.1"
FT                   FNHQSLG"
FT   gene            complement(557460..557729)
FT                   /locus_tag="SP_0587"
FT   CDS_pept        complement(557460..557729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP41"
FT                   /protein_id="AAK74740.1"
FT   gene            557963..560176
FT                   /gene="pnp"
FT                   /locus_tag="SP_0588"
FT   CDS_pept        557963..560176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="SP_0588"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P50849; match to
FT                   protein family HMM PF00013; match to protein family HMM
FT                   PF00575; match to protein family HMM PF01138; match to
FT                   protein family HMM PF03725; match to protein family HMM
FT                   PF03726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74741"
FT                   /db_xref="GOA:Q97S28"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S28"
FT                   /protein_id="AAK74741.1"
FT   gene            560192..560809
FT                   /gene="cysE"
FT                   /locus_tag="SP_0589"
FT   CDS_pept        560192..560809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SP_0589"
FT                   /product="serine acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:23933; match to
FT                   protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74742"
FT                   /db_xref="GOA:A0A0H2UNY1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY1"
FT                   /protein_id="AAK74742.1"
FT   gene            560821..561705
FT                   /locus_tag="SP_0590"
FT   CDS_pept        560821..561705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0590"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74743"
FT                   /db_xref="GOA:A0A0H2UNX9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNX9"
FT                   /protein_id="AAK74743.1"
FT                   VYLNEKGARDSEV"
FT   gene            561787..563130
FT                   /gene="cysS"
FT                   /locus_tag="SP_0591"
FT   CDS_pept        561787..563130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SP_0591"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74744"
FT                   /db_xref="GOA:Q97S25"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S25"
FT                   /protein_id="AAK74744.1"
FT   gene            563123..563509
FT                   /locus_tag="SP_0592"
FT   CDS_pept        563123..563509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108189; match to
FT                   protein family HMM PF05948"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74745"
FT                   /db_xref="GOA:A0A0H2UNY0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY0"
FT                   /protein_id="AAK74745.1"
FT   gene            563513..564397
FT                   /gene="lrp"
FT                   /locus_tag="SP_0593"
FT   CDS_pept        563513..564397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="SP_0593"
FT                   /product="leucine-rich protein"
FT                   /note="identified by similarity to EGAD:14491; match to
FT                   protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74746"
FT                   /db_xref="GOA:A0A0H2UP11"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP11"
FT                   /protein_id="AAK74746.1"
FT                   QLILGSLSTIVGL"
FT   gene            564534..564989
FT                   /locus_tag="SP_0595"
FT   CDS_pept        564534..564989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0595"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74748"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP46"
FT                   /protein_id="AAK74748.1"
FT   gene            564986..565132
FT                   /locus_tag="SP_0596"
FT   CDS_pept        564986..565132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0596"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY5"
FT                   /protein_id="AAK74749.1"
FT                   YAR"
FT   gene            565278..565664
FT                   /pseudo
FT                   /locus_tag="SP_0597"
FT                   /note="Although this gene is truncated, 2 full length (1974
FT                   bp) copies fold into the secondary structures expected for
FT                   a group II intron. Left end = TTTTTTGCGGTACGACGGGC. Right
FT                   end = GAGATTATCCCCTACTCGAT.; group II intron, maturase,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   EGAD:135254"
FT   gene            565789..565953
FT                   /locus_tag="SP_0598"
FT   CDS_pept        565789..565953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY3"
FT                   /protein_id="AAK74750.1"
FT                   QQNSRKQSL"
FT   gene            565916..567079
FT                   /gene="vex1"
FT                   /locus_tag="SP_0599"
FT   CDS_pept        565916..567079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex1"
FT                   /locus_tag="SP_0599"
FT                   /product="transmembrane protein Vexp1"
FT                   /note="identified by similarity to GP:5712667; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74751"
FT                   /db_xref="GOA:A0A0H2UNY4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY4"
FT                   /protein_id="AAK74751.1"
FT   gene            567092..567739
FT                   /gene="vex2"
FT                   /locus_tag="SP_0600"
FT   CDS_pept        567092..567739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex2"
FT                   /locus_tag="SP_0600"
FT                   /product="ABC transporter, ATP-binding protein Vexp2"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74752"
FT                   /db_xref="GOA:A0A0H2UP16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP16"
FT                   /protein_id="AAK74752.1"
FT   gene            567791..569170
FT                   /gene="vex3"
FT                   /locus_tag="SP_0601"
FT   CDS_pept        567791..569170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex3"
FT                   /locus_tag="SP_0601"
FT                   /product="transmembrane protein Vexp3"
FT                   /note="identified by similarity to GP:5712669; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74753"
FT                   /db_xref="GOA:A0A0H2UP51"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP51"
FT                   /protein_id="AAK74753.1"
FT                   E"
FT   gene            569350..569433
FT                   /gene="pep27"
FT                   /locus_tag="SP_0602"
FT   CDS_pept        569350..569433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pep27"
FT                   /locus_tag="SP_0602"
FT                   /product="pep27 protein"
FT                   /note="identified by similarity to GP:5712670"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY9"
FT                   /protein_id="AAK74754.1"
FT                   /translation="MRKEFHNVLSSGQLLADKRPARDYNRK"
FT   gene            569482..570138
FT                   /gene="vncR"
FT                   /locus_tag="SP_0603"
FT   CDS_pept        569482..570138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncR"
FT                   /locus_tag="SP_0603"
FT                   /product="DNA-binding response regulator VncR"
FT                   /note="identified by similarity to GP:5830544; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74755"
FT                   /db_xref="GOA:A0A0H2UNY7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY7"
FT                   /protein_id="AAK74755.1"
FT   gene            570135..571463
FT                   /gene="vncS"
FT                   /locus_tag="SP_0604"
FT   CDS_pept        570135..571463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncS"
FT                   /locus_tag="SP_0604"
FT                   /product="sensor histidine kinase VncS"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to GP:5830545; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74756"
FT                   /db_xref="GOA:A0A0H2UNY8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNY8"
FT                   /protein_id="AAK74756.1"
FT   gene            571604..572485
FT                   /gene="fba"
FT                   /locus_tag="SP_0605"
FT   CDS_pept        571604..572485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SP_0605"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01859"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74757"
FT                   /db_xref="GOA:P0A4S1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4S1"
FT                   /protein_id="AAK74757.1"
FT                   ERIDVFGSEGKA"
FT   gene            complement(572806..574008)
FT                   /locus_tag="SP_0606"
FT   CDS_pept        complement(572806..574008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0606"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00175"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74758"
FT                   /db_xref="GOA:A0A0H2UP22"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP22"
FT                   /protein_id="AAK74758.1"
FT                   K"
FT   gene            complement(574254..574913)
FT                   /locus_tag="SP_0607"
FT   CDS_pept        complement(574254..574913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0607"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:37775; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74759"
FT                   /db_xref="GOA:A0A0H2UP56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP56"
FT                   /protein_id="AAK74759.1"
FT   gene            complement(574923..575600)
FT                   /locus_tag="SP_0608"
FT   CDS_pept        complement(574923..575600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0608"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:45958; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74760"
FT                   /db_xref="GOA:A0A0H2UNZ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ1"
FT                   /protein_id="AAK74760.1"
FT                   YSL"
FT   gene            complement(575613..576377)
FT                   /locus_tag="SP_0609"
FT   CDS_pept        complement(575613..576377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0609"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="identified by similarity to EGAD:17088; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74761"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ3"
FT                   /protein_id="AAK74761.1"
FT   gene            complement(576417..577175)
FT                   /locus_tag="SP_0610"
FT   CDS_pept        complement(576417..577175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0610"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P27675; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74762"
FT                   /db_xref="GOA:A0A0H2UNZ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ2"
FT                   /protein_id="AAK74762.1"
FT   gene            577452..579674
FT                   /gene="recJ"
FT                   /locus_tag="SP_0611"
FT   CDS_pept        577452..579674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="SP_0611"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to EGAD:24228; match to
FT                   protein family HMM PF01368; match to protein family HMM
FT                   PF02272; match to protein family HMM TIGR00644"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74763"
FT                   /db_xref="GOA:A0A0H2UP28"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR018779"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP28"
FT                   /protein_id="AAK74763.2"
FT   gene            579708..579806
FT                   /locus_tag="SP_0612"
FT   CDS_pept        579708..579806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0612"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74764"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP60"
FT                   /protein_id="AAK74764.1"
FT                   /translation="MKTDLHFENHQKNGIMVGKDSAESIRTFRIRG"
FT   gene            579849..581510
FT                   /locus_tag="SP_0613"
FT   CDS_pept        579849..581510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0613"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by similarity to EGAD:30422; match to
FT                   protein family HMM PF00753; match to protein family HMM
FT                   PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74765"
FT                   /db_xref="GOA:A0A0H2UNZ5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ5"
FT                   /protein_id="AAK74765.1"
FT   gene            581579..582358
FT                   /gene="estA"
FT                   /locus_tag="SP_0614"
FT   CDS_pept        581579..582358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA"
FT                   /locus_tag="SP_0614"
FT                   /product="tributyrin esterase"
FT                   /note="identified by similarity to GP:7453516; match to
FT                   protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74766"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:2UZ0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ8"
FT                   /protein_id="AAK74766.1"
FT   gene            582470..583690
FT                   /gene="fibA"
FT                   /locus_tag="SP_0615"
FT   CDS_pept        582470..583690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fibA"
FT                   /locus_tag="SP_0615"
FT                   /product="beta-lactam resistance factor"
FT                   /note="identified by similarity to GP:7649681; match to
FT                   protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74767"
FT                   /db_xref="GOA:A0A0H2UNZ9"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ9"
FT                   /protein_id="AAK74767.1"
FT                   LRKKHRK"
FT   gene            583695..584927
FT                   /gene="fibB"
FT                   /locus_tag="SP_0616"
FT   CDS_pept        583695..584927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fibB"
FT                   /locus_tag="SP_0616"
FT                   /product="beta-lactam resistance factor"
FT                   /note="identified by similarity to GP:7649683; match to
FT                   protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74768"
FT                   /db_xref="GOA:A0A0H2UP33"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP33"
FT                   /protein_id="AAK74768.1"
FT                   AIQLLKKIVGR"
FT   gene            584985..585707
FT                   /locus_tag="SP_0617"
FT   CDS_pept        584985..585707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0617"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00413"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74769"
FT                   /db_xref="GOA:A0A0H2UP65"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP65"
FT                   /protein_id="AAK74769.1"
FT                   GIQEEDVANLRKIYETSE"
FT   gene            585747..587591
FT                   /gene="uvrC"
FT                   /locus_tag="SP_0618"
FT   CDS_pept        585747..587591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="SP_0618"
FT                   /product="excinuclease ABC, subunit C"
FT                   /note="identified by similarity to EGAD:18538; match to
FT                   protein family HMM PF01541; match to protein family HMM
FT                   PF02151; match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74770"
FT                   /db_xref="GOA:Q97S07"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S07"
FT                   /protein_id="AAK74770.1"
FT   gene            587581..588414
FT                   /locus_tag="SP_0619"
FT   CDS_pept        587581..588414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:165239; match to
FT                   protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74771"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UNZ7"
FT                   /protein_id="AAK74771.1"
FT   gene            complement(588596..589396)
FT                   /locus_tag="SP_0620"
FT   CDS_pept        complement(588596..589396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0620"
FT                   /product="putative amino acid ABC transporter, amino
FT                   acid-binding protein"
FT                   /note="identified by similarity to EGAD:45957; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74772"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP02"
FT                   /protein_id="AAK74772.1"
FT   gene            589470..589580
FT                   /locus_tag="SP_0621"
FT   CDS_pept        589470..589580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0621"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74773"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP03"
FT                   /protein_id="AAK74773.1"
FT   gene            589567..590172
FT                   /locus_tag="SP_0622"
FT   CDS_pept        589567..590172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0622"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74774"
FT                   /db_xref="GOA:A0A0H2UP38"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:2B67"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP38"
FT                   /protein_id="AAK74774.1"
FT   gene            590185..591585
FT                   /gene="pepV"
FT                   /locus_tag="SP_0623"
FT   CDS_pept        590185..591585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepV"
FT                   /locus_tag="SP_0623"
FT                   /product="dipeptidase"
FT                   /note="identified by similarity to EGAD:128687; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   TIGR01886; match to protein family HMM TIGR01887"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74775"
FT                   /db_xref="GOA:A0A0H2UP69"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR011291"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP69"
FT                   /protein_id="AAK74775.1"
FT                   EAIYELIK"
FT   gene            591639..592217
FT                   /locus_tag="SP_0624"
FT   CDS_pept        591639..592217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:162574; match to
FT                   protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74776"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP01"
FT                   /protein_id="AAK74776.1"
FT   gene            592377..592664
FT                   /pseudo
FT                   /locus_tag="SP_0625"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   OMNI:NT01BS3531"
FT   gene            592820..594160
FT                   /gene="brnQ"
FT                   /locus_tag="SP_0626"
FT   CDS_pept        592820..594160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SP_0626"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by similarity to EGAD:22109; match to
FT                   protein family HMM PF05525; match to protein family HMM
FT                   TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74777"
FT                   /db_xref="GOA:A0A0H2UP06"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP06"
FT                   /protein_id="AAK74777.1"
FT   gene            594258..595295
FT                   /locus_tag="SP_0627"
FT   CDS_pept        594258..595295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74778"
FT                   /db_xref="GOA:A0A0H2UP05"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP05"
FT                   /protein_id="AAK74778.1"
FT                   STLVD"
FT   gene            595264..595767
FT                   /locus_tag="SP_0628"
FT   CDS_pept        595264..595767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0628"
FT                   /product="HIT family protein"
FT                   /note="identified by similarity to EGAD:51393; match to
FT                   protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74779"
FT                   /db_xref="GOA:A0A0H2UP45"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP45"
FT                   /protein_id="AAK74779.1"
FT                   EIKE"
FT   gene            595770..596486
FT                   /locus_tag="SP_0629"
FT   CDS_pept        595770..596486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:109297; match to
FT                   protein family HMM PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74780"
FT                   /db_xref="GOA:A0A0H2UP74"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="PDB:4NT9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP74"
FT                   /protein_id="AAK74780.1"
FT                   LSLEEYYGFEGGDYVD"
FT   gene            596795..597220
FT                   /gene="rplK"
FT                   /locus_tag="SP_0630"
FT   CDS_pept        596795..597220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SP_0630"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by similarity to EGAD:13156; match to
FT                   protein family HMM PF00298; match to protein family HMM
FT                   PF03946; match to protein family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74781"
FT                   /db_xref="GOA:Q97RZ6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RZ6"
FT                   /protein_id="AAK74781.1"
FT   gene            597427..598116
FT                   /gene="rplA"
FT                   /locus_tag="SP_0631"
FT   CDS_pept        597427..598116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SP_0631"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by similarity to EGAD:13176; match to
FT                   protein family HMM PF00687; match to protein family HMM
FT                   TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74782"
FT                   /db_xref="GOA:P66095"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66095"
FT                   /protein_id="AAK74782.1"
FT                   KVDVNSL"
FT   gene            598230..598343
FT                   /pseudo
FT                   /locus_tag="SP_0632"
FT                   /note="Although this gene is truncated, 2 full length (1974
FT                   bp) copies fold into the secondary structures expected for
FT                   a group II intron. Left end = TTTTTTGCGGTACGACGGGC. Right
FT                   end = GAGATTATCCCCTACTCGAT.; group II intron, maturase,
FT                   truncation; comparison of this gene to its homologs
FT                   suggests this gene has been truncated; identified by
FT                   similarity to GP:2804734"
FT   gene            598658..599020
FT                   /locus_tag="SP_0633"
FT   CDS_pept        598658..599020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0633"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74783"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP07"
FT                   /protein_id="AAK74783.1"
FT                   INVLELLDKSQPFEEE"
FT   gene            599323..599664
FT                   /locus_tag="SP_0634"
FT   CDS_pept        599323..599664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0634"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:7160903"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP12"
FT                   /protein_id="AAK74784.1"
FT                   RKRWSSWFR"
FT   gene            complement(599592..599759)
FT                   /locus_tag="SP_0635"
FT   CDS_pept        complement(599592..599759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0635"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP09"
FT                   /protein_id="AAK74785.1"
FT                   KLFSSQIISL"
FT   gene            600065..601057
FT                   /locus_tag="SP_0636"
FT   CDS_pept        600065..601057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0636"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74786"
FT                   /db_xref="GOA:A0A0H2UP49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP49"
FT                   /protein_id="AAK74786.1"
FT   gene            601059..601877
FT                   /locus_tag="SP_0637"
FT   CDS_pept        601059..601877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0637"
FT                   /product="membrane protein"
FT                   /note="identified by similarity to GP:7636000; match to
FT                   protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74787"
FT                   /db_xref="GOA:A0A0H2UP79"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP79"
FT                   /protein_id="AAK74787.1"
FT   gene            601879..602664
FT                   /locus_tag="SP_0638"
FT   CDS_pept        601879..602664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:173491; match to
FT                   protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74788"
FT                   /db_xref="GOA:A0A0H2UP10"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP10"
FT                   /protein_id="AAK74788.1"
FT   gene            602700..602981
FT                   /locus_tag="SP_0639"
FT   CDS_pept        602700..602981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74789"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP15"
FT                   /protein_id="AAK74789.1"
FT   gene            602918..603163
FT                   /locus_tag="SP_0640"
FT   CDS_pept        602918..603163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0640"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74790"
FT                   /db_xref="GOA:A0A0H2UP14"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP14"
FT                   /protein_id="AAK74790.1"
FT   gene            603895..610317
FT                   /locus_tag="SP_0641"
FT   CDS_pept        603895..610317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0641"
FT                   /product="serine protease, subtilase family"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02225; match to protein family HMM PF06280;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74791"
FT                   /db_xref="GOA:A0A0H2UP55"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP55"
FT                   /protein_id="AAK74791.1"
FT   gene            complement(610613..610947)
FT                   /pseudo
FT                   /locus_tag="SP_0642"
FT                   /note="IS1167, transposase, truncation; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by similarity to GP:2804700"
FT   gene            complement(611051..611197)
FT                   /locus_tag="SP_0643"
FT   CDS_pept        complement(611051..611197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0643"
FT                   /product="transposase family protein, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75783"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XFG5"
FT                   /protein_id="ABC75783.1"
FT                   IVK"
FT   gene            611267..612350
FT                   /pseudo
FT                   /locus_tag="SP_0644"
FT                   /note="This gene has an N-terminal truncation, and is
FT                   interrupted by an RUP element. IRleft = deleted. IRright =
FT                   GTAACCGCCCAATAACGAAG.; IS66 family element, Orf3,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:6009427"
FT   gene            612684..613181
FT                   /locus_tag="SP_0645"
FT   CDS_pept        612684..613181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0645"
FT                   /product="putative PTS system IIA component"
FT                   /note="identified by similarity to EGAD:10467; match to
FT                   protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74792"
FT                   /db_xref="GOA:A0A0H2UP84"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP84"
FT                   /protein_id="AAK74792.1"
FT                   TA"
FT   gene            613219..613524
FT                   /locus_tag="SP_0646"
FT   CDS_pept        613219..613524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0646"
FT                   /product="putative PTS system, IIB component"
FT                   /note="identified by similarity to EGAD:7759"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74793"
FT                   /db_xref="GOA:A0A0H2UP17"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP17"
FT                   /protein_id="AAK74793.1"
FT   gene            613572..615047
FT                   /locus_tag="SP_0647"
FT   CDS_pept        613572..615047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0647"
FT                   /product="putative PTS system, IIC component"
FT                   /note="identified by similarity to EGAD:91348; match to
FT                   protein family HMM PF03611"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74794"
FT                   /db_xref="GOA:A0A0H2UP20"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP20"
FT                   /protein_id="AAK74794.1"
FT   gene            615442..622143
FT                   /gene="bgaA"
FT                   /locus_tag="SP_0648"
FT   CDS_pept        615442..622143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgaA"
FT                   /locus_tag="SP_0648"
FT                   /product="beta-galactosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:9664865; match to
FT                   protein family HMM PF00703; match to protein family HMM
FT                   PF00746; match to protein family HMM PF02836; match to
FT                   protein family HMM PF02837; match to protein family HMM
FT                   PF04650; match to protein family HMM PF07501; match to
FT                   protein family HMM PF07532; match to protein family HMM
FT                   TIGR01167; match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74795"
FT                   /db_xref="GOA:A0A0H2UP19"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="PDB:4CU6"
FT                   /db_xref="PDB:4CU7"
FT                   /db_xref="PDB:4CU8"
FT                   /db_xref="PDB:4CUC"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP19"
FT                   /protein_id="AAK74795.1"
FT                   GKKED"
FT   gene            complement(622391..623247)
FT                   /pseudo
FT                   /locus_tag="SP_0649"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:8918792"
FT   gene            complement(623457..623777)
FT                   /locus_tag="SP_0650"
FT   CDS_pept        complement(623457..623777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74796"
FT                   /db_xref="GOA:A0A0H2UP61"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP61"
FT                   /protein_id="AAK74796.1"
FT                   MK"
FT   gene            623839..624864
FT                   /pseudo
FT                   /locus_tag="SP_0651"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a frame shift which is not the
FT                   result of sequencing error; identified by similarity to
FT                   EGAD:108408"
FT   gene            624848..625405
FT                   /locus_tag="SP_0652"
FT   CDS_pept        624848..625405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:176766; match to
FT                   protein family HMM PF06962"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74797"
FT                   /db_xref="GOA:A0A0H2UP89"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP89"
FT                   /protein_id="AAK74797.1"
FT   gene            625398..625652
FT                   /locus_tag="SP_0653"
FT   CDS_pept        625398..625652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0653"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP21"
FT                   /protein_id="AAK74798.1"
FT   gene            625627..625728
FT                   /locus_tag="SP_0654"
FT   CDS_pept        625627..625728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0654"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74799"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP24"
FT                   /protein_id="AAK74799.1"
FT   gene            625664..627718
FT                   /locus_tag="SP_0655"
FT                   /note="SP06565"
FT   CDS_pept        625664..627718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0655"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 (CPA2) family"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74800"
FT                   /db_xref="GOA:A0A0H2UP25"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP25"
FT                   /protein_id="AAK74800.2"
FT   gene            627897..628757
FT                   /locus_tag="SP_0657"
FT   CDS_pept        627897..628757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0657"
FT                   /product="putative ribonuclease BN"
FT                   /note="identified by similarity to OMNI:NT03PA3143; match
FT                   to protein family HMM PF03631"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74802"
FT                   /db_xref="GOA:A0A0H2UP68"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP68"
FT                   /protein_id="AAK74802.1"
FT                   VFKKD"
FT   gene            628968..629678
FT                   /gene="ccdA-1"
FT                   /locus_tag="SP_0658"
FT   CDS_pept        628968..629678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA-1"
FT                   /locus_tag="SP_0658"
FT                   /product="cytochrome c-type biogenesis protein CcdA"
FT                   /note="identified by similarity to GP:6714962; match to
FT                   protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74803"
FT                   /db_xref="GOA:A0A0H2UP93"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP93"
FT                   /protein_id="AAK74803.1"
FT                   VLFGNASILSQLFE"
FT   gene            629698..630264
FT                   /locus_tag="SP_0659"
FT   CDS_pept        629698..630264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0659"
FT                   /product="thioredoxin family protein"
FT                   /note="identified by similarity to EGAD:28452"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74804"
FT                   /db_xref="GOA:A0A0H2UP26"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:4EVM"
FT                   /db_xref="PDB:4HQS"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP26"
FT                   /protein_id="AAK74804.1"
FT   gene            630452..631387
FT                   /gene="msrA-1"
FT                   /locus_tag="SP_0660"
FT   CDS_pept        630452..631387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA-1"
FT                   /locus_tag="SP_0660"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P35593; match to
FT                   protein family HMM PF01625; match to protein family HMM
FT                   PF01641; match to protein family HMM TIGR00357; match to
FT                   protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74805"
FT                   /db_xref="GOA:P65443"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65443"
FT                   /protein_id="AAK74805.1"
FT   gene            631655..632392
FT                   /locus_tag="SP_0661"
FT   CDS_pept        631655..632392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0661"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74806"
FT                   /db_xref="GOA:A0A0H2UP29"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP29"
FT                   /protein_id="AAK74806.1"
FT   gene            632389..634080
FT                   /locus_tag="SP_0662"
FT   CDS_pept        632389..634080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0662"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF02743; match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74807"
FT                   /db_xref="GOA:A0A0H2UP30"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP30"
FT                   /protein_id="AAK74807.1"
FT   gene            634196..634759
FT                   /locus_tag="SP_0663"
FT   CDS_pept        634196..634759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:30371; match to
FT                   protein family HMM PF04260; match to protein family HMM
FT                   TIGR01440"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74808"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RX2"
FT                   /protein_id="AAK74808.1"
FT   gene            634856..640501
FT                   /gene="zmpB"
FT                   /locus_tag="SP_0664"
FT   CDS_pept        634856..640501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpB"
FT                   /locus_tag="SP_0664"
FT                   /product="zinc metalloprotease ZmpB"
FT                   /note="identified by similarity to GP:6911257; match to
FT                   protein family HMM PF00746; match to protein family HMM
FT                   PF05342; match to protein family HMM PF07554; match to
FT                   protein family HMM PF07580; match to protein family HMM
FT                   PF07581; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74809"
FT                   /db_xref="GOA:Q9L7Q2"
FT                   /db_xref="InterPro:IPR008006"
FT                   /db_xref="InterPro:IPR011505"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9L7Q2"
FT                   /protein_id="AAK74809.1"
FT                   FKTSIFK"
FT   gene            640562..642283
FT                   /locus_tag="SP_0665"
FT   CDS_pept        640562..642283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0665"
FT                   /product="chorismate binding enzyme"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM TIGR00553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74810"
FT                   /db_xref="GOA:A0A0H2UP73"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP73"
FT                   /protein_id="AAK74810.1"
FT   gene            642284..642901
FT                   /locus_tag="SP_0666"
FT   CDS_pept        642284..642901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0666"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4704711"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74811"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP99"
FT                   /protein_id="AAK74811.1"
FT   gene            642951..643949
FT                   /locus_tag="SP_0667"
FT   CDS_pept        642951..643949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0667"
FT                   /product="putative pneumococcal surface protein"
FT                   /note="identified by match to protein family HMM PF01473;
FT                   match to protein family HMM PF05901; match to protein
FT                   family HMM PF07553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74812"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR011434"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PDB:4CNL"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP31"
FT                   /protein_id="AAK74812.1"
FT   gene            644073..645035
FT                   /gene="gki"
FT                   /locus_tag="SP_0668"
FT   CDS_pept        644073..645035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gki"
FT                   /locus_tag="SP_0668"
FT                   /product="glucokinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to EGAD:130279; match to
FT                   protein family HMM PF00480; match to protein family HMM
FT                   TIGR00744"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74813"
FT                   /db_xref="GOA:A0A0H2UP34"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2UP34"
FT                   /protein_id="AAK74813.2"
FT   gene            645132..645971
FT                   /gene="thyA"
FT                   /locus_tag="SP_0669"
FT   CDS_pept        645132..645971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="SP_0669"
FT                   /product="thymidylate synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00303"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74814"
FT                   /db_xref="GOA:P67049"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67049"
FT                   /protein_id="AAK74814.1"
FT                   RVDG