(data stored in ACNUC7421 zone)

EMBL: AE006468

ID   AE006468; SV 2; circular; genomic DNA; STD; PRO; 4857450 BP.
XX
AC   AE006468; AE008693-AE008916;
XX
PR   Project:PRJNA241;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   30-JUL-2018 (Rel. 137, Last updated, Version 13)
XX
DE   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2, complete
DE   genome.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
OS   Salmonella phage Fels-1
OC   Viruses; unclassified bacterial viruses.
XX
OS   Phage Gifsy-2
OC   Viruses; unclassified bacterial viruses.
XX
OS   Phage Gifsy-1
OC   Viruses; unclassified bacterial viruses.
XX
OS   Salmonella virus Fels2
OC   Viruses; Caudovirales; Myoviridae; Peduovirinae; Peduovirus.
XX
RN   [1]
RP   1-4857450
RX   DOI; 10.1038/35101614.
RX   PUBMED; 11677609.
RA   McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P.,
RA   Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D.,
RA   Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E.,
RA   Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R.,
RA   Wilson R.K.;
RT   "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2";
RL   Nature 413(6858):852-856(2001).
XX
RN   [2]
RP   1-4857450
RG   The Salmonella typhimurium Genome Sequencing Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2001) to the INSDC.
RL   Genome Sequencing Center, Department of Genetics, Washington University
RL   School of Medicine, 4444 Forest Park Boulevard, St. Louis, MO 63108, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-4857450
RA   McClelland M., Jain A., Saraogi P., Mendelson R., Westerman R.,
RA   SanMiguel P., Csonka L.;
RT   ;
RL   Submitted (13-JAN-2016) to the INSDC.
RL   Department of Microbiology and Molecular Genetics, University of
RL   California, Irvine, CA 92697, USA
XX
DR   MD5; 3061e637c3303dd13b1a7900541da519.
DR   BioSample; SAMN02604315.
DR   CABRI; LMBP 6728.
DR   CABRI; LMBP 6729.
DR   CABRI; LMBP 6730.
DR   CABRI; LMBP 6731.
DR   CABRI; LMBP 6732.
DR   CABRI; LMBP 6733.
DR   CABRI; LMBP 6772.
DR   CABRI; LMBP 6773.
DR   CABRI; LMBP 6774.
DR   CABRI; LMBP 6775.
DR   CABRI; LMBP 6776.
DR   CABRI; LMBP 6777.
DR   CABRI; LMBP 6779.
DR   CABRI; LMBP 6860.
DR   CABRI; LMBP 6861.
DR   CABRI; LMBP 6862.
DR   CABRI; LMBP 6863.
DR   CABRI; LMBP 6868.
DR   CABRI; LMBP 6869.
DR   CABRI; LMBP 6870.
DR   CABRI; LMBP 6873.
DR   CABRI; LMBP 6876.
DR   CABRI; LMBP 6877.
DR   CABRI; LMBP 6878.
DR   CABRI; LMBP 6880.
DR   CABRI; LMBP 7242.
DR   CABRI; LMBP 7245.
DR   CABRI; LMBP 7246.
DR   CABRI; LMBP 7247.
DR   CABRI; LMBP 7248.
DR   CABRI; LMBP 7249.
DR   CABRI; LMBP 7250.
DR   CABRI; LMBP 8982.
DR   CABRI; LMBP 8983.
DR   CABRI; LMBP 8984.
DR   CABRI; LMBP 8987.
DR   CABRI; LMBP 8989.
DR   CABRI; LMBP 8991.
DR   CABRI; LMBP 8994.
DR   CABRI; LMBP 8995.
DR   COMPARE-RefGenome; LT2.
DR   EnsemblGenomes-Gn; STM0249.
DR   EnsemblGenomes-Gn; STM0250.
DR   EnsemblGenomes-Gn; STM0251.
DR   EnsemblGenomes-Gn; STM0252.
DR   EnsemblGenomes-Gn; STM0253.
DR   EnsemblGenomes-Gn; STM0254.
DR   EnsemblGenomes-Gn; STM0265.
DR   EnsemblGenomes-Gn; STM0323.
DR   EnsemblGenomes-Gn; STM0467.
DR   EnsemblGenomes-Gn; STM0553.
DR   EnsemblGenomes-Gn; STM0673.
DR   EnsemblGenomes-Gn; STM0674.
DR   EnsemblGenomes-Gn; STM0675.
DR   EnsemblGenomes-Gn; STM0676.
DR   EnsemblGenomes-Gn; STM0677.
DR   EnsemblGenomes-Gn; STM0678.
DR   EnsemblGenomes-Gn; STM0679.
DR   EnsemblGenomes-Gn; STM0751.
DR   EnsemblGenomes-Gn; STM0752.
DR   EnsemblGenomes-Gn; STM0753.
DR   EnsemblGenomes-Gn; STM0754.
DR   EnsemblGenomes-Gn; STM0755.
DR   EnsemblGenomes-Gn; STM0949.
DR   EnsemblGenomes-Gn; STM1086.
DR   EnsemblGenomes-Gn; STM1134.
DR   EnsemblGenomes-Gn; STM1247.
DR   EnsemblGenomes-Gn; STM1262.
DR   EnsemblGenomes-Gn; STM1363.
DR   EnsemblGenomes-Gn; STM1423.
DR   EnsemblGenomes-Gn; STM1424.
DR   EnsemblGenomes-Gn; STM1757.
DR   EnsemblGenomes-Gn; STM1758.
DR   EnsemblGenomes-Gn; STM1759.
DR   EnsemblGenomes-Gn; STM1942.
DR   EnsemblGenomes-Gn; STM1943.
DR   EnsemblGenomes-Gn; STM1944.
DR   EnsemblGenomes-Gn; STM1983.
DR   EnsemblGenomes-Gn; STM1985.
DR   EnsemblGenomes-Gn; STM2000.
DR   EnsemblGenomes-Gn; STM2002.
DR   EnsemblGenomes-Gn; STM2004.
DR   EnsemblGenomes-Gn; STM2012.
DR   EnsemblGenomes-Gn; STM2014.
DR   EnsemblGenomes-Gn; STM2229.
DR   EnsemblGenomes-Gn; STM2268.
DR   EnsemblGenomes-Gn; STM2394.
DR   EnsemblGenomes-Gn; STM2411.
DR   EnsemblGenomes-Gn; STM2412.
DR   EnsemblGenomes-Gn; STM2416.
DR   EnsemblGenomes-Gn; STM2417.
DR   EnsemblGenomes-Gn; STM2418.
DR   EnsemblGenomes-Gn; STM2419.
DR   EnsemblGenomes-Gn; STM2615.
DR   EnsemblGenomes-Gn; STM2656.
DR   EnsemblGenomes-Gn; STM2657.
DR   EnsemblGenomes-Gn; STM2658.
DR   EnsemblGenomes-Gn; STM2659.
DR   EnsemblGenomes-Gn; STM2693.
DR   EnsemblGenomes-Gn; STM2821.
DR   EnsemblGenomes-Gn; STM2822.
DR   EnsemblGenomes-Gn; STM2823.
DR   EnsemblGenomes-Gn; STM2824.
DR   EnsemblGenomes-Gn; STM2825.
DR   EnsemblGenomes-Gn; STM2966.
DR   EnsemblGenomes-Gn; STM2989.
DR   EnsemblGenomes-Gn; STM2990.
DR   EnsemblGenomes-Gn; STM3037.
DR   EnsemblGenomes-Gn; STM3116.
DR   EnsemblGenomes-Gn; STM3213.
DR   EnsemblGenomes-Gn; STM3246.
DR   EnsemblGenomes-Gn; STM3289.
DR   EnsemblGenomes-Gn; STM3292.
DR   EnsemblGenomes-Gn; STM3393.
DR   EnsemblGenomes-Gn; STM3394.
DR   EnsemblGenomes-Gn; STM3395.
DR   EnsemblGenomes-Gn; STM3396.
DR   EnsemblGenomes-Gn; STM3397.
DR   EnsemblGenomes-Gn; STM3398.
DR   EnsemblGenomes-Gn; STM3634.
DR   EnsemblGenomes-Gn; STM3751.
DR   EnsemblGenomes-Gn; STM3889.
DR   EnsemblGenomes-Gn; STM3890.
DR   EnsemblGenomes-Gn; STM3891.
DR   EnsemblGenomes-Gn; STM3893.
DR   EnsemblGenomes-Gn; STM3894.
DR   EnsemblGenomes-Gn; STM3895.
DR   EnsemblGenomes-Gn; STM3896.
DR   EnsemblGenomes-Gn; STM3931.
DR   EnsemblGenomes-Gn; STM3932.
DR   EnsemblGenomes-Gn; STM3933.
DR   EnsemblGenomes-Gn; STM3934.
DR   EnsemblGenomes-Gn; STM3988.
DR   EnsemblGenomes-Gn; STM3989.
DR   EnsemblGenomes-Gn; STM3990.
DR   EnsemblGenomes-Gn; STM3991.
DR   EnsemblGenomes-Gn; STM3992.
DR   EnsemblGenomes-Gn; STM4132.
DR   EnsemblGenomes-Gn; STM4133.
DR   EnsemblGenomes-Gn; STM4134.
DR   EnsemblGenomes-Gn; STM4135.
DR   EnsemblGenomes-Gn; STM4136.
DR   EnsemblGenomes-Gn; STM4142.
DR   EnsemblGenomes-Gn; STM4143.
DR   EnsemblGenomes-Gn; STM4144.
DR   EnsemblGenomes-Gn; STM4145.
DR   EnsemblGenomes-Gn; STM4177.
DR   EnsemblGenomes-Gn; STM4178.
DR   EnsemblGenomes-Gn; STM4179.
DR   EnsemblGenomes-Gn; STM4180.
DR   EnsemblGenomes-Gn; STM4321.
DR   EnsemblGenomes-Gn; STM4352.
DR   EnsemblGenomes-Gn; STM4353.
DR   EnsemblGenomes-Gn; STM4354.
DR   EnsemblGenomes-Gn; STM4487.
DR   EnsemblGenomes-Gn; STM4553.
DR   EnsemblGenomes-Gn; STM4554.
DR   EnsemblGenomes-Gn; STM4555.
DR   EnsemblGenomes-Tr; EBT00001761199.
DR   EnsemblGenomes-Tr; EBT00001761200.
DR   EnsemblGenomes-Tr; EBT00001761201.
DR   EnsemblGenomes-Tr; EBT00001761204.
DR   EnsemblGenomes-Tr; EBT00001761205.
DR   EnsemblGenomes-Tr; EBT00001761207.
DR   EnsemblGenomes-Tr; EBT00001761209.
DR   EnsemblGenomes-Tr; EBT00001761210.
DR   EnsemblGenomes-Tr; EBT00001761213.
DR   EnsemblGenomes-Tr; EBT00001761215.
DR   EnsemblGenomes-Tr; EBT00001761217.
DR   EnsemblGenomes-Tr; EBT00001761219.
DR   EnsemblGenomes-Tr; EBT00001761221.
DR   EnsemblGenomes-Tr; EBT00001761223.
DR   EnsemblGenomes-Tr; EBT00001761224.
DR   EnsemblGenomes-Tr; EBT00001761226.
DR   EnsemblGenomes-Tr; EBT00001761228.
DR   EnsemblGenomes-Tr; EBT00001761231.
DR   EnsemblGenomes-Tr; EBT00001761232.
DR   EnsemblGenomes-Tr; EBT00001761235.
DR   EnsemblGenomes-Tr; EBT00001761236.
DR   EnsemblGenomes-Tr; EBT00001761239.
DR   EnsemblGenomes-Tr; EBT00001761241.
DR   EnsemblGenomes-Tr; EBT00001761242.
DR   EnsemblGenomes-Tr; EBT00001761244.
DR   EnsemblGenomes-Tr; EBT00001761247.
DR   EnsemblGenomes-Tr; EBT00001761249.
DR   EnsemblGenomes-Tr; EBT00001761251.
DR   EnsemblGenomes-Tr; EBT00001761253.
DR   EnsemblGenomes-Tr; EBT00001761254.
DR   EnsemblGenomes-Tr; EBT00001761256.
DR   EnsemblGenomes-Tr; EBT00001761257.
DR   EnsemblGenomes-Tr; EBT00001761260.
DR   EnsemblGenomes-Tr; EBT00001761262.
DR   EnsemblGenomes-Tr; EBT00001761264.
DR   EnsemblGenomes-Tr; EBT00001761267.
DR   EnsemblGenomes-Tr; EBT00001761269.
DR   EnsemblGenomes-Tr; EBT00001761271.
DR   EnsemblGenomes-Tr; EBT00001761273.
DR   EnsemblGenomes-Tr; EBT00001761275.
DR   EnsemblGenomes-Tr; EBT00001761277.
DR   EnsemblGenomes-Tr; EBT00001761279.
DR   EnsemblGenomes-Tr; EBT00001761280.
DR   EnsemblGenomes-Tr; EBT00001761281.
DR   EnsemblGenomes-Tr; EBT00001761282.
DR   EnsemblGenomes-Tr; EBT00001761283.
DR   EnsemblGenomes-Tr; EBT00001761284.
DR   EnsemblGenomes-Tr; EBT00001761285.
DR   EnsemblGenomes-Tr; EBT00001761286.
DR   EnsemblGenomes-Tr; EBT00001761287.
DR   EnsemblGenomes-Tr; EBT00001761288.
DR   EnsemblGenomes-Tr; EBT00001761289.
DR   EnsemblGenomes-Tr; EBT00001761290.
DR   EnsemblGenomes-Tr; EBT00001761291.
DR   EnsemblGenomes-Tr; EBT00001761292.
DR   EnsemblGenomes-Tr; EBT00001761293.
DR   EnsemblGenomes-Tr; EBT00001761294.
DR   EnsemblGenomes-Tr; EBT00001761295.
DR   EnsemblGenomes-Tr; EBT00001761296.
DR   EnsemblGenomes-Tr; EBT00001761297.
DR   EnsemblGenomes-Tr; EBT00001761298.
DR   EnsemblGenomes-Tr; EBT00001761299.
DR   EnsemblGenomes-Tr; EBT00001761300.
DR   EnsemblGenomes-Tr; EBT00001761301.
DR   EnsemblGenomes-Tr; EBT00001761302.
DR   EnsemblGenomes-Tr; EBT00001761303.
DR   EnsemblGenomes-Tr; EBT00001761304.
DR   EnsemblGenomes-Tr; EBT00001761305.
DR   EnsemblGenomes-Tr; EBT00001761306.
DR   EnsemblGenomes-Tr; EBT00001761307.
DR   EnsemblGenomes-Tr; EBT00001761308.
DR   EnsemblGenomes-Tr; EBT00001761309.
DR   EnsemblGenomes-Tr; EBT00001761310.
DR   EnsemblGenomes-Tr; EBT00001761311.
DR   EnsemblGenomes-Tr; EBT00001761312.
DR   EnsemblGenomes-Tr; EBT00001761313.
DR   EnsemblGenomes-Tr; EBT00001761314.
DR   EnsemblGenomes-Tr; EBT00001761315.
DR   EnsemblGenomes-Tr; EBT00001761316.
DR   EnsemblGenomes-Tr; EBT00001761317.
DR   EnsemblGenomes-Tr; EBT00001761318.
DR   EnsemblGenomes-Tr; EBT00001761319.
DR   EnsemblGenomes-Tr; EBT00001761320.
DR   EnsemblGenomes-Tr; EBT00001761321.
DR   EnsemblGenomes-Tr; EBT00001761322.
DR   EnsemblGenomes-Tr; EBT00001761323.
DR   EnsemblGenomes-Tr; EBT00001761324.
DR   EnsemblGenomes-Tr; EBT00001761325.
DR   EnsemblGenomes-Tr; EBT00001761326.
DR   EnsemblGenomes-Tr; EBT00001761327.
DR   EnsemblGenomes-Tr; EBT00001761328.
DR   EnsemblGenomes-Tr; EBT00001761329.
DR   EnsemblGenomes-Tr; EBT00001761330.
DR   EnsemblGenomes-Tr; EBT00001761331.
DR   EnsemblGenomes-Tr; EBT00001761332.
DR   EnsemblGenomes-Tr; EBT00001761333.
DR   EnsemblGenomes-Tr; EBT00001761334.
DR   EnsemblGenomes-Tr; EBT00001761335.
DR   EnsemblGenomes-Tr; EBT00001761336.
DR   EnsemblGenomes-Tr; EBT00001761337.
DR   EnsemblGenomes-Tr; EBT00001761338.
DR   EnsemblGenomes-Tr; EBT00001761339.
DR   EnsemblGenomes-Tr; EBT00001761340.
DR   EnsemblGenomes-Tr; EBT00001761341.
DR   EnsemblGenomes-Tr; EBT00001761342.
DR   EnsemblGenomes-Tr; EBT00001761343.
DR   EnsemblGenomes-Tr; EBT00001761344.
DR   EnsemblGenomes-Tr; EBT00001761345.
DR   EnsemblGenomes-Tr; EBT00001761346.
DR   EnsemblGenomes-Tr; EBT00001761347.
DR   EnsemblGenomes-Tr; EBT00001761348.
DR   EnsemblGenomes-Tr; EBT00001761349.
DR   EnsemblGenomes-Tr; EBT00001761350.
DR   EnsemblGenomes-Tr; EBT00001761351.
DR   EnsemblGenomes-Tr; EBT00001761352.
DR   EnsemblGenomes-Tr; EBT00001761353.
DR   EnsemblGenomes-Tr; EBT00001761354.
DR   EnsemblGenomes-Tr; EBT00001761355.
DR   EnsemblGenomes-Tr; EBT00001761356.
DR   EnsemblGenomes-Tr; EBT00001761357.
DR   EnsemblGenomes-Tr; EBT00001761358.
DR   EnsemblGenomes-Tr; EBT00001761359.
DR   EnsemblGenomes-Tr; EBT00001761360.
DR   EnsemblGenomes-Tr; EBT00001761361.
DR   EnsemblGenomes-Tr; EBT00001761362.
DR   EnsemblGenomes-Tr; EBT00001761363.
DR   EnsemblGenomes-Tr; EBT00001761364.
DR   EnsemblGenomes-Tr; EBT00001761365.
DR   EnsemblGenomes-Tr; EBT00001761366.
DR   EnsemblGenomes-Tr; EBT00001761367.
DR   EnsemblGenomes-Tr; EBT00001761368.
DR   EnsemblGenomes-Tr; EBT00001761369.
DR   EnsemblGenomes-Tr; EBT00001761370.
DR   EnsemblGenomes-Tr; EBT00001761371.
DR   EnsemblGenomes-Tr; EBT00001761372.
DR   EnsemblGenomes-Tr; EBT00001761373.
DR   EnsemblGenomes-Tr; EBT00001761374.
DR   EnsemblGenomes-Tr; EBT00001761375.
DR   EnsemblGenomes-Tr; EBT00001761376.
DR   EnsemblGenomes-Tr; EBT00001761377.
DR   EnsemblGenomes-Tr; EBT00001761378.
DR   EnsemblGenomes-Tr; EBT00001761379.
DR   EnsemblGenomes-Tr; EBT00001761380.
DR   EnsemblGenomes-Tr; EBT00001761381.
DR   EnsemblGenomes-Tr; EBT00001761382.
DR   EnsemblGenomes-Tr; EBT00001761383.
DR   EnsemblGenomes-Tr; EBT00001761384.
DR   EnsemblGenomes-Tr; EBT00001761385.
DR   EnsemblGenomes-Tr; EBT00001761386.
DR   EnsemblGenomes-Tr; EBT00001761387.
DR   EnsemblGenomes-Tr; EBT00001761388.
DR   EnsemblGenomes-Tr; EBT00001761389.
DR   EnsemblGenomes-Tr; EBT00001761390.
DR   EnsemblGenomes-Tr; EBT00001761391.
DR   EnsemblGenomes-Tr; EBT00001761392.
DR   EnsemblGenomes-Tr; EBT00001761393.
DR   EnsemblGenomes-Tr; EBT00001761394.
DR   EnsemblGenomes-Tr; EBT00001761395.
DR   EnsemblGenomes-Tr; EBT00001761396.
DR   EnsemblGenomes-Tr; EBT00001761397.
DR   EnsemblGenomes-Tr; EBT00001761398.
DR   EnsemblGenomes-Tr; EBT00001761399.
DR   EnsemblGenomes-Tr; EBT00001761400.
DR   EnsemblGenomes-Tr; EBT00001761401.
DR   EnsemblGenomes-Tr; EBT00001761402.
DR   EnsemblGenomes-Tr; EBT00001761403.
DR   EnsemblGenomes-Tr; EBT00001761404.
DR   EnsemblGenomes-Tr; EBT00001761405.
DR   EnsemblGenomes-Tr; EBT00001761406.
DR   EnsemblGenomes-Tr; EBT00001761407.
DR   EnsemblGenomes-Tr; EBT00001761408.
DR   EnsemblGenomes-Tr; EBT00001761409.
DR   EnsemblGenomes-Tr; EBT00001761410.
DR   EnsemblGenomes-Tr; EBT00001761411.
DR   EnsemblGenomes-Tr; EBT00001761412.
DR   EnsemblGenomes-Tr; EBT00001761413.
DR   EnsemblGenomes-Tr; EBT00001761414.
DR   EnsemblGenomes-Tr; EBT00001761415.
DR   EnsemblGenomes-Tr; EBT00001761416.
DR   EnsemblGenomes-Tr; EBT00001761417.
DR   EnsemblGenomes-Tr; EBT00001761418.
DR   EnsemblGenomes-Tr; EBT00001761419.
DR   EnsemblGenomes-Tr; EBT00001761420.
DR   EnsemblGenomes-Tr; EBT00001761421.
DR   EnsemblGenomes-Tr; EBT00001761422.
DR   EnsemblGenomes-Tr; EBT00001761423.
DR   EnsemblGenomes-Tr; EBT00001761424.
DR   EnsemblGenomes-Tr; EBT00001761425.
DR   EnsemblGenomes-Tr; EBT00001761426.
DR   EnsemblGenomes-Tr; EBT00001761427.
DR   EnsemblGenomes-Tr; EBT00001761428.
DR   EnsemblGenomes-Tr; EBT00001761429.
DR   EnsemblGenomes-Tr; EBT00001761430.
DR   EnsemblGenomes-Tr; EBT00001761431.
DR   EnsemblGenomes-Tr; EBT00001761432.
DR   EnsemblGenomes-Tr; EBT00001761433.
DR   EnsemblGenomes-Tr; EBT00001761434.
DR   EnsemblGenomes-Tr; EBT00001761435.
DR   EnsemblGenomes-Tr; EBT00001761436.
DR   EnsemblGenomes-Tr; EBT00001761437.
DR   EnsemblGenomes-Tr; EBT00001761438.
DR   EnsemblGenomes-Tr; EBT00001761439.
DR   EnsemblGenomes-Tr; EBT00001761440.
DR   EnsemblGenomes-Tr; EBT00001761441.
DR   EnsemblGenomes-Tr; EBT00001761442.
DR   EnsemblGenomes-Tr; EBT00001761443.
DR   EnsemblGenomes-Tr; EBT00001761444.
DR   EnsemblGenomes-Tr; EBT00001761445.
DR   EnsemblGenomes-Tr; EBT00001761446.
DR   EnsemblGenomes-Tr; EBT00001761449.
DR   EnsemblGenomes-Tr; EBT00001761451.
DR   EnsemblGenomes-Tr; EBT00001761453.
DR   EnsemblGenomes-Tr; EBT00001761455.
DR   EnsemblGenomes-Tr; EBT00001761456.
DR   EnsemblGenomes-Tr; EBT00001761457.
DR   EnsemblGenomes-Tr; EBT00001761458.
DR   EnsemblGenomes-Tr; EBT00001761460.
DR   EnsemblGenomes-Tr; EBT00001761463.
DR   EnsemblGenomes-Tr; EBT00001761465.
DR   EnsemblGenomes-Tr; EBT00001761468.
DR   EnsemblGenomes-Tr; EBT00001761470.
DR   EnsemblGenomes-Tr; EBT00001761472.
DR   EnsemblGenomes-Tr; EBT00001761474.
DR   EnsemblGenomes-Tr; EBT00001761475.
DR   EnsemblGenomes-Tr; EBT00001761478.
DR   EnsemblGenomes-Tr; EBT00001761479.
DR   EnsemblGenomes-Tr; EBT00001761481.
DR   EnsemblGenomes-Tr; EBT00001761483.
DR   EnsemblGenomes-Tr; EBT00001761485.
DR   EnsemblGenomes-Tr; EBT00001761487.
DR   EnsemblGenomes-Tr; EBT00001761490.
DR   EnsemblGenomes-Tr; EBT00001761494.
DR   EnsemblGenomes-Tr; EBT00001761496.
DR   EnsemblGenomes-Tr; EBT00001761497.
DR   EnsemblGenomes-Tr; EBT00001761500.
DR   EnsemblGenomes-Tr; EBT00001761501.
DR   EnsemblGenomes-Tr; EBT00001761503.
DR   EnsemblGenomes-Tr; EBT00001761505.
DR   EnsemblGenomes-Tr; EBT00001761506.
DR   EnsemblGenomes-Tr; EBT00001761507.
DR   EnsemblGenomes-Tr; EBT00001761509.
DR   EnsemblGenomes-Tr; EBT00001761512.
DR   EnsemblGenomes-Tr; EBT00001761514.
DR   EnsemblGenomes-Tr; EBT00001761515.
DR   EnsemblGenomes-Tr; EBT00001761518.
DR   EnsemblGenomes-Tr; EBT00001761520.
DR   EnsemblGenomes-Tr; EBT00001761521.
DR   EnsemblGenomes-Tr; EBT00001761524.
DR   EnsemblGenomes-Tr; EBT00001761526.
DR   EnsemblGenomes-Tr; EBT00001761528.
DR   EnsemblGenomes-Tr; EBT00001761530.
DR   EnsemblGenomes-Tr; EBT00001761532.
DR   EnsemblGenomes-Tr; EBT00001761534.
DR   EnsemblGenomes-Tr; EBT00001761535.
DR   EnsemblGenomes-Tr; STM0249-1.
DR   EnsemblGenomes-Tr; STM0250-1.
DR   EnsemblGenomes-Tr; STM0251-1.
DR   EnsemblGenomes-Tr; STM0252-1.
DR   EnsemblGenomes-Tr; STM0253-1.
DR   EnsemblGenomes-Tr; STM0254-1.
DR   EnsemblGenomes-Tr; STM0265-1.
DR   EnsemblGenomes-Tr; STM0323-1.
DR   EnsemblGenomes-Tr; STM0467-1.
DR   EnsemblGenomes-Tr; STM0553-1.
DR   EnsemblGenomes-Tr; STM0673-1.
DR   EnsemblGenomes-Tr; STM0674-1.
DR   EnsemblGenomes-Tr; STM0675-1.
DR   EnsemblGenomes-Tr; STM0676-1.
DR   EnsemblGenomes-Tr; STM0677-1.
DR   EnsemblGenomes-Tr; STM0678-1.
DR   EnsemblGenomes-Tr; STM0679-1.
DR   EnsemblGenomes-Tr; STM0751-1.
DR   EnsemblGenomes-Tr; STM0752-1.
DR   EnsemblGenomes-Tr; STM0753-1.
DR   EnsemblGenomes-Tr; STM0754-1.
DR   EnsemblGenomes-Tr; STM0755-1.
DR   EnsemblGenomes-Tr; STM0949-1.
DR   EnsemblGenomes-Tr; STM1086-1.
DR   EnsemblGenomes-Tr; STM1134-1.
DR   EnsemblGenomes-Tr; STM1247-1.
DR   EnsemblGenomes-Tr; STM1262-1.
DR   EnsemblGenomes-Tr; STM1363-1.
DR   EnsemblGenomes-Tr; STM1423-1.
DR   EnsemblGenomes-Tr; STM1424-1.
DR   EnsemblGenomes-Tr; STM1757-1.
DR   EnsemblGenomes-Tr; STM1758-1.
DR   EnsemblGenomes-Tr; STM1759-1.
DR   EnsemblGenomes-Tr; STM1942-1.
DR   EnsemblGenomes-Tr; STM1943-1.
DR   EnsemblGenomes-Tr; STM1944-1.
DR   EnsemblGenomes-Tr; STM1983-1.
DR   EnsemblGenomes-Tr; STM1985-1.
DR   EnsemblGenomes-Tr; STM2000-1.
DR   EnsemblGenomes-Tr; STM2002-1.
DR   EnsemblGenomes-Tr; STM2004-1.
DR   EnsemblGenomes-Tr; STM2012-1.
DR   EnsemblGenomes-Tr; STM2014-1.
DR   EnsemblGenomes-Tr; STM2229-1.
DR   EnsemblGenomes-Tr; STM2268-1.
DR   EnsemblGenomes-Tr; STM2394-1.
DR   EnsemblGenomes-Tr; STM2411-1.
DR   EnsemblGenomes-Tr; STM2412-1.
DR   EnsemblGenomes-Tr; STM2416-1.
DR   EnsemblGenomes-Tr; STM2417-1.
DR   EnsemblGenomes-Tr; STM2418-1.
DR   EnsemblGenomes-Tr; STM2419-1.
DR   EnsemblGenomes-Tr; STM2615-1.
DR   EnsemblGenomes-Tr; STM2656-1.
DR   EnsemblGenomes-Tr; STM2657-1.
DR   EnsemblGenomes-Tr; STM2658-1.
DR   EnsemblGenomes-Tr; STM2659-1.
DR   EnsemblGenomes-Tr; STM2693-1.
DR   EnsemblGenomes-Tr; STM2821-1.
DR   EnsemblGenomes-Tr; STM2822-1.
DR   EnsemblGenomes-Tr; STM2823-1.
DR   EnsemblGenomes-Tr; STM2824-1.
DR   EnsemblGenomes-Tr; STM2825-1.
DR   EnsemblGenomes-Tr; STM2966-1.
DR   EnsemblGenomes-Tr; STM2989-1.
DR   EnsemblGenomes-Tr; STM2990-1.
DR   EnsemblGenomes-Tr; STM3037-1.
DR   EnsemblGenomes-Tr; STM3116-1.
DR   EnsemblGenomes-Tr; STM3213-1.
DR   EnsemblGenomes-Tr; STM3246-1.
DR   EnsemblGenomes-Tr; STM3289-1.
DR   EnsemblGenomes-Tr; STM3292-1.
DR   EnsemblGenomes-Tr; STM3393-1.
DR   EnsemblGenomes-Tr; STM3394-1.
DR   EnsemblGenomes-Tr; STM3395-1.
DR   EnsemblGenomes-Tr; STM3396-1.
DR   EnsemblGenomes-Tr; STM3397-1.
DR   EnsemblGenomes-Tr; STM3398-1.
DR   EnsemblGenomes-Tr; STM3634-1.
DR   EnsemblGenomes-Tr; STM3751-1.
DR   EnsemblGenomes-Tr; STM3889-1.
DR   EnsemblGenomes-Tr; STM3890-1.
DR   EnsemblGenomes-Tr; STM3891-1.
DR   EnsemblGenomes-Tr; STM3893-1.
DR   EnsemblGenomes-Tr; STM3894-1.
DR   EnsemblGenomes-Tr; STM3895-1.
DR   EnsemblGenomes-Tr; STM3896-1.
DR   EnsemblGenomes-Tr; STM3931-1.
DR   EnsemblGenomes-Tr; STM3932-1.
DR   EnsemblGenomes-Tr; STM3933-1.
DR   EnsemblGenomes-Tr; STM3934-1.
DR   EnsemblGenomes-Tr; STM3988-1.
DR   EnsemblGenomes-Tr; STM3989-1.
DR   EnsemblGenomes-Tr; STM3990-1.
DR   EnsemblGenomes-Tr; STM3991-1.
DR   EnsemblGenomes-Tr; STM3992-1.
DR   EnsemblGenomes-Tr; STM4132-1.
DR   EnsemblGenomes-Tr; STM4133-1.
DR   EnsemblGenomes-Tr; STM4134-1.
DR   EnsemblGenomes-Tr; STM4135-1.
DR   EnsemblGenomes-Tr; STM4136-1.
DR   EnsemblGenomes-Tr; STM4142-1.
DR   EnsemblGenomes-Tr; STM4143-1.
DR   EnsemblGenomes-Tr; STM4144-1.
DR   EnsemblGenomes-Tr; STM4145-1.
DR   EnsemblGenomes-Tr; STM4177-1.
DR   EnsemblGenomes-Tr; STM4178-1.
DR   EnsemblGenomes-Tr; STM4179-1.
DR   EnsemblGenomes-Tr; STM4180-1.
DR   EnsemblGenomes-Tr; STM4321-1.
DR   EnsemblGenomes-Tr; STM4352-1.
DR   EnsemblGenomes-Tr; STM4353-1.
DR   EnsemblGenomes-Tr; STM4354-1.
DR   EnsemblGenomes-Tr; STM4487-1.
DR   EnsemblGenomes-Tr; STM4553-1.
DR   EnsemblGenomes-Tr; STM4554-1.
DR   EnsemblGenomes-Tr; STM4555-1.
DR   EuropePMC; PMC1183210; 15955239.
DR   EuropePMC; PMC130833; 12202585.
DR   EuropePMC; PMC135442; 12426340.
DR   EuropePMC; PMC135457; 12446641.
DR   EuropePMC; PMC1456234; 16204219.
DR   EuropePMC; PMC1489810; 16000727.
DR   EuropePMC; PMC153889; 12682132.
DR   EuropePMC; PMC168958; 12824359.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC2049048; 17975028.
DR   EuropePMC; PMC2168049; 17921269.
DR   EuropePMC; PMC2394748; 17547764.
DR   EuropePMC; PMC2519523; 18606739.
DR   EuropePMC; PMC2519529; 18586943.
DR   EuropePMC; PMC2576667; 18790860.
DR   EuropePMC; PMC2652037; 18660809.
DR   EuropePMC; PMC2658671; 19159446.
DR   EuropePMC; PMC2668754; 19390620.
DR   EuropePMC; PMC2699552; 19568419.
DR   EuropePMC; PMC2712085; 19649318.
DR   EuropePMC; PMC2715408; 19573249.
DR   EuropePMC; PMC2735749; 19682387.
DR   EuropePMC; PMC275418; 14592990.
DR   EuropePMC; PMC2766089; 18554865.
DR   EuropePMC; PMC2805327; 19897651.
DR   EuropePMC; PMC2849355; 20123999.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC3004891; 21138562.
DR   EuropePMC; PMC3008487; 20943866.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3060822; 21445262.
DR   EuropePMC; PMC3067318; 21278266.
DR   EuropePMC; PMC3072379; 21490962.
DR   EuropePMC; PMC3073000; 21494634.
DR   EuropePMC; PMC3075218; 21418628.
DR   EuropePMC; PMC310007; 14660401.
DR   EuropePMC; PMC3127695; 21571881.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3145788; 21829346.
DR   EuropePMC; PMC3150258; 21707966.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC3165313; 21709089.
DR   EuropePMC; PMC3220660; 21942987.
DR   EuropePMC; PMC3283321; 22152004.
DR   EuropePMC; PMC3295175; 22205813.
DR   EuropePMC; PMC3326293; 22140114.
DR   EuropePMC; PMC3350482; 22606300.
DR   EuropePMC; PMC3356390; 22623967.
DR   EuropePMC; PMC3370595; 22493086.
DR   EuropePMC; PMC3378968; 22360681.
DR   EuropePMC; PMC3407126; 22848711.
DR   EuropePMC; PMC3411829; 22880062.
DR   EuropePMC; PMC3416524; 22609924.
DR   EuropePMC; PMC3535392; 23233427.
DR   EuropePMC; PMC3558799; 22998607.
DR   EuropePMC; PMC3592032; 23325816.
DR   EuropePMC; PMC3716127; 23478955.
DR   EuropePMC; PMC3771896; 24069274.
DR   EuropePMC; PMC3845640; 24158624.
DR   EuropePMC; PMC387811; 15090505.
DR   EuropePMC; PMC3904217; 23041931.
DR   EuropePMC; PMC3913712; 24505344.
DR   EuropePMC; PMC3930666; 24586399.
DR   EuropePMC; PMC3994646; 24765574.
DR   EuropePMC; PMC4042001; 24885207.
DR   EuropePMC; PMC4122451; 25093666.
DR   EuropePMC; PMC4244539; 25505462.
DR   EuropePMC; PMC4336196; 25713745.
DR   EuropePMC; PMC4371985; 25737552.
DR   EuropePMC; PMC4393443; 25724958.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC4511000; 26203341.
DR   EuropePMC; PMC4526557; 26244504.
DR   EuropePMC; PMC4549013; 26303940.
DR   EuropePMC; PMC4653799; 26586897.
DR   EuropePMC; PMC4661946; 26613761.
DR   EuropePMC; PMC4797131; 26988691.
DR   EuropePMC; PMC4846824; 27199934.
DR   EuropePMC; PMC4861720; 27242707.
DR   EuropePMC; PMC4937416; 27389966.
DR   EuropePMC; PMC4994947; 27552230.
DR   EuropePMC; PMC5240271; 28105330.
DR   EuropePMC; PMC5320704; 28348832.
DR   EuropePMC; PMC5359950; 28320310.
DR   EuropePMC; PMC540180; 15634952.
DR   EuropePMC; PMC5647791.
DR   EuropePMC; PMC5663059; 29084588.
DR   EuropePMC; PMC5690331; 29146854.
DR   EuropePMC; PMC5727591; 29233257.
DR   EuropePMC; PMC5732189; 29321769.
DR   EuropePMC; PMC5744181; 29312269.
DR   EuropePMC; PMC5826628; 29444431.
DR   EuropePMC; PMC5883454; 29616614.
DR   EuropePMC; PMC5913373; 29719530.
DR   EuropePMC; PMC5930307; 29717015.
DR   EuropePMC; PMC5934421; 29755416.
DR   EuropePMC; PMC5952572; 29759067.
DR   EuropePMC; PMC5954217; 29764951.
DR   EuropePMC; PMC6125333; 30214435.
DR   EuropePMC; PMC6328658; 30643885.
DR   EuropePMC; PMC6361445; 30716090.
DR   GOA; P60997.
DR   InterPro; IPR012565; His_leader.
DR   InterPro; IPR019717; Dextransucrase_DSRB.
DR   InterPro; IPR020887; UPF0509.
DR   InterPro; IPR031434; MGTL.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00170; msr.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01384; InvR.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01386; isrB.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01388; isrD.
DR   RFAM; RF01389; isrF.
DR   RFAM; RF01390; isrG.
DR   RFAM; RF01391; isrH.
DR   RFAM; RF01392; isrI.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01398; isrP.
DR   RFAM; RF01399; isrQ.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01403; STnc290.
DR   RFAM; RF01404; STnc440.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01406; STnc500.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01795; FourU.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02048; STnc30.
DR   RFAM; RF02049; STnc460.
DR   RFAM; RF02050; STnc470.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02054; STnc420.
DR   RFAM; RF02055; STnc380.
DR   RFAM; RF02056; STnc390.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02058; STnc400.
DR   RFAM; RF02059; STnc50.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02062; STnc361.
DR   RFAM; RF02063; STnc350.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02065; STnc340.
DR   RFAM; RF02066; STnc320.
DR   RFAM; RF02067; STnc310.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02070; STnc300.
DR   RFAM; RF02071; STnc280.
DR   RFAM; RF02072; STnc590.
DR   RFAM; RF02073; STnc260.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02077; STnc220.
DR   RFAM; RF02078; STnc210.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02080; STnc170.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02088; STnc510.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; AE006468.
DR   SILVA-SSU; AE006468.
DR   StrainInfo; 118393; 1.
DR   UniProtKB/Swiss-Prot; P0C0T3; DSRB_SALTY.
DR   UniProtKB/Swiss-Prot; P0C5Y6; YCIZ_SALTY.
DR   UniProtKB/Swiss-Prot; P0CI68; LPMG_SALTY.
DR   UniProtKB/Swiss-Prot; P60997; LPHI_SALTY.
XX
CC   On Jan 13, 2016 this sequence version replaced AE006468.1.
CC   Supported by NIH grant 5U 01 AI43283
CC   Coding sequences below are predicted from manually evaluated
CC   computer analysis, using similarity information and the programs;
CC   GLIMMER; http://www.tigr.org/softlab/glimmer/glimmer.html and
CC   GeneMark; http://opal.biology.gatech.edu/GeneMark/
CC   EC numbers were kindly provided by Junko Yabuzaki and the Kyoto
CC   Encyclopedia of Genes and Genomes; http://www.genome.ad.jp/kegg/,
CC   and Pedro Romero and Peter Karp at EcoCyc;
CC   http://ecocyc.PangeaSystems.com/ecocyc/
CC   The analyses of ribosome binding sites and promoter binding sites
CC   were kindly provided by Heladia Salgado, Julio Collado-Vides and
CC   ReguonDB;
CC   http://kinich.cifn.unam.mx:8850/db/regulondb_intro.frameset
CC   This sequence was finished as follows unless otherwise noted: all
CC   regions were double stranded, sequenced with an alternate
CC   chemistries or covered by high quality data (i.e., phred quality >=
CC   30); an attempt was made to resolve all sequencing problems, such
CC   as compressions and repeats; all regions were covered by sequence
CC   from more than one m13 subclone.
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..962614,1004279..1098230,1143703..2728972,
FT                   2776826..2844430,2879238..4857450)
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium str. LT2"
FT                   /focus
FT                   /sub_species="enterica"
FT                   /strain="LT2"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Typhimurium"
FT                   /db_xref="taxon:99287"
FT                   /culture_collection="ATCC:700720"
FT                   /culture_collection="SGSC:1412"
FT                   /type_material="type strain of Salmonella enterica"
FT   source          962615..1004278
FT                   /organism="Salmonella phage Fels-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:128975"
FT   source          1098231..1143702
FT                   /organism="Phage Gifsy-2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:129862"
FT   source          2728973..2776825
FT                   /organism="Phage Gifsy-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:129861"
FT   source          2844431..2879237
FT                   /organism="Salmonella virus Fels2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:194701"
FT   gene            190..255
FT                   /gene="thrL"
FT                   /locus_tag="STM0001"
FT   CDS_pept        190..255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="STM0001"
FT                   /product="thr operon leader peptide"
FT                   /note="similar to E. coli thr operon leader peptide
FT                   (AAC73112.1); Blastp hit to AAC73112.1 (21 aa),
FT                   85-1073758644dentity in aa 1 - 21"
FT                   /db_xref="EnsemblGenomes-Gn:STM0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18965"
FT                   /db_xref="GOA:Q7CRA3"
FT                   /db_xref="InterPro:IPR011720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CRA3"
FT                   /protein_id="AAL18965.1"
FT                   /translation="MNRISTTTITTITITTGNGAG"
FT   gene            325..2799
FT                   /gene="thrA"
FT                   /locus_tag="STM0002"
FT   regulatory      325..330
FT                   /gene="thrA"
FT                   /locus_tag="STM0002"
FT                   /note="putative RBS for thrA; RegulonDB:STMS1H000398"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        337..2799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="STM0002"
FT                   /product="aspartokinase I"
FT                   /EC_number="1.1.1.3"
FT                   /EC_number="2.7.2.4"
FT                   /note="bifunctional; N-terminaus is aspartokinase I and C
FT                   terminus is homoserine dehydrogenase I; similar to E. coli
FT                   aspartokinase I, homoserine dehydrogenase I (AAC73113.1);
FT                   Blastp hit to AAC73113.1 (820 aa), 94% identity in aa 1 -
FT                   820"
FT                   /db_xref="EnsemblGenomes-Gn:STM0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18966"
FT                   /db_xref="GOA:Q8ZS19"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS19"
FT                   /protein_id="AAL18966.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTIGGQDALPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASSDDDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMS
FT                   RAGISVVLITQSSSEYSISFCVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LDNWQAELAQANAPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHQLRFAAAQSRRKFLYDTNVGAGLPVIENLQNLLNAGDELQKFSGI
FT                   LSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELSDIVIEPVLPNEFDASGDVTAFMAHLPQLDDAFAARVAKARDEGKVLRYVGNIEEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2789..3730
FT                   /gene="thrB"
FT                   /locus_tag="STM0003"
FT   regulatory      2789..2794
FT                   /gene="thrB"
FT                   /locus_tag="STM0003"
FT                   /note="putative RBS for thrB; RegulonDB:STMS1H000399"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2801..3730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="STM0003"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="similar to E. coli homoserine kinase (AAC73114.1);
FT                   Blastp hit to AAC73114.1 (310 aa), 93% identity in aa 1 -
FT                   308"
FT                   /db_xref="EnsemblGenomes-Gn:STM0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18967"
FT                   /db_xref="GOA:P65226"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65226"
FT                   /protein_id="AAL18967.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHFR
FT                   LHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLA
FT                   AALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETAQRVAD
FT                   WLSKHYLQNQEGFVHICRLDTAGARVVG"
FT   gene            3722..5020
FT                   /gene="thrC"
FT                   /locus_tag="STM0004"
FT   regulatory      3722..3727
FT                   /gene="thrB"
FT                   /locus_tag="STM0003"
FT                   /note="putative RBS for thrC; RegulonDB:STMS1H000400"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3734..5020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="STM0004"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="similar to E. coli threonine synthase (AAC73115.1);
FT                   Blastp hit to AAC73115.1 (428 aa), 93% identity in aa 1 -
FT                   428"
FT                   /db_xref="EnsemblGenomes-Gn:STM0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18968"
FT                   /db_xref="GOA:Q8ZS18"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS18"
FT                   /protein_id="AAL18968.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEIDE
FT                   MLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTM
FT                   RELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEA
FT                   LAERADLPLLSHHLPADFAALRKLMMTRQ"
FT   gene            complement(5114..5898)
FT                   /gene="yaaA"
FT                   /locus_tag="STM0005"
FT   CDS_pept        complement(5114..5887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="STM0005"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73117.1); Blastp hit to AAC73117.1 (258 aa), 86%
FT                   identity in aa 1 - 257"
FT                   /db_xref="EnsemblGenomes-Gn:STM0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18969"
FT                   /db_xref="GOA:Q8ZS17"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZS17"
FT                   /protein_id="AAL18969.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAPQ
FT                   ISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALEAQG
FT                   DRVVVNLASEEYFKSVKPKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ"
FT   regulatory      complement(5893..5898)
FT                   /gene="yaaA"
FT                   /locus_tag="STM0005"
FT                   /note="putative RBS for yaaA; RegulonDB:STMS1H000401"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(5966..7407)
FT                   /gene="yaaJ"
FT                   /locus_tag="STM0006"
FT   CDS_pept        complement(5966..7396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="STM0006"
FT                   /product="putative alanine/glycine transport protein"
FT                   /note="AGCS family; similar to E. coli inner membrane
FT                   transport protein (AAC73118.1); Blastp hit to AAC73118.1
FT                   (476 aa), 76% identity in aa 1 - 476"
FT                   /db_xref="EnsemblGenomes-Gn:STM0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18970"
FT                   /db_xref="GOA:Q8ZS16"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS16"
FT                   /protein_id="AAL18970.1"
FT                   /translation="MPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQFRYIRQFSR
FT                   SLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWMWVSAIIGMA
FT                   TSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAYGLIFNSVQA
FT                   NAVSRALHFAFNIPPLISGIALAFCALLIIIRGIKGVARLMQWLIPLIALLWVAGSVFI
FT                   CLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNEAGMGSTPNA
FT                   AAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTEGIQLLQHAM
FT                   VSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLRLATLGMVIA
FT                   GTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLASDYLRQRKLGVRPQFDPRRF
FT                   PDIEPQLAPDTWEAASRD"
FT   regulatory      complement(7402..7407)
FT                   /gene="yaaJ"
FT                   /locus_tag="STM0006"
FT                   /note="putative RBS for yaaJ; RegulonDB:STMS1H000402"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            7652..8618
FT                   /gene="talB"
FT                   /locus_tag="STM0007"
FT   regulatory      7652..7657
FT                   /gene="talB"
FT                   /locus_tag="STM0007"
FT                   /note="putative RBS for talB; RegulonDB:STMS1H000403"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        7665..8618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="STM0007"
FT                   /product="transaldolase B"
FT                   /EC_number="2.2.1.2"
FT                   /note="similar to E. coli transaldolase B (AAC73119.1);
FT                   Blastp hit to AAC73119.1 (317 aa), 94% identity in aa 1 -
FT                   317"
FT                   /db_xref="EnsemblGenomes-Gn:STM0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18971"
FT                   /db_xref="GOA:P66955"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66955"
FT                   /protein_id="AAL18971.1"
FT                   /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSSDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANTDKKDYAPAEDPGVVSVTEIYEYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVKARPERITEAEF
FT                   LWQHHQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
FT   gene            8718..9319
FT                   /gene="mog"
FT                   /locus_tag="STM0008"
FT   regulatory      8718..8723
FT                   /gene="mog"
FT                   /locus_tag="STM0008"
FT                   /note="putative RBS for mog; RegulonDB:STMS1H000404"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8729..9319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="STM0008"
FT                   /product="putative molybdochetalase"
FT                   /note="molybdopterine biosynthesis; similar to E. coli
FT                   required for the efficient incorporation of molybdate into
FT                   molybdoproteins (AAC73120.1); Blastp hit to AAC73120.1 (195
FT                   aa), 91% identity in aa 1 - 192"
FT                   /db_xref="EnsemblGenomes-Gn:STM0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18972"
FT                   /db_xref="GOA:Q8ZS15"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS15"
FT                   /protein_id="AAL18972.1"
FT                   /translation="MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQRR
FT                   LIPDEQEIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVP
FT                   YCIQLLDGPYVETAPEVVAAFRPKSARRENMSD"
FT   gene            complement(9376..9950)
FT                   /gene="yaaH"
FT                   /locus_tag="STM0009"
FT   CDS_pept        complement(9376..9942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="STM0009"
FT                   /product="putative regulatory protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73121.1); Blastp hit to AAC73121.1 (188 aa), 90%
FT                   identity in aa 1 - 188"
FT                   /db_xref="EnsemblGenomes-Gn:STM0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18973"
FT                   /db_xref="GOA:Q7CRA2"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CRA2"
FT                   /protein_id="AAL18973.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLG
FT                   LWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEATIHIAGWVGLVCGAS
FT                   AIYLAMGEVLNEQFGRTILPIGEAH"
FT   regulatory      complement(9945..9950)
FT                   /gene="yaaH"
FT                   /locus_tag="STM0009"
FT                   /note="putative RBS for yaaH; RegulonDB:STMS1H000405"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(10092..10811)
FT                   /gene="htgA"
FT                   /locus_tag="STM0010"
FT   CDS_pept        complement(10092..10805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htgA"
FT                   /locus_tag="STM0010"
FT                   /product="positive sigma H regulator"
FT                   /note="functions on sigma 32 promoters permitting growth at
FT                   high temperature; similar to E. coli putative
FT                   oxidoreductase (AAC73122.1); Blastp hit to AAC73122.1 (237
FT                   aa), 87% identity in aa 1 - 236"
FT                   /db_xref="EnsemblGenomes-Gn:STM0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18974"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CRA1"
FT                   /protein_id="AAL18974.1"
FT                   /translation="MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLSH
FT                   NELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKLKA
FT                   DKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRSLAK
FT                   GVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYRVTIPAV
FT                   LQIACLRRMMAAVQA"
FT   regulatory      complement(10806..10811)
FT                   /gene="htgA"
FT                   /locus_tag="STM0010"
FT                   /note="putative RBS for htgA; RegulonDB:STMS1H000406"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(10841..11255)
FT                   /gene="yaaI"
FT                   /locus_tag="STM0011"
FT   CDS_pept        complement(10841..11245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="STM0011"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73124.1); Blastp hit to AAC73124.1 (134 aa), 81%
FT                   identity in aa 1 - 134"
FT                   /db_xref="EnsemblGenomes-Gn:STM0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18975"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZS14"
FT                   /protein_id="AAL18975.1"
FT                   /translation="MRSVLTISVGLLFGLALSSVAHANDHKILGVIAMPRNETNDLTLK
FT                   IPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMARLKVIGDD"
FT   regulatory      complement(11250..11255)
FT                   /gene="yaaI"
FT                   /locus_tag="STM0011"
FT                   /note="putative RBS for yaaI; RegulonDB:STMS1H000407"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            11579..13509
FT                   /gene="dnaK"
FT                   /locus_tag="STM0012"
FT   regulatory      11579..11584
FT                   /gene="dnaK"
FT                   /locus_tag="STM0012"
FT                   /note="putative RBS for dnaK; RegulonDB:STMS1H000408"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11593..13509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="STM0012"
FT                   /product="chaperone Hsp70"
FT                   /note="DNAK protein; heat shock protein 70; HSP70; involved
FT                   in DNA biosynthesis and cell division; (SW:DNAK_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18976"
FT                   /db_xref="GOA:Q56073"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56073"
FT                   /protein_id="AAL18976.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   DAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALNALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            13577..14734
FT                   /gene="dnaJ"
FT                   /locus_tag="STM0013"
FT   regulatory      13577..13582
FT                   /gene="dnaJ"
FT                   /locus_tag="STM0013"
FT                   /note="putative RBS for dnaJ; RegulonDB:STMS1H000409"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13595..14734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="STM0013"
FT                   /product="heat shock protein DnaJ"
FT                   /note="chaperone protein DnaJ; GrpE; stimulates ATPase
FT                   activity of DnaK; (SW:DNAJ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18977"
FT                   /db_xref="GOA:P0A1G7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1G7"
FT                   /protein_id="AAL18977.1"
FT                   /translation="MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDI
FT                   FGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQT
FT                   CPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAG
FT                   VDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGG
FT                   EIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQ
FT                   KQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTR"
FT   gene            15007..15961
FT                   /locus_tag="STM0014"
FT   regulatory      15007..15012
FT                   /locus_tag="STM0014"
FT                   /note="putative RBS for STM0014; RegulonDB:STMS1H000410"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        15014..15961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0014"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="similar to E. coli putative transcriptional
FT                   regulator LYSR-type (AAC73704.1); Blastp hit to AAC73704.1
FT                   (300 aa), 25% identity in aa 8 - 296"
FT                   /db_xref="EnsemblGenomes-Gn:STM0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18978"
FT                   /db_xref="GOA:Q8ZS13"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS13"
FT                   /protein_id="AAL18978.1"
FT                   /translation="MGSKGANKSFDYNLIKILDAVILSGNAAMAAKKLGITPAAVSLAL
FT                   KRLQSYYPEELFSRGKGGLIPTAKAVDIHQNFSQVMKLVDDTFLCNSKKDEAFQITLLG
FT                   SDIVESYYLSQLYNSDIFDRILINHFSVRNMSREHISELLFTAQGDLLISAEPLLESGI
FT                   ENQIIDSFKSFVCICSSKHMLSTLSQLSLHHFYSSRHALYQPGMGASVIYHDSELFKDD
FT                   LYYTGRRIVGYRSDSLNGLMSMIERTSLIALIPLKLALFYKNHRKYDIKFIQPPPELAL
FT                   KSVQVYASWNKNSRNISTINEMVSMLQTLSSFRR"
FT   gene            16083..16432
FT                   /locus_tag="STM0015"
FT   regulatory      16083..16088
FT                   /locus_tag="STM0015"
FT                   /note="putative RBS for STM0015; RegulonDB:STMS1H000411"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16088..16432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0015"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18979"
FT                   /db_xref="GOA:Q8ZS12"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS12"
FT                   /protein_id="AAL18979.1"
FT                   /translation="MSIPNHVSTTEVVLLELEILLTIISIGAWGGFVSYLLRKDKTEYN
FT                   SSHESIKYCLTQIVISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRI
FT                   KKIIEGNNSD"
FT   gene            complement(16493..17033)
FT                   /locus_tag="STM0016"
FT   CDS_pept        complement(16493..17026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18980"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS11"
FT                   /protein_id="AAL18980.1"
FT                   /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMR
FT                   DLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFN
FT                   HEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHN
FT                   NEQFIYGWIKNRVT"
FT   regulatory      complement(17028..17033)
FT                   /locus_tag="STM0016"
FT                   /note="putative RBS for STM0016; RegulonDB:STMS1H000412"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(17043..17493)
FT                   /locus_tag="STM0017"
FT   CDS_pept        complement(17043..17486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0017"
FT                   /product="putative protein"
FT                   /note="similar to E. coli putative sensory transducer
FT                   (AAC75886.1); Blastp hit to AAC75886.1 (269 aa), 30%
FT                   identity in aa 3 - 109"
FT                   /db_xref="EnsemblGenomes-Gn:STM0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18981"
FT                   /db_xref="GOA:Q8ZS10"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS10"
FT                   /protein_id="AAL18981.1"
FT                   /translation="MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIENA
FT                   HLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNS
FT                   DITIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH"
FT   regulatory      complement(17488..17493)
FT                   /locus_tag="STM0017"
FT                   /note="putative RBS for STM0017; RegulonDB:STMS1H000413"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            17860..19966
FT                   /locus_tag="STM0018"
FT   regulatory      17860..17865
FT                   /locus_tag="STM0018"
FT                   /note="putative RBS for STM0018; RegulonDB:STMS1H000414"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17867..19966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0018"
FT                   /product="putative exochitinase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18982"
FT                   /db_xref="GOA:Q8ZS09"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS09"
FT                   /protein_id="AAL18982.1"
FT                   /translation="MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNK
FT                   YKNSTTKPKVFGYYTDWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITGFR
FT                   KIDTEDRDVVAEAAALCGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQSNAK
FT                   GLLGALRDMQAKAKAAGHTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQF
FT                   PMFSEVDIDWEYPNNEGAGNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVT
FT                   TIFDYAKVKDLMAAGLYGINLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLL
FT                   AEGFSADRINIGYAGYTRNARQVEIESLSPLKGSYNPGSGPTTGSFESGTSEWYDVIYS
FT                   YLDLENQKGRNGFNVYTDQVADADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVF
FT                   TWTIDQDNGVLVNAVREGLGYEIESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAP
FT                   KAAIELMVVGGSTVQLSGAGSSDEDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVSEK
FT                   TAFQFTLFVRDCYNEPSSQQRFVLTAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPAED
FT                   DTPADDKTSPYAQWDASTVYGANWGSFEIVSWKGHNYQVKWWSMGNQPDLNCGVGGAWT
FT                   DLGAY"
FT   gene            20051..23054
FT                   /locus_tag="STM0019"
FT   regulatory      20051..20056
FT                   /locus_tag="STM0019"
FT                   /note="putative RBS for STM0019; RegulonDB:STMS1H000415"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20058..23054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0019"
FT                   /product="putative hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18983"
FT                   /db_xref="GOA:Q8ZS08"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS08"
FT                   /protein_id="AAL18983.1"
FT                   /translation="MTISIHASAFDVNSWYQKITLTFINESGNAVDMNHAAISFTASGH
FT                   IDPWGNSGGTLKGNLPLTLNESSYGTLETNNIIINNSDALLLQPGERGTLSFSLAATQV
FT                   PVKMSAITLTLASSSSEDAESATPSDQETPAIPAADEQPAEPDVPEKDNDLQEHGLTLN
FT                   VSELNTASWYQRVTFTLTNLYAQAVDLNQLQLNFTASAHPDPYSPFQGTMLGNQAVTLA
FT                   SDGGWPIEKNTITINHDGALILAAGDTAELQCYLAATQTPVAISDLNATLAHDPARQGK
FT                   VCVHFPAMTQTVALKPVIELLFPAGETRRFVGEWGEVLTIGDLSAGTYRLTVPVLANDE
FT                   MQIAPVESSFTVTLQSGDAAAQVQVSCLPIVRYASARLMIDAPALGNAKLTVEIADATQ
FT                   ADERTVTLIANQPQLITRLLAGHHYTVNLQPAMINNRFISAPIQLTGFIPAAAQIAEVA
FT                   VAYQQSALDTASFVTVDATILGLPDGVAPQRYLFSSGKYQYSLMLESGSDRQTLALRFA
FT                   PGLYDVQTDDIFIDSVPWRCEQAGPLRLLQKVNHVALEFLPGVTLQVKGWPDYLAHGGV
FT                   TVNAPETVSLYRDIPFSALFKYDGFDGGGDPVPAAEVDVNGDGFLDYATLPIHKTVALV
FT                   RQIEKEAGRSVMPVMVIYTANASGGSALADLQDAQKLRNHFGNFITQCLAAQSYKDETH
FT                   PVPATFVLNPDFLGALQQGPYGYTVVRQKNSVPVNAQLAAAIQALPAMAGFIAPSLPTF
FT                   SDDLYGYIQAVNYLVRQFAPDVAFGWQTNVWATGTADWVLRDTADPVAEGQAIAGFIHE
FT                   LGVYSGEYAPDFIAFDKFECDCFSPDALAHYGWNATCWLNYLAMVKQVTKALLTPAMLW
FT                   QIPGGHMPTVEEGVSKISAAHFASGGTFFMGDARIGSDPDTLSLQLLNTALNSATYGVP
FT                   TVGDFLRKDKGYDWGQMQALNLPDFNVFSILWGGGSTISITTIHSNGEDGGWLADKMVE
FT                   YYAAPRYFR"
FT   gene            23335..24039
FT                   /locus_tag="STM0020"
FT   CDS_pept        23335..24039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0020"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73478.1); Blastp hit to AAC73478.1 (222 aa), 32%
FT                   identity in aa 21 - 222"
FT                   /db_xref="EnsemblGenomes-Gn:STM0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18984"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS07"
FT                   /protein_id="AAL18984.1"
FT                   /translation="MKKMMNDAFAKDNNENSLHSFLFSQQAKPHAAIDALFSALLPFGQ
FT                   PFTLGIGDEFYLQANDEHYIVLLESGVVSFCHDDKRLHISSSFAPSVVGMVDSYGATYN
FT                   VPARPEHFLLAETVCTGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDRELVGV
FT                   DSYLKVRALLTEIWAYPQAYRESIIVLNFIQRRTGISRSRTMKILSELKKGGYIHIDNG
FT                   RLTALGKLPVAY"
FT   gene            24462..25011
FT                   /gene="bcfA"
FT                   /locus_tag="STM0021"
FT   regulatory      24462..24467
FT                   /gene="bcfA"
FT                   /locus_tag="STM0021"
FT                   /note="putative RBS for bcfA; RegulonDB:STMS1H000416"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24469..25011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfA"
FT                   /locus_tag="STM0021"
FT                   /product="fimbrial subunit"
FT                   /note="fimbrial subunit (gi|4959511)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18985"
FT                   /db_xref="GOA:H9L412"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L412"
FT                   /protein_id="AAL18985.1"
FT                   /translation="MKKPVLALMVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAAC
FT                   SVSADSVDQTVTLGQVRASKLTEAGMVANQKEDFTIKLEDCDTQTSQNAAVIFNGQQDA
FT                   NQPGSLANTAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIATGT
FT                   ATAGNVTATATFSMVYS"
FT   gene            25105..25798
FT                   /gene="bcfB"
FT                   /locus_tag="STM0022"
FT   regulatory      25105..25110
FT                   /gene="bcfB"
FT                   /locus_tag="STM0022"
FT                   /note="putative RBS for bcfB; RegulonDB:STMS1H000417"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        25112..25798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfB"
FT                   /locus_tag="STM0022"
FT                   /product="fimbrial chaparone"
FT                   /note="fimbrial chaperone (gi|4959512)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18986"
FT                   /db_xref="GOA:H9L483"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:H9L483"
FT                   /protein_id="AAL18986.1"
FT                   /translation="MKKNVPIFLRLLLLLSAAGLSFAAQAGGIALGATRVIYPQGSKQT
FT                   SLPIINSSASNVFLIQSWVANADGSRSTDFIITPPLFVIQPKKENILRIMYVGPSLPTD
FT                   RESVFYLNSKAIPSVDKNKLTGNSLQIATQSVIKLFIRPKNLAEAPAHAPSTLRCRNER
FT                   GQLTITNPSPYYVSMVELYSAGKKLPNTMVPPKGAITLPATPGQVSLRTVNDFGATTPA
FT                   RVCPAS"
FT   gene            25803..28424
FT                   /gene="bcfC"
FT                   /locus_tag="STM0023"
FT   CDS_pept        25803..28424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfC"
FT                   /locus_tag="STM0023"
FT                   /product="fimbrial usher"
FT                   /note="bovine colonization factor BcfC (gi|4530570)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18987"
FT                   /db_xref="GOA:Q8ZS06"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS06"
FT                   /protein_id="AAL18987.1"
FT                   /translation="MRNQLFMTRYYSSVTKPVLTPLALAIALAPAPGWAENYFNPAFLS
FT                   DDPSAVADLSTFSRNAQAAGMYRVDVYLNNTFLATRDIAFQAVKTTGKSAPTDDSGLRA
FT                   CLTPEMLKNMGVNTGAFPLLAKAAAGSCPDLASAIPAARTRFDFAQQRLDISIPQAAMV
FT                   ASARGYIPPKYWDEGINALLLNYTFTGANSQDRSPGGSAENSYFLGLNSGLNLGAWRLR
FT                   DYSTWNANSGDQNSDSDWQHISTYLERDVVFLQGELTAGDSYTPSALFDSLPFRGLQLA
FT                   SDDNMLPDSMKGFAPTIHGIARSNAQVTIRQNGYIINQRYVPPGAFTINDLYPTAASGD
FT                   LTVEVKESDGSINRYNVPYSAVPILQREGRLKYAATVAEYRSDSSQKEKVKFSQATLIW
FT                   GLPHGFTLYGGTQLSSHYHALAIGSGANLGDWGAVSLDVTQATSTLADNNTYQGQSLRF
FT                   LYAKSLAQSGTNLQLMGYRYSTSGFYTLDDTTWKRMSGYDDDSRTDSDKSRPEWADYYN
FT                   LYYTRRGKVQLDINQQLGGLGSLFITGSQQSYWHTDEKDSLLQVGYSDTLAGIAWSVSY
FT                   NNNKSAGDAERDQIFALNISVPLSQWLQHGDEVTRHHNVYATFSTSTDKQHNVTQNAGL
FT                   SGTLLDENNLSYNIQQGYQNHGIGESGAASLEYDGAKGNANIGYNVSDNGDYQQVNYGL
FT                   SGGLVAHAHGVTLSQPLGNTNILIAAPGAANVGVVDQPGIHTDARGYAVVPYATTYRQN
FT                   RMALDVNAMADDVDIDDAVTRVVPTEGALVLARFKARVGARALVTLNHNGKPVPFGATV
FT                   TVNDRHAEAIVDEAGEVYLSGLSAQGVLHVRWGNLPDQQCVASYHLSSSRQILSRQHAE
FT                   CH"
FT   gene            28410..29432
FT                   /gene="bcfD"
FT                   /locus_tag="STM0024"
FT   regulatory      28410..28415
FT                   /gene="bcfD"
FT                   /locus_tag="STM0024"
FT                   /note="putative RBS for bcfD; RegulonDB:STMS1H000418"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28425..29432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfD"
FT                   /locus_tag="STM0024"
FT                   /product="fimbrial subunit"
FT                   /note="fimbrial subunit (gi|4959514)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18988"
FT                   /db_xref="GOA:Q8ZS05"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS05"
FT                   /protein_id="AAL18988.1"
FT                   /translation="MKIPLLFALLAGSVVSQYAFADVCKNVNGVPSSINYDLTTTLTAE
FT                   QNQVGKTVQLEKSQEVNVQAVCPAGASTYSQTYRSYVSPYPVVETSGNWKYLKLDPDYL
FT                   EGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTVNIS
FT                   PKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGNFNHA
FT                   GQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHVPQAIASDNADVGVVVETDEG
FT                   NALIPNDVQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDFD"
FT   gene            29418..29978
FT                   /gene="bcfE"
FT                   /locus_tag="STM0025"
FT   regulatory      29418..29423
FT                   /gene="bcfE"
FT                   /locus_tag="STM0025"
FT                   /note="putative RBS for bcfE; RegulonDB:STMS1H000419"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        29433..29978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfE"
FT                   /locus_tag="STM0025"
FT                   /product="fimbrial subunit"
FT                   /note="fimbrial subunit (gi|4959515)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18989"
FT                   /db_xref="GOA:H9L408"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L408"
FT                   /protein_id="AAL18989.1"
FT                   /translation="MNRSHCALFAMGLMLCPQINASADDLAYNLEFTGTIVAQTCDIDI
FT                   SSLSQSIDLGQFAVGDFPSTGTTTKFKPFNINLKNCSRGITGAKIWFTGEPDPDNPALL
FT                   AITDTGMGSGNMLASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRP
FT                   TVTSGNATAVMYFDMQYE"
FT   gene            29977..30512
FT                   /gene="bcfF"
FT                   /locus_tag="STM0026"
FT   regulatory      29977..29982
FT                   /gene="bcfF"
FT                   /locus_tag="STM0026"
FT                   /note="putative RBS for bcfF; RegulonDB:STMS1H000420"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        29994..30512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfF"
FT                   /locus_tag="STM0026"
FT                   /product="fimbrial subunit"
FT                   /note="fimbrial subunit (gi|4959516)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18990"
FT                   /db_xref="GOA:H9L4A8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L4A8"
FT                   /protein_id="AAL18990.1"
FT                   /translation="MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENI
FT                   NVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALTAG
FT                   ESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGDANA
FT                   SATFILAYE"
FT   gene            30466..31209
FT                   /gene="bcfG"
FT                   /locus_tag="STM0027"
FT   regulatory      30466..30471
FT                   /gene="bcfF"
FT                   /locus_tag="STM0026"
FT                   /note="putative RBS for bcfG; RegulonDB:STMS1H000421"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        30478..31209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfG"
FT                   /locus_tag="STM0027"
FT                   /product="fimbrial chaparone"
FT                   /note="fimbrial chaperone (gi|4959517)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18991"
FT                   /db_xref="GOA:Q8ZS04"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS04"
FT                   /protein_id="AAL18991.1"
FT                   /translation="MPPQPSFLPMNKFFLRCAIYWCLLPISWAQAGVVIGGTRFIYHAG
FT                   APALSVPVSNRSEASWLIDTHILPGGRWPGTKNEGNIMPFVVTPPLFMLSARQENSMRV
FT                   VYTGAPLPADRESLFTLSIAAIPSGKPEANRVQMAFRSALKLLYRPDGLAGNPQQAYRH
FT                   LIWSLTPDGATVRNPTPYYVTLFLLRANERAQDNAGVVAPFATRQTDWCRHTVRCTVRW
FT                   QSINDYGRVMPAQTVDLTRIH"
FT   gene            31270..32119
FT                   /gene="bcfH"
FT                   /locus_tag="STM0028"
FT   regulatory      31270..31275
FT                   /gene="bcfH"
FT                   /locus_tag="STM0028"
FT                   /note="putative RBS for bcfH; RegulonDB:STMS1H000422"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31274..32119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfH"
FT                   /locus_tag="STM0028"
FT                   /product="putative thiol-disulfide isomerase"
FT                   /note="unknown (gi|6650097)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18992"
FT                   /db_xref="GOA:Q8ZS03"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS03"
FT                   /protein_id="AAL18992.1"
FT                   /translation="MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIV
FT                   SHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIAQQQAYVQLALQYRAELLSSSSPSV
FT                   GPNEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGLAAR
FT                   VGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSG
FT                   AVHDALLTNQALAQHMDFSGTPAFVVMPQTQDGDVKRVTVIPGSTTQDMLQMAIQKAKG
FT                   "
FT   gene            complement(32545..33000)
FT                   /locus_tag="STM0029"
FT   CDS_pept        complement(32545..32994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0029"
FT                   /product="putative transcription regulator"
FT                   /note="putative transcriptional regulator MarT
FT                   (gi|4324612)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18993"
FT                   /db_xref="GOA:Q8ZS02"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS02"
FT                   /protein_id="AAL18993.1"
FT                   /translation="MRQYTINNEFIYNESLREIISLHDKKVLKVTLMRARCLSYLFENA
FT                   YKKLITREMISHAVWGERSQFVSDANLTQLLYLLRRDLQQIGLFELFVTLPRQGIKIDE
FT                   RFIIDAADIPPQAIQYHTHRCNKIISIGIPTLFLLFVLFFLAPFI"
FT   regulatory      complement(32995..33000)
FT                   /locus_tag="STM0029"
FT                   /note="putative RBS for STM0029; RegulonDB:STMS1H000423"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            33357..34368
FT                   /locus_tag="STM0030"
FT   regulatory      33357..33362
FT                   /locus_tag="STM0030"
FT                   /note="putative RBS for STM0030; RegulonDB:STMS1H000424"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        33364..34368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0030"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="leuO homolog (gi|6650098)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18994"
FT                   /db_xref="GOA:Q8ZS01"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS01"
FT                   /protein_id="AAL18994.1"
FT                   /translation="MRPIKNAKKIDYNLIKVFDTVITEGNATRAARKLDVTPAAISQAL
FT                   LRLQNLYGEELFIRTRKGLVPSSKGKSLHQVFRQAIESIESTLCDKTDAQESNELIVLG
FT                   GDITENYYFPALLDTVLMNRYIIKHYAIKKTGEYSPASMLTHGYADVIMGILEIKNEMI
FT                   ESYLIDNLSDFVCVCGEKSPLVGLEKMSLYNFYAARHAVYHSDMFSSFTADSIDLFKSS
FT                   TPYAGRREIGYYSDSLFGVIDIVEKSDMVAILPGKIATYFRDVRRYNIKILRMPDEMIF
FT                   RTLPVYAYLATNSTHYKNVKKLISTFQSTFLFSQEKQPDALVEGSTSLCDLSV"
FT   gene            complement(34376..34816)
FT                   /locus_tag="STM0031"
FT   CDS_pept        complement(34376..34816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0031"
FT                   /product="putative transcription regulator"
FT                   /note="putative transcriptional regulator MarT
FT                   (gi|4324612)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18995"
FT                   /db_xref="GOA:Q8ZS00"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS00"
FT                   /protein_id="AAL18995.1"
FT                   /translation="MTIYLINSTHTYNDKTNELKKIKTGKMIKIAAMRIKCLEYMLNHA
FT                   QQEIIYKKQLTNELWGERSQFISDANLTQILYLLRRDLKGFGLSQFFSTVPRTGIKVDA
FT                   NIIISNENKSCLPSSLKKEEYKYMALFFALLTMVIMVIYLIR"
FT   gene            35331..37057
FT                   /locus_tag="STM0032"
FT   regulatory      35331..35336
FT                   /locus_tag="STM0032"
FT                   /note="putative RBS for STM0032; RegulonDB:STMS1H000425"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        35339..37057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0032"
FT                   /product="putative arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18996"
FT                   /db_xref="GOA:Q8ZRZ9"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ9"
FT                   /protein_id="AAL18996.1"
FT                   /translation="MNKKSSSMVNMPAPREPINQKIDTNNALVLNHNAIYEQRLAEITQ
FT                   SNTCDKAIVTVNPYGTAPLSLYLGVWMDEAAALEINVVDSEATTEEVRYQYDVHPGANL
FT                   IPVCGMVSAVNNQITLRLASQIVGQYTVMTDALPPTDSANVSLGFPIISVSCPAQQASL
FT                   MEEGLYFSTYFDRYNLAFDHNGIVRWYVSQEIPSYNFVRMDNGHFLATSQGINHCLNMY
FT                   EFDIMGRVYTVYLLDNEFHHSILPIENNLAIAPSEYSNGRPDGYSTGKDGVSIINLSTG
FT                   LEVAYYDMLYVMDYSRSPRPSGSAPGQDVSMDDWLHINQSYINEPNNLLICSGRHQSAI
FT                   FGVNVDSGELRFIMANHEDWSDEFKQYLLTPVDDDGVPLYDLTSPGGIDAADKNFWTWG
FT                   QHNIVEIPNDEPGILEFMVFDNGNYRSREDAKSLLPLDNFSRVVQFKINLNTMTVTRPY
FT                   EYGKTEVGNRGYSSFVSAKHLLTNGHLVIHFGATTVDEFEHTITAQPGSSDLVDPDEGQ
FT                   QALGRLVLQEINKETKEVLFEAMVTSGYFKNEETNGTNYRYDISAFRVYKMPLFA"
FT   gene            complement(37103..38674)
FT                   /locus_tag="STM0033"
FT   CDS_pept        complement(37103..38674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0033"
FT                   /product="putative 5'-nucleotidase"
FT                   /note="similar to E. coli UDP-sugar hydrolase
FT                   (5'-nucleotidase) (AAC73582.1); Blastp hit to AAC73582.1
FT                   (550 aa), 26% identity in aa 1 - 253, 32% identity in aa
FT                   386 - 506"
FT                   /db_xref="EnsemblGenomes-Gn:STM0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18997"
FT                   /db_xref="GOA:Q7CR96"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR96"
FT                   /protein_id="AAL18997.1"
FT                   /translation="MVYMNKKFSISLLSLCIGLSSAISFSADARDITIYYTNDLHAHVT
FT                   PEIIPYVSKTRPVGGFAPISKIVKDAKAKEKDVFFFDAGDYFTGPFISTLTKGEAIIDI
FT                   LNTMPYDAVSVGNHEFDHGHENLVKQLSKLQFPVLLDNVFYSGTDTPLIKEPYTIVEKD
FT                   GFKIGVIGMHGVSAFYEAIAAGVREGVDCRDPIPYVKKQLEELKGKVDLTVLLAHEGVP
FT                   GMQSSAGEADVARALKTDVDMAKSLEGYGLNVLITGHAHKGTPEPIKVGDTLVVSTDAY
FT                   TIELGKLVLDWNPETKKVDSYNGKLITMYADTYKPDPVTQAKIDEWDNKVKKITDEVVA
FT                   HSPEVLTRSYGESAPTGNLITDALMATVPGADASFYNAGGIRTELPKGNITYGDVLSMY
FT                   PFTNDVMSMEISGKDLKSIMSHAADLKNGMLHVSKTVQFKYDSTKPLGQRIVEFDIKGK
FT                   PVEDNKLYTVALDSFIGKGGGGFTFTKGKNIKYIGIQTAPALVNYMKQVNNIQPDHTMR
FT                   VDDISK"
FT   gene            complement(38773..39540)
FT                   /locus_tag="STM0034"
FT   CDS_pept        complement(38773..39534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0034"
FT                   /product="putative outer membrane or exported protein"
FT                   /note="similar to E. coli putative sugar hydrolase
FT                   (AAC75461.1); Blastp hit to AAC75461.1 (254 aa), 34%
FT                   identity in aa 2 - 254"
FT                   /db_xref="EnsemblGenomes-Gn:STM0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18998"
FT                   /db_xref="GOA:Q8ZRZ8"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ8"
FT                   /protein_id="AAL18998.1"
FT                   /translation="MKNKKYINSLLAACVLFSCFNGQAAELKRVYGKLSFGYGDWNKGF
FT                   VNVDRGEVWKAVADFGAVFDRGEFASFYEMNVLNHPVEGRNHVTQFLGHYRVVEGSNFT
FT                   AMMKLYMSMENKFGDELNMMYGVGYLGLTSPSGFIKPYFAVHNLSNDYTSKKYGQATGF
FT                   NGYVLGWVAAYNFDMFNEKFVISNWNEVEMDRNDAYAEQQGGTTGLNGAVTFTWKFMPR
FT                   WTASVSYRYFNNKLGYDGYGDRMNYLIGFEF"
FT   regulatory      complement(39535..39540)
FT                   /locus_tag="STM0034"
FT                   /note="putative RBS for STM0034; RegulonDB:STMS1H000426"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            40120..41624
FT                   /locus_tag="STM0035"
FT   regulatory      40120..40125
FT                   /locus_tag="STM0035"
FT                   /note="putative RBS for STM0035; RegulonDB:STMS1H000427"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        40131..41624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0035"
FT                   /product="putative arylsulfatase"
FT                   /note="similar to E. coli putative sulfatase (AAC76701.1);
FT                   Blastp hit to AAC76701.1 (497 aa), 26% identity in aa 2 -
FT                   420"
FT                   /db_xref="EnsemblGenomes-Gn:STM0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18999"
FT                   /db_xref="GOA:Q8ZRZ7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ7"
FT                   /protein_id="AAL18999.1"
FT                   /translation="MKRTVVASMIGLALCAGCVLSTAQAATAKRPNLVIILADDLGYGD
FT                   LATYGHRIVKTPNIDKLAQEGVKFTDYYAPAPLCSPSRAGLLTGRMPFRTGIRSWIPEG
FT                   KDVALGRNELTIANLLKQQGYDTAMMGKLHLNAGGDRTDQPQAKDMGFDYTLVNPAGFV
FT                   TDATLDNAKERPRYGVVHPTGWIRNGQHIGRADKMSGEFVSSEVVNWLDNKKDDNPFFL
FT                   YVAFTEVHSPLASPKKYLDMYSQYMTDYQKQHPDLFYGDWADKPWRGTGEYYANISYMD
FT                   EQVGKVLDKIKAMGEEDNTIVIFTSDNGPVTREARKVYELNLAGETDGLRGRKDNLWEG
FT                   GIRVPAIIKYGKHIPQGMVTDTPVYGLDWLPTLANMMDFKLPTDRTYDGQSLVPLLKDK
FT                   TLKRQKPLIFGIDMPFQDDPTDEWAIRDGDWKMIIDRQNKPKYLYNLKTDRFETLNQIG
FT                   KQPQIEKQLYGKFLKYKKDIDNDSLMKARGDKPTPVTWG"
FT   gene            41717..42913
FT                   /locus_tag="STM0036"
FT   regulatory      41717..41722
FT                   /locus_tag="STM0036"
FT                   /note="putative RBS for STM0036; RegulonDB:STMS1H000428"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41723..42913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0036"
FT                   /product="putative arylsulfatase regulatory protein"
FT                   /note="similar to E. coli putative arylsulfatase regulator
FT                   (AAC76803.1); Blastp hit to AAC76803.1 (411 aa), 46%
FT                   identity in aa 8 - 401"
FT                   /db_xref="EnsemblGenomes-Gn:STM0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19000"
FT                   /db_xref="GOA:Q8ZRZ6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ6"
FT                   /protein_id="AAL19000.1"
FT                   /translation="MMFGKSCQVMVKPTGSVCNLDCKYCFYLEKEKLYPDRKNHYKMSE
FT                   ETLELFIRQQIAAQDIDEVIFAWQGGEPTLMGIPFYRKAVEFQQRYCGGKTIVNTFQTN
FT                   GILINDDWATFFREHDFLVGVSIDGDAALHDEWRVTRSGKPTHEKVENAVRCLAQHDVE
FT                   FNTLTVVNRTNMHHPVQVYRYLKSIGSRYMQFIPLVERCGENGLAQPQDKHIAMTPWSV
FT                   DSLQFGQFLNAVFDIWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPTCGSAFAMEMN
FT                   GDVYNCDHFVYPQFKLGNIHQKTLRQMNQGEQNRQFGSDKQRSMAQECHRCQWKFACYG
FT                   GCPKHRFLPSASGATNHNYLCAGYQAFFSHTATAMSAMRTLYEKGISPAEIKSIFV"
FT   gene            42926..44185
FT                   /locus_tag="STM0037"
FT   regulatory      42926..42931
FT                   /locus_tag="STM0037"
FT                   /note="putative RBS for STM0037; RegulonDB:STMS1H000429"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        42932..44185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0037"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19001"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ5"
FT                   /protein_id="AAL19001.1"
FT                   /translation="MNMFSHINVDACKTPGCKNLGILGSPDYLPQGKNVLCRACGFLFP
FT                   IISARSLNLFRQAANQPWKGLVKSCPHCGGTSLKKYGFSTKGERRMYCRQCNKTFISYT
FT                   AIRSDARQENLATLIGEGASLVEIRAALAIDSTGFSRELQKLSRRANQAERDFVFPAFD
FT                   IAMSTRAFRVKFNGGDSSLYVLVTAEEESGKVVAISTNYSAQPVEADYQYHSDYEERLP
FT                   SGTLAHLVQRKEALTMRRNVLFDVDYGPAVLYKNDPGMLVKPVLPAYRHFELVQALTDE
FT                   RSLNVQHYLDHECFILGGCMMANFSYLRQGRCHISFVRERGVTPPKRDLPPRLFLSGGI
FT                   RNNVWRTFSTRDYAMAVCNLTGNKKVSLLRHATLNSATAFIRYVHNHPFLPHLNRMSPG
FT                   NVVAVLDYLKFEYNASRN"
FT   gene            44305..46027
FT                   /locus_tag="STM0038"
FT   regulatory      44305..44310
FT                   /locus_tag="STM0038"
FT                   /note="putative RBS for STM0038; RegulonDB:STMS1H000430"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44312..46027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0038"
FT                   /product="putative arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19002"
FT                   /db_xref="GOA:Q8ZRZ4"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ4"
FT                   /protein_id="AAL19002.1"
FT                   /translation="MNTLTTTSVVLPAPRPAINQGIDINNEMVLNHTAIYENCLAQVTQ
FT                   ENTVENALMLLDPYGTAPLSAYAGVWSLEPAEIIVTVQDAAKTAMPVEHLYTLTAGANL
FT                   LPVLGLVADTENRIVFSQADTPLAVYTLITQPLPPVDSAEVVLGFPIINVTQPATDANK
FT                   MAPGFYFITHFDRYNYALDQNGLVRWYVTQDYPSYNFVRIDNGHFLTTSEAKNTYLDMY
FT                   EFDMMGRLHTFYNLDNQFHHSIWPWDSNTIVAPSEYTSGRPDDLKTNEDGVSVVDLTTG
FT                   LETAYYDMAKVLDTTRVSRPSGTAPGEDPTVKDWLHINQSYVNETNQLLIASGRHQSAV
FT                   FGVDLQTQALRFILSTHEDWDDAYQPYLLTPVDSEGVALYDFSKQEDIDAADRDFWTWG
FT                   QHNVVEIANNTPGIVEFMVFDNGNYRSRDDSKSLLPPDNYSRIVHFVVNMNEMTVMRPF
FT                   EYGKELGARGYSSCVSAKAIQQNGNIVVHFADCTFDENGRAISCQPGESDIIDPQAGSE
FT                   AMGLLILQEIAPTEKTVLFEATMTSGYYKNAETNGEGYRYDITSFRVYKMDLYA"
FT   gene            46083..47356
FT                   /gene="nhaA"
FT                   /locus_tag="STM0039"
FT   regulatory      46083..46091
FT                   /gene="nhaA"
FT                   /locus_tag="STM0039"
FT                   /note="putative -35_signal for nhaA;
FT                   RegulonDB:STMLTH004626"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      46110..46118
FT                   /gene="nhaA"
FT                   /locus_tag="STM0039"
FT                   /note="putative -10_signal for nhaA;
FT                   RegulonDB:STMLTH004626"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      46179..46184
FT                   /gene="nhaA"
FT                   /locus_tag="STM0039"
FT                   /note="putative RBS for nhaA; RegulonDB:STMS1H000431"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46190..47356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="STM0039"
FT                   /product="NhaA family of transport protein, Na+/H
FT                   antiporter, pH dependent"
FT                   /note="similar to E. coli Na+/H antiporter, pH dependent
FT                   (AAC73130.1); Blastp hit to AAC73130.1 (388 aa), 92%
FT                   identity in aa 1 - 384"
FT                   /db_xref="EnsemblGenomes-Gn:STM0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19003"
FT                   /db_xref="GOA:Q8ZRZ3"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRZ3"
FT                   /protein_id="AAL19003.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANMGATSGWYHDFLETP
FT                   VQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYSDPVTREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIVIIALFYTSDLSIVSLGVAAFAIAVLALLNLCGVRRTGVYILVGAVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTI
FT                   DGLTSMLPLGIIAGLLIGKPLGISLFCWLALRFKLAHLPQGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGNVDPELINWAKLGILIGSLLSAVVGYSWLRARLNAPA"
FT   gene            47407..48317
FT                   /gene="nhaR"
FT                   /locus_tag="STM0040"
FT   regulatory      47407..47412
FT                   /gene="nhaR"
FT                   /locus_tag="STM0040"
FT                   /note="putative RBS for nhaR; RegulonDB:STMS1H000432"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        47418..48317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="STM0040"
FT                   /product="transcriptional activator of nhaA"
FT                   /note="LysR family; similar to E. coli transcriptional
FT                   activator of nhaA (AAC73131.1); Blastp hit to AAC73131.1
FT                   (301 aa), 92% identity in aa 1 - 296"
FT                   /db_xref="EnsemblGenomes-Gn:STM0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19004"
FT                   /db_xref="GOA:Q7CR95"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR95"
FT                   /protein_id="AAL19004.1"
FT                   /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADA
FT                   LSKRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLF
FT                   SVKIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQVEILG
FT                   EFDDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAERMIQH
FT                   PAVQRICNADYSALFKLQ"
FT   gene            complement(48372..50417)
FT                   /locus_tag="STM0041"
FT   CDS_pept        complement(48372..50411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0041"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC76680.1); Blastp hit to AAC76680.1 (772 aa), 25%
FT                   identity in aa 116 - 547, 27% identity in aa 549 - 665, 25%
FT                   identity in aa 84 - 149"
FT                   /db_xref="EnsemblGenomes-Gn:STM0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19005"
FT                   /db_xref="GOA:Q8ZRZ2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ2"
FT                   /protein_id="AAL19005.1"
FT                   /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNED
FT                   WALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRGEI
FT                   GEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDLKGC
FT                   VLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWITAGD
FT                   TPAEISRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPISVIVID
FT                   FFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMRENGWLV
FT                   QTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYYDKGVKLFWLDEAEPEFSVYD
FT                   YDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQKYGALVWSG
FT                   DIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIRWFQWGVFSP
FT                   VMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCEVLTGCLALREKLKPYIK
FT                   ALMEETHKHNTPVMRPLFFEFPEQETSWTITDQYCFGPDLLIAPVMHEGMRERDVWLPE
FT                   GETWTDLATGESYSGGQTLQYATPLNRIPVFIREGGQYRSLLNL"
FT   regulatory      complement(50412..50417)
FT                   /locus_tag="STM0041"
FT                   /note="putative RBS for STM0041; RegulonDB:STMS1H000433"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(50451..51829)
FT                   /locus_tag="STM0042"
FT   CDS_pept        complement(50451..51824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0042"
FT                   /product="putative sodium galactoside symporter"
FT                   /note="similar to E. coli putative permease (AAC76681.1);
FT                   Blastp hit to AAC76681.1 (479 aa), 29% identity in aa 22 -
FT                   457"
FT                   /db_xref="EnsemblGenomes-Gn:STM0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19006"
FT                   /db_xref="GOA:Q8ZRZ1"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ1"
FT                   /protein_id="AAL19006.1"
FT                   /translation="MSSVIEDTQPSGSASLSLLQRISYGSLDVAGNLLYCFSSTYILYF
FT                   YTDVAGISLAVAGVILLLARIIDGIDAPIWGIIIDKTRSRYGKCRPWFLWLPLPFAVFS
FT                   ALSFWSPDISMTGKAIYAAISYMIASILFTGLNTPLSAILPLMTLSPKERLVLNSWRMT
FT                   GGQIGVLLMNATALPLVAFLGNGDDHAGFIYTAITFAIISCALTLFAFKNIREMDTDKI
FT                   QHEPKLPMKKSFAAMKGNWPWILMVLANLIFWIALQQRNTTIVYYLTYNLDRKDLVPLI
FT                   NSLATIQILFIIAIPFFSKYLAKTWIWVGGLLVATFGGVMMWLAADNITFLIAAWILGN
FT                   IGSGIACSMPFAMLGFAVDFGAWKTGIKATGILIAFGSTFCIKMGSGLGTAFAAWIMNS
FT                   FGYVPNHAQSAAGLEGIIWAFIWAPALLFALAAIPLLFFRKYEAMEEKIRHDLETVNS"
FT   regulatory      complement(51824..51829)
FT                   /locus_tag="STM0042"
FT                   /note="putative RBS for STM0042; RegulonDB:STMS1H000434"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(52280..52550)
FT                   /gene="rpsT"
FT                   /locus_tag="STM0043"
FT   CDS_pept        complement(52280..52543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="STM0043"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /note="30S ribosomal protein S20. (SW:RS20_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19007"
FT                   /db_xref="GOA:P0A2B1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2B1"
FT                   /protein_id="AAL19007.1"
FT                   /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   regulatory      complement(52545..52550)
FT                   /gene="rpsT"
FT                   /locus_tag="STM0043"
FT                   /note="putative RBS for rpsT; RegulonDB:STMS1H000435"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            52649..52864
FT                   /gene="yaaY"
FT                   /locus_tag="STM0044"
FT   CDS_pept        52649..52864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="STM0044"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73135.1); Blastp hit to AAC73135.1 (72 aa), 71%
FT                   identity in aa 3 - 72"
FT                   /db_xref="EnsemblGenomes-Gn:STM0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19008"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR94"
FT                   /protein_id="AAL19008.1"
FT                   /translation="MQHSLRSDGAGFYQLACCEYSLSMRKIALSGGFWGGVCRMAMKSI
FT                   FFMFHQGNRRLTLTAVQGILLRFSLF"
FT   gene            52872..53810
FT                   /gene="ribF"
FT                   /locus_tag="STM0045"
FT   CDS_pept        52872..53810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="STM0045"
FT                   /product="flavokinase and FAD synthetase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="similar to E. coli putative regulator (AAC73136.1);
FT                   Blastp hit to AAC73136.1 (313 aa), 89% identity in aa 1 -
FT                   309"
FT                   /db_xref="EnsemblGenomes-Gn:STM0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19009"
FT                   /db_xref="GOA:Q7CR93"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR93"
FT                   /protein_id="AAL19009.1"
FT                   /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHRALLQGLQEEGRRR
FT                   GLPVVVMIFEPQPLELFATDKAPARLTRLREKLHYLAQCGVDYVLCVKFDRRFAALTAQ
FT                   TFISELLVERLGVQFLAVGDDFRFGASRAGDFLLLQKAGAEYGFAVSSTQTFCEGGVRI
FT                   SSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVSPVKG
FT                   VYAVEVTGLGDKPLPGVANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHIDVILRKKIRN
FT                   EQRFASLDELKAQIARDELTARKFFGLAGQV"
FT   gene            53838..56689
FT                   /gene="ileS"
FT                   /locus_tag="STM0046"
FT   regulatory      53838..53843
FT                   /gene="ileS"
FT                   /locus_tag="STM0046"
FT                   /note="putative RBS for ileS; RegulonDB:STMS1H000436"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        53855..56689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="STM0046"
FT                   /product="isoleucine tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="similar to E. coli isoleucine tRNA synthetase
FT                   (AAC73137.1); Blastp hit to AAC73137.1 (938 aa), 87%
FT                   identity in aa 1 - 938"
FT                   /db_xref="EnsemblGenomes-Gn:STM0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19010"
FT                   /db_xref="GOA:Q8ZRZ0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRZ0"
FT                   /protein_id="AAL19010.1"
FT                   /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSPYVPGWDCHGLPIEL
FT                   KVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEA
FT                   NIIRALGRIIKNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFRAVDQDAV
FT                   KAKFGLPGVSGPVSLVIWTTTPWTLPANRAISLAPDFDYALVQIDGQAVILAKDLVESV
FT                   MQRIGAAEYTILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVIGQKYGLETANPVGPDGTYLPGTYPTLDGVNVFKANDIVIELLKEKGALLHVEKM
FT                   QHSYPCCWRHKTPIIFRATPQWFVSMDKEGLRQQSLKEIKGVQWIPDWGQARIESMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKETQELLPIERTLAAMEEVAKRVEVDGIQAWWDLDPKE
FT                   ILGEDADQYEKVPDTLDVWFDSGSTSYSVVDARPEFAGHAADMYLEGSDQHRGWFMSSL
FT                   MISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTD
FT                   YTGEMAVSDEILKRAADSYRRIRNTARFLLANLNGFNPATDMVKPEEMVVLDRWAVGCA
FT                   KTAQQEILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQTA
FT                   LYHIAEALVRWMAPIMSFTADEIWGYLPGEREKYVFTGEWYDGLFGLEENEEFNDAFWD
FT                   DVRYIKDQVNKELENQKANGIKSNLEAKVTLKYADDANGTIKKLKLLGEEVRFIFITSQ
FT                   FVISEQAGGIDDENIQYNAGNTTVQAVVTRAEGDKCPRCWHYTTDVGKVAEHADICGRC
FT                   VSNIAGNGEQRKFA"
FT   gene            56689..57189
FT                   /gene="lspA"
FT                   /locus_tag="STM0047"
FT   CDS_pept        56689..57189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="STM0047"
FT                   /product="prolipoprotein signal peptidase (SPase II)"
FT                   /EC_number="3.4.23.36"
FT                   /note="similar to E. coli prolipoprotein signal peptidase
FT                   (SPase II) (AAC73138.1); Blastp hit to AAC73138.1 (164 aa),
FT                   92% identity in aa 1 - 164"
FT                   /db_xref="EnsemblGenomes-Gn:STM0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19011"
FT                   /db_xref="GOA:Q8ZRY9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRY9"
FT                   /protein_id="AAL19011.1"
FT                   /translation="MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAK
FT                   EQA"
FT   gene            57328..57793
FT                   /gene="slpA"
FT                   /locus_tag="STM0048"
FT   regulatory      57328..57333
FT                   /gene="slpA"
FT                   /locus_tag="STM0048"
FT                   /note="putative RBS for slpA; RegulonDB:STMS1H000437"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57344..57793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slpA"
FT                   /locus_tag="STM0048"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /EC_number="5.2.1.8"
FT                   /note="similar to E. coli probable FKBX-type 16KD
FT                   peptidyl-prolyl cis-trans isomerase (a rotamase)
FT                   (AAC73139.1); Blastp hit to AAC73139.1 (149 aa), 91%
FT                   identity in aa 1 - 149"
FT                   /db_xref="EnsemblGenomes-Gn:STM0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19012"
FT                   /db_xref="GOA:Q7CR92"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR92"
FT                   /protein_id="AAL19012.1"
FT                   /translation="MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSLS
FT                   EGLEQQLLGLKEGEKKAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIEVLEIDPALEA"
FT   gene            57782..58746
FT                   /gene="lytB"
FT                   /locus_tag="STM0049"
FT   regulatory      57782..57787
FT                   /gene="slpA"
FT                   /locus_tag="STM0048"
FT                   /note="putative RBS for lytB; RegulonDB:STMS1H000438"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57796..58746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="STM0049"
FT                   /product="regulates the activity of guanosine
FT                   3',5'-bispyrophosphate synthetase I (RelA)"
FT                   /note="similar to E. coli control of stringent response;
FT                   involved in penicillin tolerance (AAC73140.1); Blastp hit
FT                   to AAC73140.1 (316 aa), 93% identity in aa 1 - 316"
FT                   /db_xref="EnsemblGenomes-Gn:STM0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19013"
FT                   /db_xref="GOA:P58679"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58679"
FT                   /protein_id="AAL19013.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRKRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGS
FT                   KNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIAR
FT                   LREFGGGEAVTLEGREENIVFEVPKELRVDVREVE"
FT   gene            58940..60148
FT                   /locus_tag="STM0050"
FT   regulatory      58940..58945
FT                   /locus_tag="STM0050"
FT                   /note="putative RBS for STM0050; RegulonDB:STMS1H000439"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58946..60148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0050"
FT                   /product="putative nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19014"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY8"
FT                   /protein_id="AAL19014.1"
FT                   /translation="MGKIKYGLPTLLAIGFWMDATSATVLELPAWERNYTGTIAGKPVN
FT                   VNITRFGNSLNGYYCYEPCNQHKAVIVLRGSLQDKEVHLEERVKALSGYWNAEISSSEI
FT                   KGEWTSADKKRHFPVALIYYKPKNSPDIVLVTNTNDAGGYDPSKEIDCGNTPAISAIKL
FT                   YRDGKLIQTLDTASVGTCSPFMPQWGDVNFDGYPDLSIVTELLAGPDAPVQTWLYDPAK
FT                   QRYVDAPASYQEITSPEIDAEHKQIVSYWRGGCCSHGVNVYRWKGKTIELIDRGESYFQ
FT                   PVISKGKMYNCYMTPSYADGRIIYPLVRKNGHLTPPLSLDGTCQSFWLTGNVRTVIQAE
FT                   KPGAEPESLEIQWQENKASPGRFCPLVPFVEGDKLSPRLVTDDDVPDACISRAEYEDIK
FT                   Q"
FT   gene            60151..61084
FT                   /gene="rihC"
FT                   /locus_tag="STM0051"
FT   regulatory      60151..60156
FT                   /gene="rihC"
FT                   /locus_tag="STM0051"
FT                   /note="putative RBS for rihC; RegulonDB:STMS1H000440"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60164..61084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="STM0051"
FT                   /product="putative purine nucleoside hydrolase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73141.1); Blastp hit to AAC73141.1 (304 aa), 80%
FT                   identity in aa 3 - 303"
FT                   /db_xref="EnsemblGenomes-Gn:STM0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19015"
FT                   /db_xref="GOA:Q8ZRY7"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRY7"
FT                   /protein_id="AAL19015.1"
FT                   /translation="MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSVE
FT                   KTTRNALQLLHFWNSDIPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLAKP
FT                   AFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNFTPN
FT                   AEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHSLFNH
FT                   YRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGQYTAGTTVVDIEGRLGQPA
FT                   NAQVALALDVDGFRQWVAEVFAYAP"
FT   gene            complement(61106..61797)
FT                   /locus_tag="STM0052"
FT   CDS_pept        complement(61106..61792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0052"
FT                   /product="putative transcription regulator sensor for
FT                   citrate"
FT                   /note="similar to E. coli sequence similarity to Shigella
FT                   regulator (AAC73721.1); Blastp hit to AAC73721.1 (226 aa),
FT                   47% identity in aa 5 - 223"
FT                   /db_xref="EnsemblGenomes-Gn:STM0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19016"
FT                   /db_xref="GOA:Q8ZRY6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY6"
FT                   /protein_id="AAL19016.1"
FT                   /translation="MDSITTLIVEDEPMLAEILVDTIKIFPQFSIVGIADKLESAKKQI
FT                   RLYQPQLILLDNFLPDGKGIDLIRHTISTNYTGRIIFITADNHMDTISDALRMGVFDYL
FT                   IKPVHYQRLQHTLERFTRYRSSLRSSEQANQTHVDALFNIQAKEQTAEPNSGLRGIDEN
FT                   TFNRVRQIFADPQAVHTADTLAQILGSSKTTARRYLEQGVKNNFLEAEISYGKVGRPER
FT                   LYRGKV"
FT   regulatory      complement(61792..61797)
FT                   /locus_tag="STM0052"
FT                   /note="putative RBS for STM0052; RegulonDB:STMS1H000441"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(61794..63413)
FT                   /locus_tag="STM0053"
FT   CDS_pept        complement(61794..63413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0053"
FT                   /product="putative transcription regulator"
FT                   /note="histidine kinase for citrate; similar to E. coli
FT                   putative sensor-type protein (AAC73720.1); Blastp hit to
FT                   AAC73720.1 (552 aa), 42% identity in aa 12 - 538"
FT                   /db_xref="EnsemblGenomes-Gn:STM0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19017"
FT                   /db_xref="GOA:Q8ZRY5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY5"
FT                   /protein_id="AAL19017.1"
FT                   /translation="MFIREITRWFARHSFQNRIFLLILFTSTIVMLAITWYLTDITKER
FT                   LHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSDATYITVGNEKGQR
FT                   LYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPIQDSTGKVIGIVSV
FT                   GYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKKQMLNMEPQQLSQLLIQQ
FT                   SVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIHHVVLPEAFFYDAP
FT                   QKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLSLQLSQVRQYADNL
FT                   RAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISHNFRDHHLAGLLIG
FT                   KYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNATLLNREGSRQIEC
FT                   LINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLWLVHSYVKQANGDI
FT                   IVDNNNPFGTIFTLYIPFTREE"
FT   gene            complement(63548..64855)
FT                   /locus_tag="STM0054"
FT   CDS_pept        complement(63548..64849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0054"
FT                   /product="putative oxalacetate decarboxylase, subunit beta"
FT                   /EC_number="4.1.1.3"
FT                   /note="oxaloacetate decarboxylase beta chain.
FT                   (SW:DCOB_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19018"
FT                   /db_xref="GOA:Q8ZRY4"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRY4"
FT                   /protein_id="AAL19018.1"
FT                   /translation="MESLNALLQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLLL
FT                   PIGFGGLLSNIPEAGMALTALESLLAHHDAGQLAVIAAKLNCAPDVHAIKEALALALPS
FT                   VQGQMENLAVDMGYTPGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTLLLG
FT                   AAAQFGIFATVLGALTLNYFGLISFTLPQAAAIGIIGGADGPTAIYLSGKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMKALTSETERKIRMVQLRTVSKREKILFPVVLLMLVALLLP
FT                   DAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILLLGVIAFGIGTAAGVLMAKLLNLCSKNKINPLIGSAGVSAVPMAARVSNKVGLESD
FT                   PQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
FT   regulatory      complement(64850..64855)
FT                   /locus_tag="STM0054"
FT                   /note="putative RBS for STM0054; RegulonDB:STMS1H000442"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(64862..66644)
FT                   /locus_tag="STM0055"
FT   CDS_pept        complement(64862..66637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0055"
FT                   /product="putative oxalacetate decarboxylase, subunit
FT                   alpha"
FT                   /EC_number="4.1.1.3"
FT                   /note="oxaloacetate decarboxylase alpha chain.
FT                   (SW:DCOA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19019"
FT                   /db_xref="GOA:Q03030"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03030"
FT                   /protein_id="AAL19019.1"
FT                   /translation="MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLECW
FT                   GGATFDACIRFLGEDPWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERA
FT                   VKNGMDVFRVFDAMNDPRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLL
FT                   ETGVDSIAIKDMSGILTPMAAYELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEAGV
FT                   DGVDTAISSMSATYGHPATEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEG
FT                   QLKGYDSRILVAQVPGGMLTNLESQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTS
FT                   QIVGTQAVLNVLTGERYKTIAKETAGILKGEYGHTPVPVNAALQARVLEGGAPVTCRPA
FT                   DLLKPELAELEADVRRQAQEKGITLAGNAIDDVLTVALFPQIGLKFLENRNNPAAFEPL
FT                   PQAEAAQPVAKAEKPAASGIYTVEVEGKAFVVKVSDGGDISQLTAAVPAASSAPVQAAA
FT                   PAGAGTPVTAPLAGNIWKVIATEGQTVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVK
FT                   SGDAVSVGDTLMTLA"
FT   regulatory      complement(66639..66644)
FT                   /locus_tag="STM0055"
FT                   /note="putative RBS for STM0055; RegulonDB:STMS1H000443"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(66654..66899)
FT                   /locus_tag="STM0056"
FT   CDS_pept        complement(66654..66893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0056"
FT                   /product="putative oxalacetate decarboxylase, subunit
FT                   gamma"
FT                   /note="sodium ion pump oxaloacetate decarboxylase subunit
FT                   gamma (gi|321934)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19020"
FT                   /db_xref="GOA:P58651"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58651"
FT                   /protein_id="AAL19020.1"
FT                   /translation="MNEAVLLGEGFTLMFLGMGFVLSFLFLLIFAIRGMSAVITRFFPE
FT                   PVAAPAPRAVPVVDDFTRLKPVIAAAIHHHRHHV"
FT   regulatory      complement(66894..66899)
FT                   /locus_tag="STM0056"
FT                   /note="putative RBS for STM0056; RegulonDB:STMS1H000444"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(67052..68400)
FT                   /locus_tag="STM0057"
FT   CDS_pept        complement(67052..68392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0057"
FT                   /product="putative citrate-sodium symport"
FT                   /db_xref="EnsemblGenomes-Gn:STM0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19021"
FT                   /db_xref="GOA:P0A2F8"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="InterPro:IPR018025"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2F8"
FT                   /protein_id="AAL19021.1"
FT                   /translation="MTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHFYN
FT                   AIPTDLVGGFALMFVMGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQKEI
FT                   DAISNVMDKSNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGIVIG
FT                   LCFGIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTIANIF
FT                   AIIFAALLDMIGKKYTWLSGEGELVRKASFKTEDDEKAGQITHRETAVGMVLSTTCFLL
FT                   AYVVAKKILPSIGGVSIHYFAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSKQLLWVL
FT                   MVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGLCM
FT                   ANRGGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFSMMV"
FT   regulatory      complement(68395..68400)
FT                   /locus_tag="STM0057"
FT                   /note="putative RBS for STM0057; RegulonDB:STMS1H000445"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            68637..69680
FT                   /gene="citC2"
FT                   /locus_tag="STM0058"
FT   CDS_pept        68637..69680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC2"
FT                   /locus_tag="STM0058"
FT                   /product="putative citrate lyase synthetase"
FT                   /EC_number="6.2.1.22"
FT                   /note="citrate (pro-3S)-lyase ligase; similar to E. coli
FT                   citrate lyase synthetase (citrate (pro-3S)-lyase ligase
FT                   (AAC73719.1); Blastp hit to AAC73719.1 (381 aa), 49%
FT                   identity in aa 33 - 363"
FT                   /db_xref="EnsemblGenomes-Gn:STM0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19022"
FT                   /db_xref="GOA:Q8ZRY3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY3"
FT                   /protein_id="AAL19022.1"
FT                   /translation="MQNRVNLIFKRIYLQKDVLRRESVAMFLEGVGLALEDDCEIAVCA
FT                   YWQGEIVGCGSLAGSVLKCIAVSPVLQGEGLSLKLLTELLTLAYELNRSELFLFTKPQN
FT                   RLLFSGAGFWPIAQAGELAVLMENSSERLARFCRQLALYRQPGKTIGAIVMNANPFTLG
FT                   HRYLVEQAAAACDWLHLFVVKEDASFFSYTDRWALIEQGIAGIDNVTLHSGSAYMISRA
FT                   TFPGYFLKEKGVVDDCHCQIDLQLFREHLAPALGITHRFVGSEPFCPLTCAYNQRMHDI
FT                   LHDPKRSGPVIEVVELARVEKNGAAISASRVRKLYSERNWSAISALVPAGTLAYLQRHA
FT                   ARHTETI"
FT   gene            69703..70003
FT                   /gene="citD2"
FT                   /locus_tag="STM0059"
FT   regulatory      69703..69708
FT                   /gene="citD2"
FT                   /locus_tag="STM0059"
FT                   /note="putative RBS for citD2; RegulonDB:STMS1H000446"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69710..70003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD2"
FT                   /locus_tag="STM0059"
FT                   /product="putative citrate lyase acyl carrier protein,
FT                   gamma chain"
FT                   /note="similar to E. coli citrate lyase acyl carrier
FT                   protein (gamma chain) (AAC73718.1); Blastp hit to
FT                   AAC73718.1 (98 aa), 48% identity in aa 1 - 94"
FT                   /db_xref="EnsemblGenomes-Gn:STM0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19023"
FT                   /db_xref="GOA:Q7CR91"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR91"
FT                   /protein_id="AAL19023.1"
FT                   /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAAI
FT                   EQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
FT   gene            69994..70869
FT                   /gene="citE2"
FT                   /locus_tag="STM0060"
FT   regulatory      69994..69999
FT                   /gene="citD2"
FT                   /locus_tag="STM0059"
FT                   /note="putative RBS for citE2; RegulonDB:STMS1H000447"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70000..70869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE2"
FT                   /locus_tag="STM0060"
FT                   /product="putative citrate lyase beta chain, acyl lyase
FT                   subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="similar to E. coli citrate lyase beta chain (acyl
FT                   lyase subunit) (AAC73717.1); Blastp hit to AAC73717.1 (307
FT                   aa), 63% identity in aa 17 - 306"
FT                   /db_xref="EnsemblGenomes-Gn:STM0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19024"
FT                   /db_xref="GOA:Q8ZRY2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY2"
FT                   /protein_id="AAL19024.1"
FT                   /translation="MRPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDTA
FT                   RLLVHHALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVLEL
FT                   EAQVERIERECGREVGSTRLMAAIESAKGVVNAVDIATSSPRMVAIALAAFDYVMDMGT
FT                   SRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGKSLVN
FT                   PRQIELLHQAYSPTRKEVEHAYEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHARKVVA
FT                   LSASGIRD"
FT   gene            70873..72400
FT                   /gene="citF2"
FT                   /locus_tag="STM0061"
FT   regulatory      70873..70878
FT                   /gene="citF2"
FT                   /locus_tag="STM0061"
FT                   /note="putative RBS for citF2; RegulonDB:STMS1H000449"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70880..72400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF2"
FT                   /locus_tag="STM0061"
FT                   /product="putative citrate lyase alpha chain"
FT                   /note="bifunctional; similar to E. coli citrate lyase alpha
FT                   chain (AAC73716.1); Blastp hit to AAC73716.1 (510 aa), 72%
FT                   identity in aa 30 - 509; putative citrate-ACP transferase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19025"
FT                   /db_xref="GOA:Q8ZRY1"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="PDB:1XR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY1"
FT                   /protein_id="AAL19025.1"
FT                   /translation="MKETVTMLNQQYVVPEGLQPYQGVTANSPWLASETEKRRRKICDS
FT                   LEEAIRRSGLKNGMTISFHHAFRGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWPLI
FT                   EHIKNGVVRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVKLIQSGELNIDVAFLGV
FT                   PCCDEFGNANGFSGKSRCGSLGYAQVDAQYAKCVVLLTEEWVEFPNYPASIAQDQVDLI
FT                   VQVDEVGDPEKITAGAIRLSSNPRELLIARQAANVIEHSGYFCDGFSLQTGTGGASLAV
FT                   TRFLEDKMRRHNITASFGLGGITGTMVDLHEKGLIKALLDTQSFDGDAARSLAQNPHHI
FT                   EISTNQYANPASKGAACERLNVVMLSALEIDVNFNVNVMTGSNGVLRGASGGHSDTAAG
FT                   ADLTIITAPLVRGRIPCVVEKVLTTVTPGASVDVLVTDHGIAVNPARQDLLDNLRAAGV
FT                   ALMTIEQLQQRAEQLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKG"
FT   gene            72394..72951
FT                   /gene="citX2"
FT                   /locus_tag="STM0062"
FT   regulatory      72394..72399
FT                   /gene="citX2"
FT                   /locus_tag="STM0062"
FT                   /note="putative RBS for citX2; RegulonDB:STMS1H000450"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72400..72951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX2"
FT                   /locus_tag="STM0062"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73715.1); Blastp hit to AAC73715.1 (183 aa), 46%
FT                   identity in aa 12 - 167"
FT                   /db_xref="EnsemblGenomes-Gn:STM0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19026"
FT                   /db_xref="GOA:Q8ZRY0"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY0"
FT                   /protein_id="AAL19026.1"
FT                   /translation="MKGTDLLYLGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLTL
FT                   VAPGAVKNSAVWRRVADYAIAEILALCEQMEWVNVWEMQVNERSGPEWMAAVCAPAMAL
FT                   KQHMSTLEMSHPLGRLWDIDIIDSDGKSLSRRELGHPARPCLICQQDAHLCARGKHHTL
FT                   DLLLDEIARRIECYERERCD"
FT   gene            72923..73837
FT                   /gene="citG2"
FT                   /locus_tag="STM0063"
FT   regulatory      72923..72928
FT                   /gene="citX2"
FT                   /locus_tag="STM0062"
FT                   /note="putative RBS for citG2; RegulonDB:STMS1H000451"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72929..73837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG2"
FT                   /locus_tag="STM0063"
FT                   /product="putative modifier of citrate lyase protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73714.1); Blastp hit to AAC73714.1 (292 aa), 47%
FT                   identity in aa 1 - 290"
FT                   /db_xref="EnsemblGenomes-Gn:STM0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19027"
FT                   /db_xref="GOA:Q8ZRX9"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX9"
FT                   /protein_id="AAL19027.1"
FT                   /translation="MNVSVVTERRTPAYSSLAAGELNGLVARALLTEARLTPKPGLVDI
FT                   RNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMACENDML
FT                   QATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIVAHELSAKKA
FT                   GKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLALLQTLLHLM
FT                   AWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQSLDDELILRNLSPGGS
FT                   ADLLAVTWFLSHFPAGSLYPE"
FT   gene            74007..74838
FT                   /gene="dapB"
FT                   /locus_tag="STM0064"
FT   regulatory      74007..74012
FT                   /gene="dapB"
FT                   /locus_tag="STM0064"
FT                   /note="putative RBS for dapB; RegulonDB:STMS1H000452"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74017..74838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="STM0064"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="similar to E. coli dihydrodipicolinate reductase
FT                   (AAC73142.1); Blastp hit to AAC73142.1 (273 aa), 90%
FT                   identity in aa 1 - 273"
FT                   /db_xref="EnsemblGenomes-Gn:STM0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19028"
FT                   /db_xref="GOA:Q8ZRX8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX8"
FT                   /protein_id="AAL19028.1"
FT                   /translation="MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKSGVIVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTT
FT                   GFDDAGKQAIREASQEIAIVFAANFSVGVNVMLKLLEKAAKVMGDYSDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAGALDKNLKDCAVYSREGYTGERVAGTIGFATVRAGDIVGEHTA
FT                   MFADIGERVEITHKASSRMTFANGALRSALWLKTKKNGLFDMRDVLGLDVL"
FT   gene            75088..75435
FT                   /locus_tag="STM0065"
FT   CDS_pept        75088..75435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0065"
FT                   /product="putative viral protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19029"
FT                   /db_xref="GOA:Q8ZRX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRX7"
FT                   /protein_id="AAL19029.1"
FT                   /translation="MRLIGPSDASVRVITFNGKKLLPELTLVIFSRSALPYAKGTSTRL
FT                   IRLISIGGGVLFLGGAFYLFCFNRLAFLCCSEAGCGPIVCACLKEKEAGSLYRDCNSYY
FT                   IVLICCFLLIL"
FT   protein_bind    75470..75484
FT                   /bound_moiety="IHF"
FT                   /note="putative binding site for IHF, RegulonDB:
FT                   STMS1H000223"
FT   gene            75812..77028
FT                   /gene="carA"
FT                   /locus_tag="STM0066"
FT   regulatory      75812..75820
FT                   /gene="carA"
FT                   /locus_tag="STM0066"
FT                   /note="putative -35_signal for carA;
FT                   RegulonDB:STMLTH004690"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    75820..75832
FT                   /gene="carA"
FT                   /locus_tag="STM0066"
FT                   /bound_moiety="ArgR"
FT                   /note="putative binding site for ArgR, RegulonDB:
FT                   STMS1H000031"
FT   regulatory      75836..75844
FT                   /gene="carA"
FT                   /locus_tag="STM0066"
FT                   /note="putative -10_signal for carA;
FT                   RegulonDB:STMLTH004690"
FT                   /regulatory_class="minus_10_signal"
FT   protein_bind    75852..75870
FT                   /gene="carA"
FT                   /locus_tag="STM0066"
FT                   /bound_moiety="ArgR"
FT                   /note="putative binding site for ArgR, RegulonDB:
FT                   STMS1H000028"
FT   regulatory      75868..75873
FT                   /gene="carA"
FT                   /locus_tag="STM0066"
FT                   /note="putative RBS for carA; RegulonDB:STMS1H000453"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75880..77028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="STM0066"
FT                   /product="carbamoyl-phosphate synthetase,
FT                   glutamine-hydrolysing small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="carbamoyl-phosphate synthase small chain.
FT                   (SW:CARA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19030"
FT                   /db_xref="GOA:P14845"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14845"
FT                   /protein_id="AAL19030.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNKADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLNGMDLAKEVT
FT                   TAETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQ
FT                   TSAEEVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPLFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
FT   gene            77030..80274
FT                   /gene="carB"
FT                   /locus_tag="STM0067"
FT   regulatory      77030..77035
FT                   /gene="carB"
FT                   /locus_tag="STM0067"
FT                   /note="putative RBS for carB; RegulonDB:STMS1H000454"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77047..80274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="STM0067"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="carbamoyl-phosphate synthase large chain.
FT                   (SW:CARB_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19031"
FT                   /db_xref="GOA:P14846"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14846"
FT                   /protein_id="AAL19031.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNADFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSIDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLTEQGVTQEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATTMALNADATEKVTSVQEMHAQIKKS"
FT   protein_bind    80396..80420
FT                   /bound_moiety="FNR"
FT                   /note="putative binding site for FNR, RegulonDB:
FT                   STMS1H000154"
FT   protein_bind    80416..80436
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000050"
FT   gene            80459..80943
FT                   /gene="caiF"
FT                   /locus_tag="STM0068"
FT   regulatory      80459..80467
FT                   /gene="caiF"
FT                   /locus_tag="STM0068"
FT                   /note="putative -35_signal for caiF;
FT                   RegulonDB:STMLTH004691"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      80486..80494
FT                   /gene="caiF"
FT                   /locus_tag="STM0068"
FT                   /note="putative -10_signal for caiF;
FT                   RegulonDB:STMLTH004691"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      80537..80542
FT                   /gene="caiF"
FT                   /locus_tag="STM0068"
FT                   /note="putative RBS for caiF; RegulonDB:STMS1H000455"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        80548..80943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="STM0068"
FT                   /product="transcriptional regulator of cai and fix operon"
FT                   /note="similar to E. coli transcriptional regulator of cai
FT                   operon (AAC73145.1); Blastp hit to AAC73145.1 (166 aa), 76%
FT                   identity in aa 36 - 166"
FT                   /db_xref="EnsemblGenomes-Gn:STM0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19032"
FT                   /db_xref="GOA:Q7CR90"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR90"
FT                   /protein_id="AAL19032.1"
FT                   /translation="MCEKYVERPLYLLIADWMMAENRWITAREISRQFDIEHCKAINTL
FT                   SYILSEVGEIVCEVKMIPNQIAGRGCQCQRLVKVVSIDSQLYRRLNHNLQERKVSVAKA
FT                   PRLSAVPPTELNREQKWQMMLSKSMRR"
FT   gene            complement(81020..81627)
FT                   /gene="caiE"
FT                   /locus_tag="STM0069"
FT   CDS_pept        complement(81020..81616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="STM0069"
FT                   /product="stimulates carnitine racemase activity of CaiD
FT                   and CaiB activity"
FT                   /note="similar to E. coli possible synthesis of cofactor
FT                   for carnitine racemase and dehydratase (AAC73146.1); Blastp
FT                   hit to AAC73146.1 (203 aa), 84% identity in aa 8 - 202"
FT                   /db_xref="EnsemblGenomes-Gn:STM0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19033"
FT                   /db_xref="GOA:Q8ZRX6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX6"
FT                   /protein_id="AAL19033.1"
FT                   /translation="MSYYAFEGLIPVVHPDAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLILEAGSNLQDGCIMHGYCDTDTIVHENGHIGHGAILHGCVVGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFQGEARQLLVGSPARVLRQVTDQELHWKHLNTKEYQDLA
FT                   IRCRTGLSETKPLTQAEENRPRLKGTTDVKPKSAQ"
FT   regulatory      complement(81622..81627)
FT                   /gene="caiE"
FT                   /locus_tag="STM0069"
FT                   /note="putative RBS for caiE; RegulonDB:STMS1H000456"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(81725..82523)
FT                   /gene="caiD"
FT                   /locus_tag="STM0070"
FT   CDS_pept        complement(81725..82510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="STM0070"
FT                   /product="carnitine racemase"
FT                   /EC_number="5.-.-.-"
FT                   /note="similar to E. coli carnitine racemase (AAC73147.1);
FT                   Blastp hit to AAC73147.1 (297 aa), 93% identity in aa 37 -
FT                   297"
FT                   /db_xref="EnsemblGenomes-Gn:STM0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19034"
FT                   /db_xref="GOA:Q8ZRX5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX5"
FT                   /protein_id="AAL19034.1"
FT                   /translation="MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDDP
FT                   ELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGR
FT                   RMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAALKEIYRATSEMPVEEG
FT                   YRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKGR"
FT   regulatory      complement(82518..82523)
FT                   /gene="caiD"
FT                   /locus_tag="STM0070"
FT                   /note="putative RBS for caiD; RegulonDB:STMS1H000457"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(82564..84131)
FT                   /gene="caiC"
FT                   /locus_tag="STM0071"
FT   CDS_pept        complement(82564..84117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="STM0071"
FT                   /product="crotonobetaine/carnitine-CoA ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="similar to E. coli probable
FT                   crotonobetaine/carnitine-CoA ligase (AAC73148.1); Blastp
FT                   hit to AAC73148.1 (522 aa), 84% identity in aa 6 - 522"
FT                   /db_xref="EnsemblGenomes-Gn:STM0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19035"
FT                   /db_xref="GOA:Q8ZRX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX4"
FT                   /protein_id="AAL19035.1"
FT                   /translation="MDIVGGQNLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNE
FT                   EINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWI
FT                   LQNSQVSLLVTSAQFYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFTQLQARQSAT
FT                   LCYTPVLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYMTVMP
FT                   AFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPA
FT                   APTDRQHHLREVMFYLNLSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRVGFSYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAKALEPEGW
FT                   LHTGDSGYQDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAI
FT                   RDEAIKAFIVLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK
FT                   "
FT   regulatory      complement(84126..84131)
FT                   /gene="caiC"
FT                   /locus_tag="STM0071"
FT                   /note="putative RBS for caiC; RegulonDB:STMS1H000458"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(84180..85410)
FT                   /gene="caiB"
FT                   /locus_tag="STM0072"
FT   CDS_pept        complement(84180..85397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="STM0072"
FT                   /product="l-carnitine dehydratase"
FT                   /note="similar to E. coli l-carnitine dehydratase
FT                   (AAC73149.1); Blastp hit to AAC73149.1 (405 aa), 95%
FT                   identity in aa 1 - 405"
FT                   /db_xref="EnsemblGenomes-Gn:STM0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19036"
FT                   /db_xref="GOA:Q8ZRX3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX3"
FT                   /protein_id="AAL19036.1"
FT                   /translation="MNHLPMPTFGPLAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMPA
FT                   FPYTADYFSGMTATTAALAALHKVRETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEIC
FT                   PRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILGTPEVPEGTQLI
FT                   HRVECPYGPLVEEKLDAWLATHTIADVQARFAELNIACAKVLTIPELEGNPQYVARESI
FT                   TQWQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAILKNIGYSEADIKELVGKG
FT                   LAKVED"
FT   regulatory      complement(85405..85410)
FT                   /gene="caiB"
FT                   /locus_tag="STM0072"
FT                   /note="putative RBS for caiB; RegulonDB:STMS1H000459"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(85509..86662)
FT                   /gene="caiA"
FT                   /locus_tag="STM0073"
FT   CDS_pept        complement(85509..86651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="STM0073"
FT                   /product="putative acyl-CoA dehydrogenase, carnitine
FT                   metabolism"
FT                   /EC_number="1.3.99.-"
FT                   /note="similar to E. coli probable carnitine operon
FT                   oxidoreductase (AAC73150.1); Blastp hit to AAC73150.1 (380
FT                   aa), 97% identity in aa 1 - 380"
FT                   /db_xref="EnsemblGenomes-Gn:STM0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19037"
FT                   /db_xref="GOA:Q8ZRX2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX2"
FT                   /protein_id="AAL19037.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLEAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKAGIKVNKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQVLGGVG
FT                   IAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   regulatory      complement(86657..86662)
FT                   /gene="caiA"
FT                   /locus_tag="STM0073"
FT                   /note="putative RBS for caiA; RegulonDB:STMS1H000460"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(86686..88216)
FT                   /gene="caiT"
FT                   /locus_tag="STM0074"
FT   CDS_pept        complement(86686..88203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="STM0074"
FT                   /product="putative BCCT family betaine/carnitine/choline
FT                   transport protein"
FT                   /note="similar to E. coli probable carnitine transporter
FT                   (AAC73151.1); Blastp hit to AAC73151.1 (504 aa), 96%
FT                   identity in aa 1 - 504"
FT                   /db_xref="EnsemblGenomes-Gn:STM0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19038"
FT                   /db_xref="GOA:Q8ZRX1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX1"
FT                   /protein_id="AAL19038.1"
FT                   /translation="MKNEKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMDVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMHLPRMLFYTDAIGKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNILNIPQLIEQHGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVRDGEEPPLLVRIGWSVLVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDK"
FT   regulatory      complement(88211..88216)
FT                   /gene="caiT"
FT                   /locus_tag="STM0074"
FT                   /note="putative RBS for caiT; RegulonDB:STMS1H000461"
FT                   /regulatory_class="ribosome_binding_site"
FT   protein_bind    complement(88340..88366)
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000069"
FT   protein_bind    88461..88489
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000092"
FT   protein_bind    88532..88552
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000084"
FT   gene            88547..89454
FT                   /gene="fixA"
FT                   /locus_tag="STM0075"
FT   regulatory      88547..88555
FT                   /gene="fixA"
FT                   /locus_tag="STM0075"
FT                   /note="putative -35_signal for fixA;
FT                   RegulonDB:STMLTH004700"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      88574..88582
FT                   /gene="fixA"
FT                   /locus_tag="STM0075"
FT                   /note="putative -10_signal for fixA;
FT                   RegulonDB:STMLTH004700"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      88673..88678
FT                   /gene="fixA"
FT                   /locus_tag="STM0075"
FT                   /note="putative RBS for fixA; RegulonDB:STMS1H000462"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        88684..89454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="STM0075"
FT                   /product="putative flavoprotein reductase, carnitine
FT                   metabolism"
FT                   /note="similar to E. coli probable flavoprotein subunit,
FT                   carnitine metabolism (AAC73152.1); Blastp hit to AAC73152.1
FT                   (268 aa), 87% identity in aa 13 - 268"
FT                   /db_xref="EnsemblGenomes-Gn:STM0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19039"
FT                   /db_xref="GOA:Q8ZRX0"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX0"
FT                   /protein_id="AAL19039.1"
FT                   /translation="MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAA
FT                   CQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQHTATAL
FT                   AAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTLTVEREL
FT                   EDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLNSVPAYSAQ
FT                   QVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
FT   gene            89459..90411
FT                   /gene="fixB"
FT                   /locus_tag="STM0076"
FT   regulatory      89459..89464
FT                   /gene="fixB"
FT                   /locus_tag="STM0076"
FT                   /note="putative RBS for fixB; RegulonDB:STMS1H000463"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89470..90411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="STM0076"
FT                   /product="putative electron transfer flavoprotein,
FT                   carnitine metabolism"
FT                   /note="similar to E. coli probable flavoprotein subunit,
FT                   carnitine metabolism (AAC73153.1); Blastp hit to AAC73153.1
FT                   (313 aa), 84% identity in aa 1 - 313"
FT                   /db_xref="EnsemblGenomes-Gn:STM0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19040"
FT                   /db_xref="GOA:P64095"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64095"
FT                   /protein_id="AAL19040.1"
FT                   /translation="MNKFSSVWVFSDTPSRLPELMSGAQAVGEKVNAFVLNEADSATAC
FT                   HLGADHVWLLSGKPEDRMIEDYAAAMAETIRQHSEGGAVLLPNTRRGKLLAAKLGYRLS
FT                   AAVSNDASDVSLQDGKAAVKHMVYGGLAIGAETIASPFAVITLSSGTFDAQQPDASRSG
FT                   EMHTVQWQAPATAVTRTATQARQSNSVDLDKARLVVSVGRGIGSKENISLAEALCQTIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQTIFAIN
FT                   KDKNAPIFQYADFGIVGDALKILPALTAALAR"
FT   gene            90450..91747
FT                   /gene="fixC"
FT                   /locus_tag="STM0077"
FT   regulatory      90450..90455
FT                   /gene="fixC"
FT                   /locus_tag="STM0077"
FT                   /note="putative RBS for fixC; RegulonDB:STMS1H000464"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        90461..91747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="STM0077"
FT                   /product="related to carnitine metabolism protein"
FT                   /note="similar to E. coli flavoprotein; electron transport
FT                   (AAC73154.1); Blastp hit to AAC73154.1 (428 aa), 88%
FT                   identity in aa 1 - 428"
FT                   /db_xref="EnsemblGenomes-Gn:STM0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19041"
FT                   /db_xref="GOA:Q8ZRW9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRW9"
FT                   /protein_id="AAL19041.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLERIIPGFADQAPIERMITHEKLAFMTDNGAMTIDYCNGEDASASQVSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNVVQRDGKVVGVEADGDILEAKVVILADGVN
FT                   SLLAEKLGMTKRVEASHVAVGVKELIELPKLVIEDRFQLQGNEGAACLFAGAPTDGLMG
FT                   GGFLYTNETTLSLGLVCGLHHLKDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYAAHVV
FT                   PEAGMNMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAISAGEAAAKTVLSAMKRDDF
FT                   SKQSLGEYRQHLDEGPMRDMRMYQKLPAFLDNPRMFTAYPEMAVNIARDLFTVDGSAPV
FT                   PMRKKILRHAKKVGFINLMKDGLKGVTVL"
FT   gene            91728..92031
FT                   /gene="fixX"
FT                   /locus_tag="STM0078"
FT   regulatory      91728..91733
FT                   /gene="fixX"
FT                   /locus_tag="STM0078"
FT                   /note="putative RBS for fixX; RegulonDB:STMS1H000465"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91744..92031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="STM0078"
FT                   /product="putative ferredoxin"
FT                   /note="carnitine metabolism; similar to E. coli putative
FT                   ferredoxin (AAC73155.1); Blastp hit to AAC73155.1 (95 aa),
FT                   88% identity in aa 1 - 95"
FT                   /db_xref="EnsemblGenomes-Gn:STM0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19042"
FT                   /db_xref="GOA:Q8ZRW8"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRW8"
FT                   /protein_id="AAL19042.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEDSPHIILKTDPDKQALEVLIKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLDTALEKWEYPRGTFGVEFRYG"
FT   gene            92166..93518
FT                   /gene="yaaU"
FT                   /locus_tag="STM0079"
FT   regulatory      92166..92171
FT                   /gene="yaaU"
FT                   /locus_tag="STM0079"
FT                   /note="putative RBS for yaaU; RegulonDB:STMS1H000466"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        92178..93518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="STM0079"
FT                   /product="putative MFS family transport protein"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC73156.1); Blastp hit to AAC73156.1 (443 aa), 86%
FT                   identity in aa 1 - 439"
FT                   /db_xref="EnsemblGenomes-Gn:STM0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19043"
FT                   /db_xref="GOA:Q8ZRW7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRW7"
FT                   /protein_id="AAL19043.1"
FT                   /translation="MQQPRNFDDLKFSSIHRRIMLWGSGGPFLDGYVLVIIGVALEQLT
FT                   PLLHLDAEWIGALGAATLAGLFIGTSLFGYICDKVGRRKMFLLDIIAIGVISVATMFVS
FT                   TPLELLVMRVLIGIVIGADYPIATSMITEFSNTRQRAFSIGFIAAMWYVGATCANLVGY
FT                   WLYDMEGGWRWMLGSAFIPCLIILIGRFDLPESPRWLLRKGRVKECEQMMIKLFGEPVC
FT                   FDDELPQETRFLQLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGWEQGRNA
FT                   ALGNVVISLFFMLGCIPAMFWLNSIGRRPLLIGSFAMMTIALALLGLVSNLGIILVVVA
FT                   FAVYAFFSGGPGILQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFITRYGI
FT                   NNVMLIGALISLVGLGVSVMFAPETRGLTLTQTGNMTLRGTPSDNPR"
FT   gene            93601..93837
FT                   /locus_tag="STM0080"
FT   regulatory      93601..93606
FT                   /locus_tag="STM0080"
FT                   /note="putative RBS for STM0080; RegulonDB:STMS1H000467"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        93607..93837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0080"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC75851.1); Blastp hit to AAC75851.1 (76 aa), 51%
FT                   identity in aa 1 - 75"
FT                   /db_xref="EnsemblGenomes-Gn:STM0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19044"
FT                   /db_xref="InterPro:IPR010305"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR89"
FT                   /protein_id="AAL19044.1"
FT                   /translation="MQKRLMTALFTAATLFTVAGCSSNQAVETTDGKTIVTDGKPEVDN
FT                   DTGMVSYKNAATGKTEQINRDQLKNMSELDN"
FT   gene            94123..94547
FT                   /locus_tag="STM0081"
FT   regulatory      94123..94128
FT                   /locus_tag="STM0081"
FT                   /note="putative RBS for STM0081; RegulonDB:STMS1H000468"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        94131..94547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0081"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRW6"
FT                   /protein_id="AAL19045.1"
FT                   /translation="MKPIPFYLLALFSAASGATEINVCKDLIGTWKTTADNPPYTMTIS
FT                   PPVESCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGTYN
FT                   RQLQLLWAGVISKNKKGKWITKMENYWFRQVKAH"
FT   gene            complement(94771..95069)
FT                   /locus_tag="STM0082"
FT   CDS_pept        complement(94771..95061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0082"
FT                   /product="putative secreted protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC76270.1); Blastp hit to AAC76270.1 (104 aa), 36%
FT                   identity in aa 18 - 103"
FT                   /db_xref="EnsemblGenomes-Gn:STM0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19046"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="PDB:2JNA"
FT                   /db_xref="PDB:2MA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR88"
FT                   /protein_id="AAL19046.1"
FT                   /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQ
FT                   SGGQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
FT   regulatory      complement(95064..95069)
FT                   /locus_tag="STM0082"
FT                   /note="putative RBS for STM0082; RegulonDB:STMS1H000469"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            95271..95465
FT                   /locus_tag="STM0083"
FT   CDS_pept        95271..95465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0083"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19047"
FT                   /db_xref="GOA:Q8ZRW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRW5"
FT                   /protein_id="AAL19047.1"
FT                   /translation="MLPGTHSLAAFKQLELFWVITSVDYLKIALFGVTVFYLVIVTSLC
FT                   CCQCKIMHCQLKRNLTPCK"
FT   gene            95952..97848
FT                   /locus_tag="STM0084"
FT   regulatory      95952..95957
FT                   /locus_tag="STM0084"
FT                   /note="putative RBS for STM0084; RegulonDB:STMS1H000470"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        95959..97848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0084"
FT                   /product="putative sulfatase"
FT                   /note="similar to E. coli putative sulfatase (AAC76701.1);
FT                   Blastp hit to AAC76701.1 (497 aa), 31% identity in aa 251 -
FT                   345, 31% identity in aa 5 - 103, 45% identity in aa 400 -
FT                   431"
FT                   /db_xref="EnsemblGenomes-Gn:STM0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19048"
FT                   /db_xref="GOA:Q8ZRW4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRW4"
FT                   /protein_id="AAL19048.1"
FT                   /translation="MSNKKNLSAEETDLTRRKLLTSAGILAAGGMLSGAVKADEKCAVK
FT                   AKPAWDKPFTGEIPEKLPEGYNILLVVTDQERFFPTFPFPVPGRERLMKTGVTFCNHQN
FT                   TSNVCTPSRSVLYTGLHMPQTKMFDNLGLPWMPYDLDPALGTTGHMMRELGYYTAYKGK
FT                   WHLTEKLEKPLPDEKDEDIDVGDIPEPELHKIMEKYGFADYHGIGDIIGHSKGGYFYDS
FT                   TTTAQTINWLRCKGQPLNDQHKPWFLAVNLVNPHDVMFIDTDKEGEKVQWRGELDQDDN
FT                   TLAPTQPPENELYQASWPNYPLPANRHQSFNEQGRPPAHLEYQTARAALEGQFPDEDRR
FT                   WRKLLDYYFNCIRDCDTHLDRILNELDALKLTDKTIVVFTADHGELGGSHQMHGKGASV
FT                   YKEQIHVPMIISHPAYPGNKKCQALTCHLDIAPTLVGLTGLPEEKQHQALGNRKGVNFS
FT                   GLLKNPESVAVNAVRNASLYCYGMILYTDAHYLHRVIALQRDKQKTVAQIKQEISHLHP
FT                   DFSHRSGTRMINDGRYKFARYFSLREHNTPETWEDLIKYNDLELYDLKNDPDENHNLAA
FT                   DKQKYQDLILTMNEKLNKIIKDEIGVDDGSFMPDAAHEPWDLTIEQFNRMAKD"
FT   gene            98245..98785
FT                   /gene="yabF"
FT                   /locus_tag="STM0085"
FT   regulatory      98245..98250
FT                   /gene="yabF"
FT                   /locus_tag="STM0085"
FT                   /note="putative RBS for yabF; RegulonDB:STMS1H000471"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98255..98785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabF"
FT                   /locus_tag="STM0085"
FT                   /product="putative NAD(P)H oxidoreductase"
FT                   /EC_number="1.6.99.-"
FT                   /note="similar to E. coli putative NAD(P)H oxidoreductase
FT                   (AAC73157.1); Blastp hit to AAC73157.1 (176 aa), 87%
FT                   identity in aa 1 - 176"
FT                   /db_xref="EnsemblGenomes-Gn:STM0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19049"
FT                   /db_xref="GOA:Q8ZRW3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRW3"
FT                   /protein_id="AAL19049.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQAGTLENVEIRSLYHLYPDFNID
FT                   VAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGENHFAIGSHPGFDVLSQPLQATALYCGLKWLSPFAMHCTFICDDDTLQAQARQY
FT                   KQRLLAWQEVNHG"
FT   gene            98765..100640
FT                   /gene="kefC"
FT                   /locus_tag="STM0086"
FT   regulatory      98765..98770
FT                   /gene="yabF"
FT                   /locus_tag="STM0085"
FT                   /note="putative RBS for kefC; RegulonDB:STMS1H000472"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98778..100640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="STM0086"
FT                   /product="CPA2 family K+ efflux antiporter,
FT                   glutathione-regulated"
FT                   /note="similar to E. coli K+ efflux antiporter,
FT                   glutathione-regulated (AAC73158.1); Blastp hit to
FT                   AAC73158.1 (620 aa), 90% identity in aa 1 - 619"
FT                   /db_xref="EnsemblGenomes-Gn:STM0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19050"
FT                   /db_xref="GOA:Q8ZRW2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRW2"
FT                   /protein_id="AAL19050.1"
FT                   /translation="MDSHTLLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMGVCGGLIGLF
FT                   CMFLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASGASTTLGAFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLVENPLRILLLLAGFLAIKIVMLWLVARPLGVPAKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMADVLEPEWAKALTLAVALSMAATPIFLVLLTRMEKTATGEAREADEIDEEQ
FT                   PRVIVAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLSELVKSHFPHLQIIARARDVDHYIRLRQAGVAMPERE
FT                   TFEGALKSGRQALEALGLGRYEARERADLFRHFNTRMVEEMAKGENDPLSRAAAYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTAEGKHSGEVADEPEVKPSI"
FT   gene            100826..101318
FT                   /gene="folA"
FT                   /locus_tag="STM0087"
FT   regulatory      100826..100831
FT                   /gene="folA"
FT                   /locus_tag="STM0087"
FT                   /note="putative RBS for folA; RegulonDB:STMS1H000473"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        100839..101318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="STM0087"
FT                   /product="dihydrofolate reductase type I"
FT                   /EC_number="1.5.1.3"
FT                   /note="trimethoprim resistance; similar to E. coli
FT                   dihydrofolate reductase type I; trimethoprim resistance
FT                   (AAC73159.1); Blastp hit to AAC73159.1 (159 aa), 96%
FT                   identity in aa 1 - 159"
FT                   /db_xref="EnsemblGenomes-Gn:STM0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19051"
FT                   /db_xref="GOA:Q8ZRW1"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRW1"
FT                   /protein_id="AAL19051.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRH
FT                   TWESIGRPLPGRKNIVISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            complement(101424..102272)
FT                   /gene="apaH"
FT                   /locus_tag="STM0088"
FT   CDS_pept        complement(101424..102272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="STM0088"
FT                   /product="diadenosine tetraphosphatase"
FT                   /EC_number="3.6.1.41"
FT                   /note="bis(5'-nucleosyl)-tetraphosphatase. (SW:APAH_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19052"
FT                   /db_xref="GOA:P0A1B1"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1B1"
FT                   /protein_id="AAL19052.1"
FT                   /translation="MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGNSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQVDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVSEAYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGEGEAVN
FT                   A"
FT   gene            complement(102283..102674)
FT                   /gene="apaG"
FT                   /locus_tag="STM0089"
FT   CDS_pept        complement(102283..102660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="STM0089"
FT                   /product="putative cytoplasmic protein"
FT                   /note="APAG protein (CORD protein). (SW:APAG_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19053"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56017"
FT                   /protein_id="AAL19053.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGHGRETEVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDE
FT                   NGDAFTIDIPVFRLAVPTLIH"
FT   gene            complement(102663..103484)
FT                   /gene="ksgA"
FT                   /locus_tag="STM0090"
FT   CDS_pept        complement(102663..103484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="STM0090"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase; kasugamycin resistance"
FT                   /EC_number="2.1.1.-"
FT                   /note="dimethyladenosine transferase. (SW:KSGA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19054"
FT                   /db_xref="GOA:Q56016"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56016"
FT                   /protein_id="AAL19054.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDRFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDKLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSAQL
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKEYGRLSVM
FT                   AQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVETLTEMGIDPAMRAENISVAQYCQMANYLSENAPLKES"
FT   regulatory      complement(102669..102674)
FT                   /gene="apaG"
FT                   /locus_tag="STM0089"
FT                   /note="putative RBS for apaG; RegulonDB:STMS1H000474"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(103481..104470)
FT                   /gene="pdxA"
FT                   /locus_tag="STM0091"
FT   CDS_pept        complement(103481..104470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="STM0091"
FT                   /product="NAD-dependent dehydrogenase/carboxylase"
FT                   /note="pyridoxine phosphate biosynthetic protein PdxJ-PdxA
FT                   subunit; similar to E. coli pyridoxine biosynthesis
FT                   (AAC73163.1); Blastp hit to AAC73163.1 (329 aa), 92%
FT                   identity in aa 1 - 329"
FT                   /db_xref="EnsemblGenomes-Gn:STM0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19055"
FT                   /db_xref="GOA:P58717"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="PDB:1R8K"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58717"
FT                   /protein_id="AAL19055.1"
FT                   /translation="MSSAQRVVITPGEPAGSGPDLVVQLAQRAWPIELVVCADGALLTE
FT                   RAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAISGQLTVENGPYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGISFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(104470..105767)
FT                   /gene="surA"
FT                   /locus_tag="STM0092"
FT   CDS_pept        complement(104470..105756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="STM0092"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="survival protein; similar to E. coli survival
FT                   protein (AAC73164.1); Blastp hit to AAC73164.1 (428 aa),
FT                   91% identity in aa 1 - 428"
FT                   /db_xref="EnsemblGenomes-Gn:STM0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19056"
FT                   /db_xref="GOA:Q7CR87"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR87"
FT                   /protein_id="AAL19056.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIA
FT                   KQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQ
FT                   IGTQNDASTELNLSHILIALPENPTSEQVNDAQRQAESIVEEARNGADFGKLAITYSAD
FT                   QQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQSIS
FT                   VTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAATWMQEQRASAYVKILSN"
FT   regulatory      complement(105762..105767)
FT                   /gene="surA"
FT                   /locus_tag="STM0092"
FT                   /note="putative RBS for surA; RegulonDB:STMS1H000475"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(105810..108170)
FT                   /gene="imp"
FT                   /locus_tag="STM0093"
FT   CDS_pept        complement(105810..108170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="STM0093"
FT                   /product="organic solvent tolerance protein"
FT                   /note="similar to E. coli organic solvent tolerance
FT                   (AAC73165.1); Blastp hit to AAC73165.1 (784 aa), 91%
FT                   identity in aa 1 - 784"
FT                   /db_xref="EnsemblGenomes-Gn:STM0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19057"
FT                   /db_xref="GOA:Q8ZRW0"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="PDB:4N4R"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRW0"
FT                   /protein_id="AAL19057.1"
FT                   /translation="MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVKG
FT                   DTNDLPVTINADNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLTQ
FT                   AGEGVMELDYLPSDKVYEDDHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKVSDSSYF
FT                   NDFDSKYGSSTDGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEPQLDVNYY
FT                   HNDLGPFDTRIYGQAVHFVNTKDNMPEATRVHLEPTINLPLSNRWGSLNTEAKLMATHY
FT                   QQTNLDSYNSDPNNKNKLEDSVNRVMPQFKVDGKLIFERDMAMLAPGYTQTLEPRVQYL
FT                   YVPYRDQSGIYNYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTTRIYDDAAVER
FT                   FNVSVGQIYYFTESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGLRSGVQYDTRLD
FT                   SVATSSSSLEYRRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKNGINQVGAVASWP
FT                   IADRWSIVGAYYFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNGWDNDKQHAIYDNA
FT                   IGFNIELRGLSSNYGLGTQEMLRSNILPYQSSM"
FT   gene            108413..109236
FT                   /gene="djlA"
FT                   /locus_tag="STM0094"
FT   regulatory      108413..108418
FT                   /gene="djlA"
FT                   /locus_tag="STM0094"
FT                   /note="putative RBS for djlA; RegulonDB:STMS1H000476"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        108424..109236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="STM0094"
FT                   /product="DnaJ like chaperone protein"
FT                   /note="similar to E. coli putative DNA binding protein
FT                   (AAC73166.1); Blastp hit to AAC73166.1 (271 aa), 95%
FT                   identity in aa 1 - 271"
FT                   /db_xref="EnsemblGenomes-Gn:STM0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19058"
FT                   /db_xref="GOA:Q7CR86"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR86"
FT                   /protein_id="AAL19058.1"
FT                   /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVG
FT                   KADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGI
FT                   SRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKR
FT                   AYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
FT   gene            complement(109331..110002)
FT                   /gene="rluA"
FT                   /locus_tag="STM0095"
FT   CDS_pept        complement(109331..109990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="STM0095"
FT                   /product="23S rRNA pseudouridylate 746 synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="similar to E. coli pseudouridylate synthase
FT                   (AAC73169.1); Blastp hit to AAC73169.1 (219 aa), 95%
FT                   identity in aa 1 - 219"
FT                   /db_xref="EnsemblGenomes-Gn:STM0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19059"
FT                   /db_xref="GOA:Q8ZRV9"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRV9"
FT                   /protein_id="AAL19059.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDEHIMVVNKPSGLLSVPGRLEAHKDS
FT                   IMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEALSLAPRLQLHAEMLTITHPAYGNSMTFKVPADF"
FT   regulatory      complement(109997..110002)
FT                   /gene="rluA"
FT                   /locus_tag="STM0095"
FT                   /note="putative RBS for rluA; RegulonDB:STMS1H000477"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(110002..112908)
FT                   /gene="hepA"
FT                   /locus_tag="STM0096"
FT   CDS_pept        complement(110002..112908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="STM0096"
FT                   /product="RNA polymerase associated protein"
FT                   /note="putative SNF2 family RNA helicase; similar to E.
FT                   coli probable ATP-dependent RNA helicase (AAC73170.1);
FT                   Blastp hit to AAC73170.1 (968 aa), 93% identity in aa 1 -
FT                   968"
FT                   /db_xref="EnsemblGenomes-Gn:STM0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19060"
FT                   /db_xref="GOA:Q8ZRV8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRV8"
FT                   /protein_id="AAL19060.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAMDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHEGWQLHIDEVKEENGLLVYVGTRLDTEETNVTLREVLLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPYSGLRGQRTNLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYTEAQHDAYNPFETEQLVICSLDFARRNKQRLEHLCDAEWDLLVVDE
FT                   AHHLVWSTDAPSREYMAIEQLAERVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFE
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNRLGDLIGEQDIEPLLQAANSDRDDAQAA
FT                   RDELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTVKLPLPTQYQTAIKVSGIMGARK
FT                   SPEDRARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKATTAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   NLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRAIYDSAYASLINYLAAPEETDGFDDLIKSCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQQLAQSIEEQDDDTNLIAFAMNLFDIVGINQDDRGDNLIVLTPSDHMLVPDFPG
FT                   LPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELVYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRH
FT                   TGSKLVNAVQQDVHAILQLGETQIEKSARALIDNARREADEKLSGELSRLEALRAVNPN
FT                   IRDDELAAIDSNRQQVLESLNQAGWRLDALRLIVVTHQ"
FT   gene            complement(113082..115445)
FT                   /gene="polB"
FT                   /locus_tag="STM0097"
FT   CDS_pept        complement(113082..115433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="STM0097"
FT                   /product="DNA polymerase II"
FT                   /EC_number="2.7.7.7"
FT                   /note="3'->5' exonuclease; similar to E. coli DNA
FT                   polymerase II (AAC73171.1); Blastp hit to AAC73171.1 (783
FT                   aa), 89% identity in aa 1 - 783"
FT                   /db_xref="EnsemblGenomes-Gn:STM0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19061"
FT                   /db_xref="GOA:Q8ZRV7"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRV7"
FT                   /protein_id="AAL19061.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPVQATLAPQESVAFI
FT                   PTSQTSRAASLLQAEKDYRLTPLQLRDFHRQPVSGLYCRTHRQLMRMEKLLRENGVTVY
FT                   EADVRPPERYLMERFITSPVWVDGEMRNGVIRNARLKPHSDYRPPLKWVSLDIETTRHG
FT                   ELYCIGLEGCGQRTVYMLGPANGDDHQLDFELVYVASRPQLLEKLNAWFAEHDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRIPLRLGRDNSELEWREHGFKNGVFFAQARGRVIIDGIDAL
FT                   KSAFWNFSSFSLEAVSQELLGEGKSIDNPWDRMDEIDRRFAQDKPALATYNLKDCELVT
FT                   RIFHKTEIMPFLLERATINGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPLAS
FT                   PGGYVMDSQPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVSQIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLAS
FT                   SITMRGHAIMRQTKALIEAQGYDVIYGDTDSTFVWLRRAHSEADAAEIGHRLVRHVNEW
FT                   WAQTLQQQNLTSALELEFETHFCRFLMPTIRGADTGSKKRYAGLIQEGDSQRMVFKGLE
FT                   TVRTDWTPLAQRFQQELYLRVFRNEPYQDYVRETIDKLMAGELDAQLVYRKRLRRPLHE
FT                   YQRNVPPHVRAARLADEQNLKQGRPAQYQNRGAIKYVWTVNGPEPVDYQQSPLDYEHYL
FT                   TRQLQPVAEGILPFVEDNFATLLTGQLGLF"
FT   regulatory      complement(115440..115445)
FT                   /gene="polB"
FT                   /locus_tag="STM0097"
FT                   /note="putative RBS for polB; RegulonDB:STMS1H000478"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(115477..116102)
FT                   /locus_tag="STM0098"
FT   CDS_pept        complement(115477..116097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0098"
FT                   /product="putative secreted protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC76121.1); Blastp hit to AAC76121.1 (230 aa), 24%
FT                   identity in aa 19 - 171"
FT                   /db_xref="EnsemblGenomes-Gn:STM0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19062"
FT                   /db_xref="GOA:Q8ZRV6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRV6"
FT                   /protein_id="AAL19062.1"
FT                   /translation="MKYRYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIV
FT                   AGAGVSGKTPSPVFQARLDHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKG
FT                   IPAKAIFIEERSTVTRENIRYAKQILRQQQWRTALLVSDPLHMLRLKTIAQDNGIDSRS
FT                   SPTRSTRYKSWWAQTRFLLRETFYYSGYRLLRYMPVQNNSITP"
FT   regulatory      complement(116097..116102)
FT                   /locus_tag="STM0098"
FT                   /note="putative RBS for STM0098; RegulonDB:STMS1H000479"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            116294..116601
FT                   /locus_tag="STM0099"
FT   regulatory      116294..116299
FT                   /locus_tag="STM0099"
FT                   /note="putative RBS for STM0099; RegulonDB:STMS1H000480"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        116299..116601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0099"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19063"
FT                   /db_xref="GOA:Q8ZRV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRV5"
FT                   /protein_id="AAL19063.1"
FT                   /translation="MNVACDGPSGQGPWMGRVIRSQHISNSKYEGYNDAGVDSRYNYPI
FT                   TANFESFLFTVFTHVLAVLCQVCFHTLSIFQKGACSNLLLISRINKKAIFFVCFN"
FT   gene            116816..117235
FT                   /locus_tag="STM0100"
FT   CDS_pept        116816..117235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0100"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19064"
FT                   /db_xref="InterPro:IPR031855"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRV4"
FT                   /protein_id="AAL19064.1"
FT                   /translation="MNVSMQARLVGNDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIWR
FT                   TEIIENGNAFFHWQGHDRKNGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGHYD
FT                   NIIEYVSSDHYVYQSAFAEYITDQIHQRAPHGTRF"
FT   gene            complement(117241..117949)
FT                   /gene="araD"
FT                   /locus_tag="STM0101"
FT   CDS_pept        complement(117241..117936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="STM0101"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="L-ribulose-5-phosphate 4-epimerase. (SW:ARAD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19065"
FT                   /db_xref="GOA:P06190"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06190"
FT                   /protein_id="AAL19065.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVLVIKPSG
FT                   VDYSVMTADDMVVVSLESGEVVEGHKKPSSDTPTHRLLYQAFPTIGGIVHTHSRHATIW
FT                   AQAGQPIPATGTTHADYFYGTIPCTRKMTEAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQSLLDKHYLRK
FT                   HGAKAYYGQ"
FT   regulatory      complement(117944..117949)
FT                   /gene="araD"
FT                   /locus_tag="STM0101"
FT                   /note="putative RBS for araD; RegulonDB:STMS1H000481"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(118077..119591)
FT                   /gene="araA"
FT                   /locus_tag="STM0102"
FT   CDS_pept        complement(118077..119579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="STM0102"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="L-arabinose isomerase. (SW:ARAA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19066"
FT                   /db_xref="GOA:P06189"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06189"
FT                   /protein_id="AAL19066.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKLP
FT                   CKLVLKPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAW
FT                   MRQAVSKQDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIG
FT                   DGDINALIDEYESSYTLTPATQIHGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKEDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALD
FT                   LNDMRQFAEIHDIEIAVIDNDTHLPAFKDALRWNEVYYGFKR"
FT   regulatory      complement(119586..119591)
FT                   /gene="araA"
FT                   /locus_tag="STM0102"
FT                   /note="putative RBS for araA; RegulonDB:STMS1H000482"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(119590..121412)
FT                   /gene="araB"
FT                   /locus_tag="STM0103"
FT   CDS_pept        complement(119590..121299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="STM0103"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /note="L-ribulokinase. (SW:KIRI_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19067"
FT                   /db_xref="GOA:P06188"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06188"
FT                   /protein_id="AAL19067.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCATGDEIATSVEWYPRWQEGRYCDG
FT                   PNNQFRHHPRDYMESMEAALKAVLAQLSAAQRANVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEADEITRLCHKPGKVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQAAVSWIELCDWVPALLSGTTRPQDIRRGRCSAGHKTLWHESWGGLPPASF
FT                   FDELDPCINRHLRYPLFSETFTADLPVGTLCAEWAQRLDLPESVVISGGAFDCHMGAVG
FT                   AGAQPNTLVKVIGTSTCDILIADKQSVGDRAVKGICGQVDGSVVPNFIGLEAGQSAFGD
FT                   IYAWFSRVLSWPLEQLAAQHPELKPQINASQKQLLPALTDAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPALFGGLVASTAFGARAIQECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQVCCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPAAQQSMASA
FT                   VERTLRPHPEQAQRFEQLYRRYQQWALSAEQHYLPTAAPAPTTPANQAILTH"
FT   regulatory      complement(121307..121312)
FT                   /gene="araB"
FT                   /locus_tag="STM0103"
FT                   /note="putative RBS for araB; RegulonDB:STMS1H000483"
FT                   /regulatory_class="ribosome_binding_site"
FT   protein_bind    complement(121352..121370)
FT                   /gene="araB"
FT                   /locus_tag="STM0103"
FT                   /bound_moiety="AraC"
FT                   /note="putative binding site for AraC, RegulonDB:
FT                   STMS1H000003"
FT   protein_bind    121374..121392
FT                   /bound_moiety="AraC"
FT                   /note="putative binding site for AraC, RegulonDB:
FT                   STMS1H000008"
FT   protein_bind    complement(121378..121396)
FT                   /gene="araB"
FT                   /locus_tag="STM0103"
FT                   /bound_moiety="AraC"
FT                   /note="putative binding site for AraC, RegulonDB:
FT                   STMS1H000007"
FT   regulatory      complement(121385..121393)
FT                   /gene="araB"
FT                   /locus_tag="STM0103"
FT                   /note="putative -10_signal for araB;
FT                   RegulonDB:STMLTH004463"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(121404..121412)
FT                   /gene="araB"
FT                   /locus_tag="STM0103"
FT                   /note="putative -35_signal for araB;
FT                   RegulonDB:STMLTH004463"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    complement(121406..121433)
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000094"
FT   protein_bind    121412..121432
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000082"
FT   protein_bind    121430..121448
FT                   /bound_moiety="AraC"
FT                   /note="putative binding site for AraC, RegulonDB:
FT                   STMS1H000012"
FT   protein_bind    121464..121482
FT                   /bound_moiety="AraC"
FT                   /note="putative binding site for AraC, RegulonDB:
FT                   STMS1H000006"
FT   gene            121528..122485
FT                   /gene="araC"
FT                   /locus_tag="STM0104"
FT   regulatory      121528..121536
FT                   /gene="araC"
FT                   /locus_tag="STM0104"
FT                   /note="putative -35_signal for araC;
FT                   RegulonDB:STMLTH004464"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      121552..121560
FT                   /gene="araC"
FT                   /locus_tag="STM0104"
FT                   /note="putative -10_signal for araC;
FT                   RegulonDB:STMLTH004464"
FT                   /regulatory_class="minus_10_signal"
FT   protein_bind    121590..121608
FT                   /gene="araC"
FT                   /locus_tag="STM0104"
FT                   /bound_moiety="AraC"
FT                   /note="putative binding site for AraC, RegulonDB:
FT                   STMS1H000004"
FT   protein_bind    complement(121602..121620)
FT                   /bound_moiety="AraC"
FT                   /note="putative binding site for AraC, RegulonDB:
FT                   STMS1H000009"
FT   regulatory      121632..121637
FT                   /gene="araC"
FT                   /locus_tag="STM0104"
FT                   /note="putative RBS for araC; RegulonDB:STMS1H000484"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        121640..122485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="STM0104"
FT                   /product="transcriptional regulator (AraC/XylS family) for
FT                   ara operon"
FT                   /note="arabinose operon regulatory protein.
FT                   (SW:ARAC_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19068"
FT                   /db_xref="GOA:P03022"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03022"
FT                   /protein_id="AAL19068.1"
FT                   /translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYW
FT                   QEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLLLRR
FT                   MAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   "
FT   gene            122593..123371
FT                   /gene="yabI"
FT                   /locus_tag="STM0105"
FT   regulatory      122593..122598
FT                   /gene="yabI"
FT                   /locus_tag="STM0105"
FT                   /note="putative RBS for yabI; RegulonDB:STMS1H000485"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122604..123371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="STM0105"
FT                   /product="putative DedA family membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73176.1); Blastp hit to AAC73176.1 (254 aa), 89%
FT                   identity in aa 1 - 253"
FT                   /db_xref="EnsemblGenomes-Gn:STM0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19069"
FT                   /db_xref="GOA:Q8ZRV3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRV3"
FT                   /protein_id="AAL19069.1"
FT                   /translation="MQALLEHFITQSTLYSLIAVLLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELNFWHAWLVGIIGCLMGDWISFWLGWRFKKPLHRWSFMKKNKSLLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFIGPNLIGCLLWPPFYFLPGILAG
FT                   AAIDIPSDMQSGDFKWLLLATALLLWVGGWLCWRLWRSGKAAVDRLTAYFPRSRLLYLA
FT                   PLTLGIGVVALVVLVRHPLMPVYIDILRKVVGY"
FT   gene            complement(123410..124136)
FT                   /gene="yabJ"
FT                   /locus_tag="STM0106"
FT   CDS_pept        complement(123410..124117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="STM0106"
FT                   /product="putative ABC-transport protein"
FT                   /note="similar to E. coli putative ATP-binding component of
FT                   a transport system (AAC73177.1); Blastp hit to AAC73177.1
FT                   (232 aa), 84% identity in aa 1 - 230"
FT                   /db_xref="EnsemblGenomes-Gn:STM0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19070"
FT                   /db_xref="GOA:Q8ZRV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRV2"
FT                   /protein_id="AAL19070.1"
FT                   /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLAPASGTLLIAGDDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTLNA
FT                   SQREKRDAIAHQMGIESLMTRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELLSGQA
FT                   SASALLGIKSHIL"
FT   gene            complement(124101..125728)
FT                   /gene="yabK"
FT                   /locus_tag="STM0107"
FT   CDS_pept        complement(124101..125711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="STM0107"
FT                   /product="putative binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /note="similar to E. coli putative transport system
FT                   permease protein (AAC73178.1); Blastp hit to AAC73178.1
FT                   (536 aa), 89% identity in aa 1 - 536"
FT                   /db_xref="EnsemblGenomes-Gn:STM0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19071"
FT                   /db_xref="GOA:Q8ZRV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRV1"
FT                   /protein_id="AAL19071.1"
FT                   /translation="MATRRQPLIPGWLIPGLCAAALMITVSLAAFLALWLNAPSGAWST
FT                   IWRDSYLWHVVRFSFWQAFLSAVLSVVPAVFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQMLGLQWTFSPYGLQGILLAHVFFNLPMASRLLLQSLE
FT                   SIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIFQALSYDYDPARAAMLALIQMVCCLALVLLSQRLSKAIAPGMTLTQGWRDP
FT                   DDRLHSRLTDALLIVLALLLLLPPLVAVVVDGVNRSLPEVLAQPILWQAVWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRQRQQLFAGQTLELSGMLILAMPGIVLATGFFLLLNNSVG
FT                   LPESADGIVIFTNALMAIPYALKVLENPMRDITARYGMLCQSLGIEGWSRLKIVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFTLFTLIEKLPGRHAKTD"
FT   regulatory      complement(124131..124136)
FT                   /gene="yabJ"
FT                   /locus_tag="STM0106"
FT                   /note="putative RBS for yabJ; RegulonDB:STMS1H000486"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(125687..126680)
FT                   /gene="tbpA"
FT                   /locus_tag="STM0108"
FT   CDS_pept        complement(125687..126670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="STM0108"
FT                   /product="thiamine-binding periplasmic protein"
FT                   /note="similar to E. coli thiamin-binding periplasmic
FT                   protein (AAC73179.1); Blastp hit to AAC73179.1 (327 aa),
FT                   91% identity in aa 1 - 327"
FT                   /db_xref="EnsemblGenomes-Gn:STM0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19072"
FT                   /db_xref="GOA:Q7CR85"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR85"
FT                   /protein_id="AAL19072.1"
FT                   /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANE
FT                   AVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTP
FT                   GLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   IIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM
FT                   YPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
FT   regulatory      complement(125723..125728)
FT                   /gene="tbpA"
FT                   /locus_tag="STM0108"
FT                   /note="putative RBS for yabK; RegulonDB:STMS1H000487"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(126675..126680)
FT                   /gene="tbpA"
FT                   /locus_tag="STM0108"
FT                   /note="putative RBS for tbpA; RegulonDB:STMS1H000488"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(126848..128522)
FT                   /gene="yabN"
FT                   /locus_tag="STM0109"
FT   CDS_pept        complement(126848..128506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="STM0109"
FT                   /product="putative periplasmic binding protein of transport
FT                   system"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC73180.1); Blastp hit to AAC73180.1 (551 aa), 85%
FT                   identity in aa 1 - 551"
FT                   /db_xref="EnsemblGenomes-Gn:STM0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19073"
FT                   /db_xref="GOA:Q8ZRV0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRV0"
FT                   /protein_id="AAL19073.1"
FT                   /translation="MPSGRLQQQFIRLWQCCDGKTQDTTLNELADLLNCSRRHMRTLLN
FT                   TMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKSAVR
FT                   QMLISHLGRSFRQGRHILRVLYYRPMHNLLPGTALRRSETHIARQIFSSLTRVNEENGE
FT                   LEADIAHHWQQISPLLWRFYLRPGIHFHHGRELEMEDVISSLTRINTLPLYSHITKIDS
FT                   PTAWTLDIHLSQPDRWLPWLLGQVPAMILPRKWETLANFASHPIGTGPYAVRRNTPNQL
FT                   KILAFDDYFGYRALIDEVNVWVLPDISEEPACGLMLEGPIQGGEKAIESRLEEGCYYLL
FT                   FDARTPRGAHPQVREWVSHVLSPTNLLYHADEPLQQLWFPAYGLLPRWHHARPGPGEKP
FT                   AGLETLTLTFYREHIEHRVIARIMSALLAEHQVHLHIQEIDYDQWHAGEIESDIWLNSA
FT                   NFTLPLDFSLFAHLCEVPLLQNCIPRDWQGDAAQWRAGEMNLANWCQQLLANKAIVPLI
FT                   HHWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   regulatory      complement(128517..128522)
FT                   /gene="yabN"
FT                   /locus_tag="STM0109"
FT                   /note="putative RBS for yabN; RegulonDB:STMS1H000489"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(129057..129674)
FT                   /gene="leuD"
FT                   /locus_tag="STM0110"
FT   CDS_pept        complement(129057..129662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="STM0110"
FT                   /product="3-isopropylmalate isomerase (dehydratase),
FT                   subunit with LeuC"
FT                   /EC_number="4.2.1.33"
FT                   /note="3-isopropylmalate dehydratase small subunit.
FT                   (SW:LEUD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19074"
FT                   /db_xref="GOA:P04787"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04787"
FT                   /protein_id="AAL19074.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVTLSDAQVDELFALVKANPGIKFEVDLEAQVVKAGDKTYSFK
FT                   IDDFRRHCMLNGLDSIGLTLQHEDAIAAYENKQPAFMR"
FT   regulatory      complement(129669..129674)
FT                   /gene="leuD"
FT                   /locus_tag="STM0110"
FT                   /note="putative RBS for leuD; RegulonDB:STMS1H000490"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(129673..131086)
FT                   /gene="leuC"
FT                   /locus_tag="STM0111"
FT   CDS_pept        complement(129673..131073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="STM0111"
FT                   /product="3-isopropylmalate isomerase (dehydratase),
FT                   subunit with LeuD"
FT                   /EC_number="4.2.1.33"
FT                   /note="3-isopropylmalate dehydratase large subunit.
FT                   (SW:LEU2_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19075"
FT                   /db_xref="GOA:P15717"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15717"
FT                   /protein_id="AAL19075.1"
FT                   /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTVVALRA
FT                   EEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPLTDVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
FT   gene            complement(131076..132181)
FT                   /gene="leuB"
FT                   /locus_tag="STM0112"
FT   CDS_pept        complement(131076..132167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="STM0112"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="3-isopropylmalate dehydrogenase. (SW:LEU3_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19076"
FT                   /db_xref="GOA:P37412"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="PDB:1CNZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37412"
FT                   /protein_id="AAL19076.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMAQALKVMDAVRSRFDMRITTSHYDV
FT                   GGIAIDNHGHPLPKATVEGCEQADAILFGSVGGPKWENLPPESQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQSSILWREIVNDVAKTYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDANDAATAIEQAINRALEEGVRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   regulatory      complement(131081..131086)
FT                   /gene="leuB"
FT                   /locus_tag="STM0112"
FT                   /note="putative RBS for leuC; RegulonDB:STMS1H000491"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(132167..133758)
FT                   /gene="leuA"
FT                   /locus_tag="STM0113"
FT   CDS_pept        complement(132167..133738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="STM0113"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="similar to E. coli 2-isopropylmalate synthase
FT                   (AAC73185.1); Blastp hit to AAC73185.1 (523 aa), 92%
FT                   identity in aa 1 - 523"
FT                   /db_xref="EnsemblGenomes-Gn:STM0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19077"
FT                   /db_xref="GOA:P15875"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15875"
FT                   /protein_id="AAL19077.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAINAGA
FT                   RTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCALEEVIMAIKVRKDIMNVHTNINHHEIWRTSQTVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MEEMGYKDTDYNMDHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFSVQ
FT                   SGSSDIATASVKLACGEEIKAEAANGNGPVDAIYQAINRITGYDVELVKYDLNAKGQGK
FT                   DALGQVDIVVNHHGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNKE
FT                   NNKETV"
FT   regulatory      complement(132176..132181)
FT                   /gene="leuB"
FT                   /locus_tag="STM0112"
FT                   /note="putative RBS for leuB; RegulonDB:STMS1H000492"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(133753..133758)
FT                   /gene="leuA"
FT                   /locus_tag="STM0113"
FT                   /note="putative RBS for leuA; RegulonDB:STMS1H000493"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(133826..134057)
FT                   /gene="leuL"
FT                   /locus_tag="STM0114"
FT   CDS_pept        complement(133826..133912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="STM0114"
FT                   /product="leu operon leader peptide"
FT                   /note="leu operon leader peptide. (SW:LPL_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19078"
FT                   /db_xref="GOA:P03062"
FT                   /db_xref="InterPro:IPR012570"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03062"
FT                   /protein_id="AAL19078.1"
FT                   /translation="MSHIVRFTGLLLLNAFIVRGRPVGGIQH"
FT   regulatory      complement(133921..133926)
FT                   /gene="leuL"
FT                   /locus_tag="STM0114"
FT                   /note="putative RBS for leuL; RegulonDB:STMS1H000494"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(134030..134038)
FT                   /gene="leuL"
FT                   /locus_tag="STM0114"
FT                   /note="putative -10_signal for leuL;
FT                   RegulonDB:STMLTH004472"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(134049..134057)
FT                   /gene="leuL"
FT                   /locus_tag="STM0114"
FT                   /note="putative -35_signal for leuL;
FT                   RegulonDB:STMLTH004472"
FT                   /regulatory_class="minus_35_signal"
FT   gene            134557..135513
FT                   /gene="leuO"
FT                   /locus_tag="STM0115"
FT   regulatory      134557..134562
FT                   /gene="leuO"
FT                   /locus_tag="STM0115"
FT                   /note="putative RBS for leuO; RegulonDB:STMS1H000495"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        134569..135513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="STM0115"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="probable activator protein in leuabcd operon.
FT                   (SW:LEUO_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19079"
FT                   /db_xref="GOA:P46924"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46924"
FT                   /protein_id="AAL19079.1"
FT                   /translation="MPEVKTEKPHLLDMGKPQLRMVDLNLLTVFDAVMQEQNITRAAHT
FT                   LGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSG
FT                   FEPTSSERVFNLCVCSPLDNILTSQIYNRVEKIAPNIHVVFKASLNQNTEHQLRYQETE
FT                   FVISYEEFRRPEFTSVPLFKDEMVLVASRKHPRISGPLLEGDVYNEQHAVVSLDRYASF
FT                   SQPWYDTPDKQSSVAYQGMALISVLNVVSQTHLVAIAPRWLAEEFAESLDLQILPLPLK
FT                   LNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCKR"
FT   protein_bind    135700..135712
FT                   /bound_moiety="Lrp"
FT                   /note="putative binding site for Lrp, RegulonDB:
FT                   STMS1H000262"
FT   protein_bind    135720..135732
FT                   /bound_moiety="Lrp"
FT                   /note="putative binding site for Lrp, RegulonDB:
FT                   STMS1H000266"
FT   gene            135770..137559
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT   regulatory      135770..135778
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /note="putative -35_signal for ilvI;
FT                   RegulonDB:STMLTH004475"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    135773..135795
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /bound_moiety="Lrp"
FT                   /note="putative binding site for Lrp, RegulonDB:
FT                   STMS1H000252"
FT   regulatory      135797..135805
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /note="putative -10_signal for ilvI;
FT                   RegulonDB:STMLTH004475"
FT                   /regulatory_class="minus_10_signal"
FT   protein_bind    135836..135850
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /bound_moiety="Lrp"
FT                   /note="putative binding site for Lrp, RegulonDB:
FT                   STMS1H000253"
FT   regulatory      135884..135889
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /note="putative RBS for ilvI; RegulonDB:STMS1H000496"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        135898..137559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /product="valine sensitive acetolactate synthase III, large
FT                   subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="acetolactate synthase isozyme III large subunit.
FT                   (SW:ILVI_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19080"
FT                   /db_xref="GOA:P40811"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40811"
FT                   /protein_id="AAL19080.1"
FT                   /translation="MFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATG
FT                   DVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDAFQECDMVGISRPV
FT                   VKHSFLVKQTEDIPLVLKKAFWLAASGRPGPVVVDLPKDILNPAKKMPYAWPETVSMRS
FT                   YNPTTSGHKGQIKRALQTLASAKKPVVYVGGGAISAACYAPLRHIIETFNLPVVSSLMG
FT                   LGAFPATHRQSLGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATVLH
FT                   IDIDPTSISKTVNADIPVVGDARLVLEQMLELLAQDAPSQPQDDIRDWWQQIESWRARQ
FT                   CLKYDAESESIKPQAVIETLWRLTKGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGL
FT                   GTMGFGLPAALGVKMALPKEMVVCVTGDGSIQMNIQELSTALQYELPVLVLNLNNRYLG
FT                   MVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGLQINRPDELESKLSEALEHVRNN
FT                   RLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   protein_bind    135926..135938
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /bound_moiety="Lrp"
FT                   /note="putative binding site for Lrp, RegulonDB:
FT                   STMS1H000264"
FT   protein_bind    135928..135942
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /bound_moiety="Lrp"
FT                   /note="putative binding site for Lrp, RegulonDB:
FT                   STMS1H000257"
FT   gene            137550..138053
FT                   /gene="ilvH"
FT                   /locus_tag="STM0117"
FT   regulatory      137550..137555
FT                   /gene="ilvH"
FT                   /locus_tag="STM0117"
FT                   /note="putative RBS for ilvH; RegulonDB:STMS1H000497"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        137562..138053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="STM0117"
FT                   /product="acetolactate synthase III, small subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="acetolactate synthase isozyme III small subunit.
FT                   (SW:ILVH_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19081"
FT                   /db_xref="GOA:P21622"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21622"
FT                   /protein_id="AAL19081.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKRN
FT                   TEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
FT   gene            138326..139341
FT                   /gene="fruR"
FT                   /locus_tag="STM0118"
FT   regulatory      138326..138331
FT                   /gene="fruR"
FT                   /locus_tag="STM0118"
FT                   /note="putative RBS for fruR; RegulonDB:STMS1H000498"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        138337..139341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="STM0118"
FT                   /product="transcriptional repressor of fru operon and
FT                   others"
FT                   /note="GlaR/LacI family; fructose repressor (catabolite
FT                   repressor/activator). (SW:FRUR_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19082"
FT                   /db_xref="GOA:P0A2P8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2P8"
FT                   /protein_id="AAL19082.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDHELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS"
FT   gene            139931..140405
FT                   /gene="yabB"
FT                   /locus_tag="STM0119"
FT   regulatory      139931..139936
FT                   /gene="yabB"
FT                   /locus_tag="STM0119"
FT                   /note="putative RBS for yabB; RegulonDB:STMS1H000499"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139947..140405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="STM0119"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73192.1); Blastp hit to AAC73192.1 (152 aa), 94%
FT                   identity in aa 1 - 152"
FT                   /db_xref="EnsemblGenomes-Gn:STM0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19083"
FT                   /db_xref="GOA:Q8ZRU9"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU9"
FT                   /protein_id="AAL19083.1"
FT                   /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
FT   gene            140388..141348
FT                   /gene="yabC"
FT                   /locus_tag="STM0120"
FT   regulatory      140388..140393
FT                   /gene="yabB"
FT                   /locus_tag="STM0119"
FT                   /note="putative RBS for yabC; RegulonDB:STMS1H000500"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        140407..141348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="STM0120"
FT                   /product="putative S-adenosyl methionine adenyltransferase"
FT                   /note="similar to E. coli putative apolipoprotein
FT                   (AAC73193.1); Blastp hit to AAC73193.1 (313 aa), 95%
FT                   identity in aa 1 - 313"
FT                   /db_xref="EnsemblGenomes-Gn:STM0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19084"
FT                   /db_xref="GOA:Q8ZRU8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU8"
FT                   /protein_id="AAL19084.1"
FT                   /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLSVLAPGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKLGGREL
FT                   RALGKLMPGEKEVAENPRARSSVLRIAERTNA"
FT   gene            141333..141710
FT                   /gene="ftsL"
FT                   /locus_tag="STM0121"
FT   regulatory      141333..141338
FT                   /gene="ftsL"
FT                   /locus_tag="STM0121"
FT                   /note="putative RBS for ftsL; RegulonDB:STMS1H000501"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        141345..141710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="STM0121"
FT                   /product="cell division protein"
FT                   /note="ingrowth of wall at septum; similar to E. coli cell
FT                   division protein; ingrowth of wall at septum (AAC73194.1);
FT                   Blastp hit to AAC73194.1 (121 aa), 98% identity in aa 1 -
FT                   121"
FT                   /db_xref="EnsemblGenomes-Gn:STM0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19085"
FT                   /db_xref="GOA:Q7CR84"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR84"
FT                   /protein_id="AAL19085.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            141709..143492
FT                   /gene="ftsI"
FT                   /locus_tag="STM0122"
FT   regulatory      141709..141714
FT                   /gene="ftsI"
FT                   /locus_tag="STM0122"
FT                   /note="putative RBS for ftsI; RegulonDB:STMS1H000502"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        141726..143492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="STM0122"
FT                   /product="division specific transpeptidase"
FT                   /note="penicillin-binding protein 3; similar to E. coli
FT                   septum formation; penicillin-binding protein 3;
FT                   peptidoglycan synthetase (AAC73195.1); Blastp hit to
FT                   AAC73195.1 (588 aa), 96% identity in aa 1 - 588"
FT                   /db_xref="EnsemblGenomes-Gn:STM0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19086"
FT                   /db_xref="GOA:Q7CR83"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR83"
FT                   /protein_id="AAL19086.1"
FT                   /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWL
FT                   QIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERI
FT                   FPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEF
FT                   VINQGEGTGGRS"
FT   gene            143469..144966
FT                   /gene="murE"
FT                   /locus_tag="STM0123"
FT   regulatory      143469..143474
FT                   /gene="murE"
FT                   /locus_tag="STM0123"
FT                   /note="putative RBS for murE; RegulonDB:STMS1H000503"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143479..144966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="STM0123"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate
FT                   2,6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="similar to E. coli meso-diaminopimelate-adding
FT                   enzyme (AAC73196.1); Blastp hit to AAC73196.1 (495 aa), 91%
FT                   identity in aa 1 - 495"
FT                   /db_xref="EnsemblGenomes-Gn:STM0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19087"
FT                   /db_xref="GOA:Q8ZRU7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU7"
FT                   /protein_id="AAL19087.1"
FT                   /translation="MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHE
FT                   PSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHVLASLVAQGATFGAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYE
FT                   AAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEY
FT                   HDRGATIRFASSWGEGEIESRLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDN
FT                   DVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA"
FT   gene            144949..146321
FT                   /gene="murF"
FT                   /locus_tag="STM0124"
FT   regulatory      144949..144954
FT                   /gene="murF"
FT                   /locus_tag="STM0124"
FT                   /note="putative RBS for murF; RegulonDB:STMS1H000504"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        144963..146321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="STM0124"
FT                   /product="D-alanine:D-alanine-adding enzyme"
FT                   /note="similar to E. coli D-alanine:D-alanine-adding enzyme
FT                   (AAC73197.1); Blastp hit to AAC73197.1 (452 aa), 87%
FT                   identity in aa 1 - 452"
FT                   /db_xref="EnsemblGenomes-Gn:STM0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19088"
FT                   /db_xref="GOA:Q8ZRU6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRU6"
FT                   /protein_id="AAL19088.1"
FT                   /translation="MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALKG
FT                   ERFDAHDFADKAKANGAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNFNNDIGVPITLLRLNHDYDYAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMNADNN
FT                   DWLNWQSIIGDRLVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLPLPGRH
FT                   NIANALAAAALSMAVGATLTAIKAGLAALKAVPGRLFPIQLSENQLVLDDAYNANVGSM
FT                   TAAVQVLSEMPGYRVLVVGDMAELGAESEACHLQVGEAAKAAGIDRVLSTGKLSQAISH
FT                   ASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKGSC"
FT   gene            146301..147397
FT                   /gene="mraY"
FT                   /locus_tag="STM0125"
FT   regulatory      146301..146306
FT                   /gene="mraY"
FT                   /locus_tag="STM0125"
FT                   /note="putative RBS for mraY; RegulonDB:STMS1H000505"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146315..147397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="STM0125"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="similar to E. coli
FT                   phospho-N-acetylmuramoyl-pentapeptide transferase?
FT                   (AAC73198.1); Blastp hit to AAC73198.1 (360 aa), 97%
FT                   identity in aa 1 - 360"
FT                   /db_xref="EnsemblGenomes-Gn:STM0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19089"
FT                   /db_xref="GOA:Q8ZRU5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU5"
FT                   /protein_id="AAL19089.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   ARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTSIVISVLLWAYPSNPYVWCVLVV
FT                   LIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNM
FT                   NFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            147386..148716
FT                   /gene="murD"
FT                   /locus_tag="STM0126"
FT   regulatory      147386..147391
FT                   /gene="mraY"
FT                   /locus_tag="STM0125"
FT                   /note="putative RBS for murD; RegulonDB:STMS1H000506"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        147400..148716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="STM0126"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="similar to E. coli
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase
FT                   (AAC73199.1); Blastp hit to AAC73199.1 (438 aa), 92%
FT                   identity in aa 1 - 438"
FT                   /db_xref="EnsemblGenomes-Gn:STM0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19090"
FT                   /db_xref="GOA:Q8ZRU4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU4"
FT                   /protein_id="AAL19090.1"
FT                   /translation="MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLD
FT                   KLPQEVERHVGGLNDEWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELSSFQ
FT                   LETTSSLQAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVR
FT                   GADERCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLTRYLTGDRIRLYCFGRDGAQLAALRPEIAQQTETMEEAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKELG"
FT   gene            148702..149960
FT                   /gene="ftsW"
FT                   /locus_tag="STM0127"
FT   regulatory      148702..148707
FT                   /gene="ftsW"
FT                   /locus_tag="STM0127"
FT                   /note="putative RBS for ftsW; RegulonDB:STMS1H000507"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148716..149960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="STM0127"
FT                   /product="essential cell division gene"
FT                   /note="stablilzes FtsZ ring; cytoplasmic membrane required
FT                   for PBP2 expression; similar to E. coli cell division;
FT                   membrane protein involved in shape determination
FT                   (AAC73200.1); Blastp hit to AAC73200.1 (414 aa), 90%
FT                   identity in aa 1 - 414"
FT                   /db_xref="EnsemblGenomes-Gn:STM0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19091"
FT                   /db_xref="GOA:Q7CR82"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR82"
FT                   /protein_id="AAL19091.1"
FT                   /translation="MRLSLPRLRMPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMYD
FT                   RTLLWLTFGLAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRLPM
FT                   TFWQKYSTTMLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYLANY
FT                   LVRKVDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEIWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMFLLRIDY
FT                   ETRLEKAQAFTRGSR"
FT   gene            149947..151024
FT                   /gene="murG"
FT                   /locus_tag="STM0128"
FT   regulatory      149947..149952
FT                   /gene="murG"
FT                   /locus_tag="STM0128"
FT                   /note="putative RBS for murG; RegulonDB:STMS1H000508"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149957..151024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="STM0128"
FT                   /product="UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="similar to E. coli
FT                   UDP-N-acetylglucosamine:N-acetylmuramyl- (pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
FT                   (AAC73201.1); Blastp hit to AAC73201.1 (355 aa), 92%
FT                   identity in aa 1 - 354"
FT                   /db_xref="EnsemblGenomes-Gn:STM0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19092"
FT                   /db_xref="GOA:Q8ZRU3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU3"
FT                   /protein_id="AAL19092.1"
FT                   /translation="MSGQPKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIDIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKRFKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATTVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQVRLAGRDGPIRVLVVGGSQGARVLNQTMPQVAARLGDTVTIWHQSGKGA
FT                   QLTVEQAYAGAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPAIFVPF
FT                   QHKDRQQYWNALPLENAGAAKIFEQPQFTVEAVADTLAGWSREALLTMAERARAVSIPD
FT                   ATERVASEVSRVART"
FT   gene            151131..152618
FT                   /gene="murC"
FT                   /locus_tag="STM0129"
FT   regulatory      151131..151136
FT                   /gene="murC"
FT                   /locus_tag="STM0129"
FT                   /note="putative RBS for murC; RegulonDB:STMS1H000509"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        151143..152618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="STM0129"
FT                   /product="L-alanine adding enzyme"
FT                   /EC_number="6.3.2.8"
FT                   /note="similar to E. coli L-alanine adding enzyme,
FT                   UDP-N-acetyl-muramate:alanine ligase (AAC73202.1); Blastp
FT                   hit to AAC73202.1 (491 aa), 94% identity in aa 1 - 490"
FT                   /db_xref="EnsemblGenomes-Gn:STM0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19093"
FT                   /db_xref="GOA:Q8ZRU2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU2"
FT                   /protein_id="AAL19093.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLTSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQGMPD
FT                   LHVTLNAPGRHNALNAAAAVAVATEEGIADDAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRYTRTRDLYDDFANVLT
FT                   QVDALLMLDVYPAGEAPIPGADSRSLCRTIRNRGKIDPILVSDPAQVATMLAPVLTGND
FT                   LILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG"
FT   gene            152595..153531
FT                   /gene="ddlB"
FT                   /locus_tag="STM0130"
FT   regulatory      152595..152600
FT                   /gene="ddlB"
FT                   /locus_tag="STM0130"
FT                   /note="putative RBS for ddlB; RegulonDB:STMS1H000510"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        152611..153531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="STM0130"
FT                   /product="D-alanine-D-alanine ligase B"
FT                   /EC_number="6.3.2.4"
FT                   /note="affects cell division; similar to E. coli
FT                   D-alanine-D-alanine ligase B, affects cell division
FT                   (AAC73203.1); Blastp hit to AAC73203.1 (306 aa), 90%
FT                   identity in aa 1 - 306"
FT                   /db_xref="EnsemblGenomes-Gn:STM0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19094"
FT                   /db_xref="GOA:Q8ZRU1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU1"
FT                   /protein_id="AAL19094.1"
FT                   /translation="MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGINAHPVDPQEV
FT                   DVAQLKAMGFQKVFIALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRAEFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENAL
FT                   QGALSLAFQHDDEILIEKWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQ
FT                   YFCPAGLDASQEAALQSLVLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            153375..154363
FT                   /gene="ftsQ"
FT                   /locus_tag="STM0131"
FT   regulatory      153375..153383
FT                   /gene="ddlB"
FT                   /locus_tag="STM0130"
FT                   /note="putative -35_signal for ftsQ;
FT                   RegulonDB:STMLTH004481"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      153401..153409
FT                   /gene="ddlB"
FT                   /locus_tag="STM0130"
FT                   /note="putative -10_signal for ftsQ;
FT                   RegulonDB:STMLTH004481"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      153514..153519
FT                   /gene="ddlB"
FT                   /locus_tag="STM0130"
FT                   /note="putative RBS for ftsQ; RegulonDB:STMS1H000511"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153533..154363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="STM0131"
FT                   /product="cell division protein"
FT                   /note="ingrowth of wall at septum; similar to E. coli cell
FT                   division protein; ingrowth of wall at septum (AAC73204.1);
FT                   Blastp hit to AAC73204.1 (276 aa), 93% identity in aa 1 -
FT                   276"
FT                   /db_xref="EnsemblGenomes-Gn:STM0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19095"
FT                   /db_xref="GOA:Q7CR81"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR81"
FT                   /protein_id="AAL19095.1"
FT                   /translation="MSQAALNTRNSDEETPSSRRNNGTRLAGILFLLTVLCTVFVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPSDRIGKQVLPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNGIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQQQNQAQAEQQ"
FT   gene            154346..155622
FT                   /gene="ftsA"
FT                   /locus_tag="STM0132"
FT   regulatory      154346..154351
FT                   /gene="ftsQ"
FT                   /locus_tag="STM0131"
FT                   /note="putative RBS for ftsA; RegulonDB:STMS1H000513"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        154360..155622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="STM0132"
FT                   /product="ATP-binding cell division protein"
FT                   /note="septation process protein; complexes with FtsZ;
FT                   associated with junctions of inner and outer membranes;
FT                   similar to E. coli ATP-binding cell division protein,
FT                   septation process, complexes with FtsZ, associated with
FT                   junctions of inner and outer membranes (AAC73205.1); Blastp
FT                   hit to AAC73205.1 (420 aa), 99% identity in aa 1 - 420"
FT                   /db_xref="EnsemblGenomes-Gn:STM0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19096"
FT                   /db_xref="GOA:Q7CR80"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR80"
FT                   /protein_id="AAL19096.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            155670..156834
FT                   /gene="ftsZ"
FT                   /locus_tag="STM0133"
FT   regulatory      155670..155675
FT                   /gene="ftsZ"
FT                   /locus_tag="STM0133"
FT                   /note="putative RBS for ftsZ; RegulonDB:STMS1H000514"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        155683..156834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="STM0133"
FT                   /product="tubulin-like GTP-binding protein and GTPase"
FT                   /note="forms circumferential ring in cell division; similar
FT                   to E. coli cell division; forms circumferential ring;
FT                   tubulin-like GTP-binding protein and GTPase (AAC73206.1);
FT                   Blastp hit to AAC73206.1 (383 aa), 98% identity in aa 1 -
FT                   383"
FT                   /db_xref="EnsemblGenomes-Gn:STM0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19097"
FT                   /db_xref="GOA:Q8ZRU0"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRU0"
FT                   /protein_id="AAL19097.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQ
FT                   QHGMAPLTQEQKTVAKVVNDNTPQAAKEPDYLDIPAFLRKQAD"
FT   gene            156919..157852
FT                   /gene="lpxC"
FT                   /locus_tag="STM0134"
FT   regulatory      156919..156924
FT                   /gene="lpxC"
FT                   /locus_tag="STM0134"
FT                   /note="putative RBS for lpxC; RegulonDB:STMS1H000515"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        156935..157852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="STM0134"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="similar to E. coli UDP-3-O-acyl N-acetylglucosamine
FT                   deacetylase; lipid A biosynthesis (AAC73207.1); Blastp hit
FT                   to AAC73207.1 (305 aa), 98% identity in aa 1 - 305"
FT                   /db_xref="EnsemblGenomes-Gn:STM0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19098"
FT                   /db_xref="GOA:Q8ZRT9"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRT9"
FT                   /protein_id="AAL19098.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFRPYNGFTLDFTIDFNH
FT                   PAIDSSSQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEFVTFQDDAELPLAFKAPSTVLA"
FT   gene            158199..158627
FT                   /gene="yacA"
FT                   /locus_tag="STM0135"
FT   CDS_pept        158199..158627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacA"
FT                   /locus_tag="STM0135"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73208.1); Blastp hit to AAC73208.1 (195 aa), 69%
FT                   identity in aa 49 - 195"
FT                   /db_xref="EnsemblGenomes-Gn:STM0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19099"
FT                   /db_xref="GOA:Q8ZRT8"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRT8"
FT                   /protein_id="AAL19099.1"
FT                   /translation="MVAASFGLPALSNAAETNTPARTTASTASKVNFSHFALLEASNRR
FT                   PNFTVDYWHQHAIRTVIRHLSFAMAPQTLPVADAPSPLQAHHIALLNTLSAMLTQEGTP
FT                   PAIVRRLSLAYFAPQTAFSIPAWISQAQGIRAGPQRLS"
FT   gene            158689..161394
FT                   /gene="secA"
FT                   /locus_tag="STM0136"
FT   CDS_pept        158689..161394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="STM0136"
FT                   /product="preprotein translocase; secretion protein of IISP
FT                   family"
FT                   /note="similar to E. coli preprotein translocase; secretion
FT                   protein (AAC73209.1); Blastp hit to AAC73209.1 (901 aa),
FT                   95% identity in aa 1 - 900"
FT                   /db_xref="EnsemblGenomes-Gn:STM0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19100"
FT                   /db_xref="GOA:Q8ZRT7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRT7"
FT                   /protein_id="AAL19100.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELKA
FT                   KTNEFRARIEKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAGRGTDIMLGG
FT                   SWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLEMPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQLSHQDDDAAVAADLA
FT                   AQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
FT   gene            161532..161941
FT                   /gene="mutT"
FT                   /locus_tag="STM0137"
FT   regulatory      161532..161537
FT                   /gene="mutT"
FT                   /locus_tag="STM0137"
FT                   /note="putative RBS for mutT; RegulonDB:STMS1H000516"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161546..161941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="STM0137"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="prefers dGTP; similar to E. coli
FT                   7,8-dihydro-8-oxoguanine-triphosphatase, prefers dGTP,
FT                   causes AT-GC transversions (AAC73210.1); Blastp hit to
FT                   AAC73210.1 (129 aa), 80% identity in aa 1 - 128"
FT                   /db_xref="EnsemblGenomes-Gn:STM0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19101"
FT                   /db_xref="GOA:Q8ZRT6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT6"
FT                   /protein_id="AAL19101.1"
FT                   /translation="MKKLQIAVGIIRNPNDEIFITQRAADAHMANKLEFPGGKIEAGET
FT                   PEQALIRELQEEVGITPTQVTLFDTLEYQFPDRHITLWFWLVERWEGEPWGKEGQPGRW
FT                   IAQNALSTDDFPPANEPIIRKLRQFAL"
FT   gene            complement(162263..162465)
FT                   /gene="yacG"
FT                   /locus_tag="STM0138"
FT   CDS_pept        complement(162263..162454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="STM0138"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73212.1); Blastp hit to AAC73212.1 (65 aa), 87%
FT                   identity in aa 1 - 62"
FT                   /db_xref="EnsemblGenomes-Gn:STM0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19102"
FT                   /db_xref="GOA:P67481"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67481"
FT                   /protein_id="AAL19102.1"
FT                   /translation="MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIASSGDQSDSDDWSEER"
FT   regulatory      complement(162460..162465)
FT                   /gene="yacG"
FT                   /locus_tag="STM0138"
FT                   /note="putative RBS for yacG; RegulonDB:STMS1H000517"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(162464..163221)
FT                   /gene="yacF"
FT                   /locus_tag="STM0139"
FT   CDS_pept        complement(162464..163207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="STM0139"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73213.1); Blastp hit to AAC73213.1 (247 aa), 89%
FT                   identity in aa 1 - 247"
FT                   /db_xref="EnsemblGenomes-Gn:STM0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19103"
FT                   /db_xref="GOA:P67693"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="PDB:5GNP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67693"
FT                   /protein_id="AAL19103.1"
FT                   /translation="MHTQVLFEHPLNEKMRTWLRIEFLIQQLSINLPIADHAGALHFFR
FT                   NISDLLDVFERGEVRTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVLIS
FT                   APRIGQQLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLQQAQRDAQIESWLASLNP
FT                   LTQALTLVLDLIRNSAPFRKQTSLNGFYQDNGDDADLLRLMLTLDSQLYPQISGHKSRF
FT                   AIRFMPLDSENGLVPERLDFELACC"
FT   gene            complement(163207..163835)
FT                   /gene="yacE"
FT                   /locus_tag="STM0140"
FT   CDS_pept        complement(163207..163827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacE"
FT                   /locus_tag="STM0140"
FT                   /product="putative nucleotide kinase"
FT                   /note="similar to E. coli putative DNA repair protein
FT                   (AAC73214.1); Blastp hit to AAC73214.1 (206 aa), 88%
FT                   identity in aa 1 - 206"
FT                   /db_xref="EnsemblGenomes-Gn:STM0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19104"
FT                   /db_xref="GOA:P63828"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63828"
FT                   /protein_id="AAL19104.1"
FT                   /translation="MRYTVALTGGIGSGKSTVADAFADLGITVIDADIIARQMVEPGQP
FT                   ALNAIAEHFGSELIAADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQAT
FT                   SPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTMQRDDVTREHVEHILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHASYLKLASQFVSQEKP"
FT   regulatory      complement(163216..163221)
FT                   /gene="yacE"
FT                   /locus_tag="STM0140"
FT                   /note="putative RBS for yacF; RegulonDB:STMS1H000518"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(163830..163835)
FT                   /gene="yacE"
FT                   /locus_tag="STM0140"
FT                   /note="putative RBS for yacE; RegulonDB:STMS1H000519"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            164040..165096
FT                   /gene="guaC"
FT                   /locus_tag="STM0141"
FT   regulatory      164040..164045
FT                   /gene="guaC"
FT                   /locus_tag="STM0141"
FT                   /note="putative RBS for guaC; RegulonDB:STMS1H000520"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        164053..165096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="STM0141"
FT                   /product="GMP reductase"
FT                   /EC_number="1.7.1.7"
FT                   /note="similar to E. coli GMP reductase (AAC73215.1);
FT                   Blastp hit to AAC73215.1 (347 aa), 95% identity in aa 1 -
FT                   347"
FT                   /db_xref="EnsemblGenomes-Gn:STM0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19105"
FT                   /db_xref="GOA:Q8ZRT5"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRT5"
FT                   /protein_id="AAL19105.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQTWS
FT                   GVPIIAANMDTVGTFEMAQALAGFDILTAVHKHYTVEEWAAFINTASADVLKHVMVSTG
FT                   TSDADFEKTVQILALNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TMPGDVAKAFGGGADFVMLGGMLAGHEESGGSVVEENGEKFMLFYGMSSESAMNRHVGG
FT                   VAKYRAAEGKTVKLPLRGPVGNTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNSL"
FT   gene            complement(165127..166342)
FT                   /gene="hofC"
FT                   /locus_tag="STM0142"
FT   CDS_pept        complement(165127..166329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="STM0142"
FT                   /product="putative component in type IV pilin biogenesis"
FT                   /note="similar to E. coli putative integral membrane
FT                   protein involved in biogenesis of fimbriae, protein
FT                   transport, DNA uptake (AAC73217.1); Blastp hit to
FT                   AAC73217.1 (400 aa), 67% identity in aa 1 - 400"
FT                   /db_xref="EnsemblGenomes-Gn:STM0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19106"
FT                   /db_xref="GOA:Q8ZRT4"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT4"
FT                   /protein_id="AAL19106.1"
FT                   /translation="MSVKQLWRWQGVNDKGQLEQDVVWADNRLALIITLQHQRIMPLRI
FT                   KRMGVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAHEL
FT                   EQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVKKAL
FT                   RYPAIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGSAWGWLILF
FT                   LTMLVAIAHRRVKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSAGIPFL
FT                   QGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTGEASGSL
FT                   DIMLHNLARHHSETTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(166319..167715)
FT                   /gene="hofB"
FT                   /locus_tag="STM0143"
FT   CDS_pept        complement(166319..167704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="STM0143"
FT                   /product="putative integral membrane protein"
FT                   /note="involved in biogenesis of fimbriae (type IV pilin),
FT                   protein transport, DNA uptake; similar to E. coli putative
FT                   integral membrane protein involved in biogenesis of
FT                   fimbriae, protein transport, DNA uptake (AAC73218.1);
FT                   Blastp hit to AAC73218.1 (461 aa), 69% identity in aa 1 -
FT                   459"
FT                   /db_xref="EnsemblGenomes-Gn:STM0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19107"
FT                   /db_xref="GOA:Q8ZRT3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT3"
FT                   /protein_id="AAL19107.1"
FT                   /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFAT
FT                   QKQIDIVCWTRQQMENHRHKPDQAPSANAAKGGETAAQLLNQTLRSAMAKRASDIHLEP
FT                   GASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDLAGD
FT                   SISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTRNTPGINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNVLRALL
FT                   RQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQMGVARWMISS
FT                   ALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSAIPRWQASGCQHCYHGFYGRTALF
FT                   EVLTVTPALRQLIASGASAQALEAHLQQTGTGTLFENGCRAVEQGMTSFEEILCVLGMP
FT                   HER"
FT   regulatory      complement(166337..166342)
FT                   /gene="hofC"
FT                   /locus_tag="STM0142"
FT                   /note="putative RBS for hofC; RegulonDB:STMS1H000521"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(167710..167715)
FT                   /gene="hofB"
FT                   /locus_tag="STM0143"
FT                   /note="putative RBS for hofB; RegulonDB:STMS1H000522"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(167714..168163)
FT                   /gene="ppdD"
FT                   /locus_tag="STM0144"
FT   CDS_pept        complement(167714..168151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="STM0144"
FT                   /product="prelipin peptidase dependent protein"
FT                   /note="putative major component of type IV pilin; similar
FT                   to E. coli prelipin peptidase dependent protein
FT                   (AAC73219.1); Blastp hit to AAC73219.1 (146 aa), 89%
FT                   identity in aa 1 - 146"
FT                   /db_xref="EnsemblGenomes-Gn:STM0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19108"
FT                   /db_xref="GOA:Q7CR79"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR79"
FT                   /protein_id="AAL19108.1"
FT                   /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGTSTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSGLS
FT                   VIMTPAWDNANGITGWTRNCNIQSDSALQQACEDVFRFDAN"
FT   regulatory      complement(168158..168163)
FT                   /gene="ppdD"
FT                   /locus_tag="STM0144"
FT                   /note="putative RBS for ppdD; RegulonDB:STMS1H000523"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(168373..169279)
FT                   /gene="nadC"
FT                   /locus_tag="STM0145"
FT   CDS_pept        complement(168373..169266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="STM0145"
FT                   /product="quinolinate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.19"
FT                   /note="nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]. (SW:NADC_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19109"
FT                   /db_xref="GOA:P30012"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="PDB:1QAP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30012"
FT                   /protein_id="AAL19109.1"
FT                   /translation="MPPRRYNPDDRRDALLERINLDIPAAVAQALREDLGGEVDAGNDI
FT                   TAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTWHVDDGDAIHANQTV
FT                   FELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLLAGTQTQLLDTRKTLPGLRTAL
FT                   KYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHPDVPVEVEVENLDEL
FT                   DDALKAGADIIMLDNFNTDQMREAVKRVNGQARLEVSGNVTAETLREFAETGVDFISVG
FT                   ALTKHVRALDLSMRFC"
FT   regulatory      complement(169274..169279)
FT                   /gene="nadC"
FT                   /locus_tag="STM0145"
FT                   /note="putative RBS for nadC; RegulonDB:STMS1H000524"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            169341..169917
FT                   /gene="ampD"
FT                   /locus_tag="STM0146"
FT   regulatory      169341..169346
FT                   /gene="ampD"
FT                   /locus_tag="STM0146"
FT                   /note="putative RBS for ampD; RegulonDB:STMS1H000525"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        169354..169917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="STM0146"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /note="AMPD protein. (SW:AMPD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19110"
FT                   /db_xref="GOA:P0CL03"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CL03"
FT                   /protein_id="AAL19110.1"
FT                   /translation="MLPDKGWLVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRTLIASYPAIADNMTGHCNITPDRKT
FT                   DPGPAFDWPRFRALVALSSHKEMT"
FT   gene            169903..170768
FT                   /gene="ampE"
FT                   /locus_tag="STM0147"
FT   regulatory      169903..169908
FT                   /gene="ampD"
FT                   /locus_tag="STM0146"
FT                   /note="putative RBS for ampE; RegulonDB:STMS1H000526"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        169914..170768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="STM0147"
FT                   /product="putative transmembrane protein"
FT                   /note="similar to E. coli regulates ampC (AAC73222.1);
FT                   Blastp hit to AAC73222.1 (284 aa), 84% identity in aa 1 -
FT                   284"
FT                   /db_xref="EnsemblGenomes-Gn:STM0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19111"
FT                   /db_xref="GOA:H9L469"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:H9L469"
FT                   /protein_id="AAL19111.1"
FT                   /translation="MTLFTTLLVLIVERLFKLGEHWQLDHRLEALFRRITHFSMLRTMG
FT                   MTAIAMVVTFLLLQALKGLLFNVPTLVVWILLGVLCIGAGKVRVHYHAWLKAASRNDPH
FT                   PCEAMASELTLIHGVPPDCNEREFLRELQNALLWINFRFYLAPLFWFIVGGPWGPVTLV
FT                   GYAFLRAWQTWLARYQTPHQRLQSGIDAILHVLDWIPVRLAGVVYALLGHGEKALPAWF
FT                   ASLADLHTSQYQVLTRLAQFSLAREPHTDKVETPKAAVSMAKKASFVVVVIIALLTIYG
FT                   ALV"
FT   gene            complement(170860..171822)
FT                   /locus_tag="STM0148"
FT   CDS_pept        complement(170860..171810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0148"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein (gi|7688348)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19112"
FT                   /db_xref="GOA:H9L4B4"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:H9L4B4"
FT                   /protein_id="AAL19112.1"
FT                   /translation="MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRANSLE
FT                   GLRAADPVVVWRKPESGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRMFA
FT                   LECADADPLTGKWTEKGQIKTPFDTFALDATTFYHQGKQWYLWAQKAPDIAGNSNIYLA
FT                   ELENPWTIKGEPVRLSKPEYDWECRGFWVNEGPAVVVHGDKLFISYSASATDENYCMGL
FT                   LWINVNDDPRDPANWHKSPRPVFTTSYENRQYGPGHNSFTQTPEGENVLVYHARNYTEI
FT                   EGDPLYDPNRHTRLKRVRWDENGMPDFGVPPADTI"
FT   gene            complement(171810..173227)
FT                   /locus_tag="STM0149"
FT   CDS_pept        complement(171810..173216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0149"
FT                   /product="putative permease of the Na+:galactoside
FT                   symporter family"
FT                   /note="hypothetical protein (gi|7688349)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19113"
FT                   /db_xref="GOA:H9L454"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:H9L454"
FT                   /protein_id="AAL19113.1"
FT                   /translation="MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPA
FT                   LVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPDWG
FT                   YNSKVVYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATLLLS
FT                   LTLLPMVDWFGGGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDF
FT                   KDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIG
FT                   SMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPL
FT                   HWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKAQ
FT                   SASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNYRELSELQE
FT                   LNAAESVRKA"
FT   regulatory      complement(171817..171822)
FT                   /locus_tag="STM0148"
FT                   /note="putative RBS for STM0148; RegulonDB:STMS1H000527"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(173222..173227)
FT                   /locus_tag="STM0149"
FT                   /note="putative RBS for STM0149; RegulonDB:STMS1H000528"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(173380..174812)
FT                   /gene="aroP"
FT                   /locus_tag="STM0150"
FT   CDS_pept        complement(173380..174753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="STM0150"
FT                   /product="APC family aromatic amino acid transporter"
FT                   /note="similar to E. coli aromatic amino acid transport
FT                   protein (AAC73223.1); Blastp hit to AAC73223.1 (457 aa),
FT                   92% identity in aa 1 - 457"
FT                   /db_xref="EnsemblGenomes-Gn:STM0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19114"
FT                   /db_xref="GOA:P0CK99"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CK99"
FT                   /protein_id="AAL19114.1"
FT                   /translation="MMDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VIAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVS
FT                   AVVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGVKTRFPA
FT                   LFYPFGNVLCLLFMAAVLIIMLMTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKAH"
FT   regulatory      complement(174756..174761)
FT                   /gene="aroP"
FT                   /locus_tag="STM0150"
FT                   /note="putative RBS for aroP; RegulonDB:STMS1H000529"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(174788..174796)
FT                   /gene="aroP"
FT                   /locus_tag="STM0150"
FT                   /note="putative -10_signal for aroP;
FT                   RegulonDB:STMLTH004492"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(174804..174812)
FT                   /gene="aroP"
FT                   /locus_tag="STM0150"
FT                   /note="putative -35_signal for aroP;
FT                   RegulonDB:STMLTH004492"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    complement(174816..174838)
FT                   /bound_moiety="TyrR"
FT                   /note="putative binding site for TyrR, RegulonDB:
FT                   STMS1H000391"
FT   protein_bind    complement(174838..174862)
FT                   /bound_moiety="TyrR"
FT                   /note="putative binding site for TyrR, RegulonDB:
FT                   STMS1H000393"
FT   gene            175153..176080
FT                   /gene="pdhR"
FT                   /locus_tag="STM0151"
FT   regulatory      175153..175161
FT                   /gene="pdhR"
FT                   /locus_tag="STM0151"
FT                   /note="putative -35_signal for pdhR;
FT                   RegulonDB:STMLTH004493"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      175180..175188
FT                   /gene="pdhR"
FT                   /locus_tag="STM0151"
FT                   /note="putative -10_signal for pdhR;
FT                   RegulonDB:STMLTH004493"
FT                   /regulatory_class="minus_10_signal"
FT   protein_bind    175264..175286
FT                   /gene="pdhR"
FT                   /locus_tag="STM0151"
FT                   /bound_moiety="PdhR"
FT                   /note="putative binding site for PdhR, RegulonDB:
FT                   STMS1H000337"
FT   regulatory      175307..175312
FT                   /gene="pdhR"
FT                   /locus_tag="STM0151"
FT                   /note="putative RBS for pdhR; RegulonDB:STMS1H000530"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175316..176080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="STM0151"
FT                   /product="transcriptional repressor for pyruvate
FT                   dehydrogenase complex (GntR family)"
FT                   /note="similar to E. coli transcriptional regulator for
FT                   pyruvate dehydrogenase complex (AAC73224.1); Blastp hit to
FT                   AAC73224.1 (254 aa), 96% identity in aa 1 - 254"
FT                   /db_xref="EnsemblGenomes-Gn:STM0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19115"
FT                   /db_xref="GOA:P0CL10"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CL10"
FT                   /protein_id="AAL19115.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLETR
FT                   HALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEIMLDRSREESRRERALRRLEQRKN"
FT   gene            176227..178903
FT                   /gene="aceE"
FT                   /locus_tag="STM0152"
FT   regulatory      176227..176232
FT                   /gene="aceE"
FT                   /locus_tag="STM0152"
FT                   /note="putative RBS for aceE; RegulonDB:STMS1H000531"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176240..178903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="STM0152"
FT                   /product="pyruvate dehydrogenase, decarboxylase component"
FT                   /EC_number="1.2.4.1"
FT                   /note="similar to E. coli pyruvate dehydrogenase
FT                   (decarboxylase component) (AAC73225.1); Blastp hit to
FT                   AAC73225.1 (887 aa), 96% identity in aa 1 - 887"
FT                   /db_xref="EnsemblGenomes-Gn:STM0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19116"
FT                   /db_xref="GOA:Q8ZRT2"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT2"
FT                   /protein_id="AAL19116.1"
FT                   /translation="MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEAR
FT                   KGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQEQM
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIVNELEG
FT                   IFAGAGWNVIKVMWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGD
FT                   TAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYITFPEGSEEHKYLHERRQA
FT                   LHGYLPSRQPNFTEKLELPQLSDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   ASWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWQAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPAGAEEGIRKGIYKLETLEGSKGKVQLLGSGSILRHVREAAQILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   ITKFNIDADKVNPRLA"
FT   gene            178904..180807
FT                   /gene="aceF"
FT                   /locus_tag="STM0153"
FT   regulatory      178904..178909
FT                   /gene="aceF"
FT                   /locus_tag="STM0153"
FT                   /note="putative RBS for aceF; RegulonDB:STMS1H000532"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        178918..180807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="STM0153"
FT                   /product="pyruvate dehydrogenase"
FT                   /EC_number="2.3.1.12"
FT                   /note="dihydrolipoyltransacetylase component; similar to E.
FT                   coli pyruvate dehydrogenase (dihydrolipoyltransacetylase
FT                   component) (AAC73226.1); Blastp hit to AAC73226.1 (630 aa),
FT                   93% identity in aa 1 - 630"
FT                   /db_xref="EnsemblGenomes-Gn:STM0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19117"
FT                   /db_xref="GOA:Q8ZRT1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT1"
FT                   /protein_id="AAL19117.2"
FT                   /translation="MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGVVKEIKVSVGDKTETGALIMIFDSAEGAADAAPAKAEEKKEAAPAAAPAAAA
FT                   AKDVHVPDIGSDEVEVTEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVT
FT                   EVMVKVGDKVTAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFG
FT                   VNLAKVKGTGRKGRILREDVQAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEV
FT                   EEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTP
FT                   VVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKS
FT                   VTELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSK
FT                   SAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDIRRLVM"
FT   protein_bind    180798..180814
FT                   /bound_moiety="FIS"
FT                   /note="putative binding site for FIS, RegulonDB:
FT                   STMS1H000144"
FT   gene            180898..182431
FT                   /gene="lpdA"
FT                   /locus_tag="STM0154"
FT   regulatory      180898..180906
FT                   /gene="lpdA"
FT                   /locus_tag="STM0154"
FT                   /note="putative -35_signal for lpdA;
FT                   RegulonDB:STMLTH004495"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      180922..180930
FT                   /gene="lpdA"
FT                   /locus_tag="STM0154"
FT                   /note="putative -10_signal for lpdA;
FT                   RegulonDB:STMLTH004495"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      180998..181003
FT                   /gene="lpdA"
FT                   /locus_tag="STM0154"
FT                   /note="putative RBS for lpdA; RegulonDB:STMS1H000533"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        181007..182431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="STM0154"
FT                   /product="lipoamide dehydrogenase (NADH)"
FT                   /EC_number="1.8.1.4"
FT                   /note="component of 2-oxodehydrogenase and pyruvate
FT                   complexes; L protein of glycine cleavage complex second
FT                   part; similar to E. coli lipoamide dehydrogenase (NADH);
FT                   component of 2-oxodehydrogenase and pyruvate complexes;
FT                   L-protein of glycine cleavage complex (AAC73227.1); Blastp
FT                   hit to AAC73227.1 (474 aa), 98% identity in aa 1 - 474"
FT                   /db_xref="EnsemblGenomes-Gn:STM0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19118"
FT                   /db_xref="GOA:Q8ZRT0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT0"
FT                   /protein_id="AAL19118.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRVW
FT                   DSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
FT   gene            182714..183004
FT                   /locus_tag="STM0155"
FT   regulatory      182714..182719
FT                   /locus_tag="STM0155"
FT                   /note="putative RBS for STM0155; RegulonDB:STMS1H000534"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        182720..183004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0155"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19119"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR75"
FT                   /protein_id="AAL19119.1"
FT                   /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGE
FT                   DLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
FT   gene            complement(183042..183840)
FT                   /locus_tag="STM0156"
FT   CDS_pept        complement(183042..183833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0156"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19120"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR74"
FT                   /protein_id="AAL19120.1"
FT                   /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQL
FT                   TALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPMVK
FT                   ETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISSEGQ
FT                   KDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHYGETG
FT                   VMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
FT   regulatory      complement(183835..183840)
FT                   /locus_tag="STM0156"
FT                   /note="putative RBS for STM0156; RegulonDB:STMS1H000535"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(183846..185488)
FT                   /gene="yacH"
FT                   /locus_tag="STM0157"
FT   CDS_pept        complement(183846..185468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="STM0157"
FT                   /product="putative outer membrane protein"
FT                   /note="similar to E. coli putative membrane protein
FT                   (AAC73228.1); Blastp hit to AAC73228.1 (617 aa), 29%
FT                   identity in aa 3 - 523"
FT                   /db_xref="EnsemblGenomes-Gn:STM0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19121"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRS9"
FT                   /protein_id="AAL19121.2"
FT                   /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAAAPASEP
FT                   TQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDNPT
FT                   LQGDAAIQAVASQPWDPSVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDAVQR
FT                   LRLLAQQTGSLKSTPQQTVTSVPKSSASTAVTTTTTTSASTPATPSTVIKIEPANPQVV
FT                   YVPNYNPATVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALFSSIDWD
FT                   DDDHHHHDDDHHDDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGWQHNPAWR
FT                   NGVPYPNNTVAQRFHPTNVSGGLSATQQAPVSRDSQRQAAMTQFQQRSHTANASLPAPG
FT                   TRDAQRKAASQQLNQIAQRNNYRGYDGTQNSSRREAAQQTLNKSTTQQHRSELKAKAQQ
FT                   HPVSQQQRDTARQRIESSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQLRGLESRRGS
FT                   HLNTEQRAAAREHFSEHHEFHRR"
FT   regulatory      complement(185483..185488)
FT                   /gene="yacH"
FT                   /locus_tag="STM0157"
FT                   /note="putative RBS for yacH; RegulonDB:STMS1H000536"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            185843..188454
FT                   /gene="acnB"
FT                   /locus_tag="STM0158"
FT   regulatory      185843..185848
FT                   /gene="acnB"
FT                   /locus_tag="STM0158"
FT                   /note="putative RBS for acnB; RegulonDB:STMS1H000537"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185857..188454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="STM0158"
FT                   /product="aconitate hydratase 2"
FT                   /EC_number="4.2.1.3"
FT                   /note="similar to E. coli aconitate hydrase B (AAC73229.1);
FT                   Blastp hit to AAC73229.1 (865 aa), 96% identity in aa 1 -
FT                   865"
FT                   /db_xref="EnsemblGenomes-Gn:STM0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19122"
FT                   /db_xref="GOA:Q8ZRS8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS8"
FT                   /protein_id="AAL19122.1"
FT                   /translation="MLEEYRKHVAERAAQGIVPKPLDATQMAALVELLKTPPVGEEEFL
FT                   LDLLINRVPPGVDEAAYVKAGFLAAVAKGDTTSPLVSPEKAIELLGTMQGGYNIHPLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLSRPPLA
FT                   EKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAQAMLKNAREGIEPDQPGVVGPIKQ
FT                   IEALQKKGYPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESSRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVTTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIVEYLTSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLADPQLLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARLL
FT                   SDVQGEKIDEVFIGSCMTNIGHFRAAGKLLDNHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFDQLSQYTEKADGVIFQTAV"
FT   gene            complement(188515..189363)
FT                   /locus_tag="STM0159"
FT   CDS_pept        complement(188515..189357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0159"
FT                   /product="putative restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:STM0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19123"
FT                   /db_xref="GOA:Q8ZRS7"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRS7"
FT                   /protein_id="AAL19123.1"
FT                   /translation="MGTLKLIQYPSQLLSLTISDIINKQNLSQLIQKSKKDDSENWEGK
FT                   DWIIKNTPQQGINWIGEHPNIKAVIIKTKDGSYADDGWKNNEKTIYSYSFKAAKGIINF
FT                   NDSANRVLINQPISNYPILLFTDSSNKWEFQGCFKIIDILEKAVILEKMISFPSLNDKN
FT                   SDNDDVILYKNEHTEGKIKYITHMLSERNRKIIDEIKDNSQWVCDICEIKFLDKYGKNY
FT                   IEAHHKIPIHTFTGEHRILKTDFALLCPNCHKAVHIYLREENLQYEEAKIKIRNILKR"
FT   regulatory      complement(189358..189363)
FT                   /locus_tag="STM0159"
FT                   /note="putative RBS for STM0159; RegulonDB:STMS1H000538"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            189591..189965
FT                   /gene="yacL"
FT                   /locus_tag="STM0160"
FT   regulatory      189591..189596
FT                   /gene="yacL"
FT                   /locus_tag="STM0160"
FT                   /note="putative RBS for yacL; RegulonDB:STMS1H000539"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        189603..189965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="STM0160"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73230.1); Blastp hit to AAC73230.1 (136 aa), 85%
FT                   identity in aa 17 - 135"
FT                   /db_xref="EnsemblGenomes-Gn:STM0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19124"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS6"
FT                   /protein_id="AAL19124.1"
FT                   /translation="MDYEFLRDVTGGVKVRMSMGHEVVGHWFNEEVKDNLSLLDEVEQA
FT                   ARTVKGSERSWQRAGHEYTIWMDGEEVMIRANQLDFSGDEMEEGMSYYDEESLSLCGME
FT                   DFLRVVAAYREFVSKA"
FT   gene            190186..191153
FT                   /gene="kdgT"
FT                   /locus_tag="STM0161"
FT   regulatory      190186..190191
FT                   /gene="kdgT"
FT                   /locus_tag="STM0161"
FT                   /note="putative RBS for kdgT; RegulonDB:STMS1H000540"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        190200..191153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="STM0161"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="similar to E. coli 2-keto-3-deoxy-D-gluconate
FT                   transport system (AAC76891.1); Blastp hit to AAC76891.1
FT                   (330 aa), 45% identity in aa 4 - 324"
FT                   /db_xref="EnsemblGenomes-Gn:STM0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19125"
FT                   /db_xref="GOA:P65207"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65207"
FT                   /protein_id="AAL19125.1"
FT                   /translation="MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALEIGGFTTALFKN
FT                   GAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIGIGLGVEHLFGAEGIFGL
FT                   SGVAIIAAMSNSNGGLYAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMANIPI
FT                   MALVAVLVPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGGLAGI
FT                   LLGVLTTFVGGFFNIRADRLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAEVAAAA
FT                   APLIAASVITTAILTPVLTSWVAKKQARQASLEKNA"
FT   gene            191145..192421
FT                   /locus_tag="STM0162"
FT   regulatory      191145..191150
FT                   /gene="kdgT"
FT                   /locus_tag="STM0161"
FT                   /note="putative RBS for STM0162; RegulonDB:STMS1H000541"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191150..192421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0162"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC75779.1); Blastp hit to AAC75779.1 (388 aa), 28%
FT                   identity in aa 2 - 384"
FT                   /db_xref="EnsemblGenomes-Gn:STM0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19126"
FT                   /db_xref="GOA:Q8ZRS5"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS5"
FT                   /protein_id="AAL19126.1"
FT                   /translation="MKMIVIADDFTGSNDTGVQLAKKGARTEVMLSASQKPSRRADVLV
FT                   INTESRAMPADQAASAVYAALSPWCETSPAPLVYKKIDSTFRGNIGAEVTAAMRASQRK
FT                   LAVIAAAIPAAGRTTLEGKCLVNGVPLLETEFASDPKTPIVSSRIAEIVALQSEIPVYE
FT                   VFLQDVRRGGLSALLTAYAAEGEGIIVVDAVEERDLTLIAQAACEQPSMPLLVGAAGLA
FT                   NALPVELFMQDRQRLPVLVVAGSMSEATRRQVDNALCRGRAEVVDIDAARMVSDSAEQE
FT                   IASVVEQACALLSQHRHTILRTSRRAEDRQLIDALCEKSAMSRQQLGERLSQRLGVVTL
FT                   NIIEQARIGGLFLTGGDIATAVAGALGAEGYRIQSEVAPCIPCGTFVNSEIDDLPVITK
FT                   AGGFGSDSTLCDALYYIEEMYCGD"
FT   gene            192403..193394
FT                   /locus_tag="STM0163"
FT   regulatory      192403..192408
FT                   /locus_tag="STM0163"
FT                   /note="putative RBS for STM0163; RegulonDB:STMS1H000542"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192411..193394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0163"
FT                   /product="pyridoxine phosphate biosynthetic protein"
FT                   /note="similar to E. coli pyridoxine biosynthesis
FT                   (AAC73163.1); Blastp hit to AAC73163.1 (329 aa), 37%
FT                   identity in aa 2 - 324"
FT                   /db_xref="EnsemblGenomes-Gn:STM0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19127"
FT                   /db_xref="GOA:P58718"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="PDB:2HI1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58718"
FT                   /protein_id="AAL19127.1"
FT                   /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATLK
FT                   RLQAKGITPNVELRAIERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYRCV
FT                   KRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDKLKV
FT                   IHVSTHIALRKFLDTLSTARVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENGLFGD
FT                   EETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFY
FT                   DGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
FT   gene            193399..194171
FT                   /locus_tag="STM0164"
FT   regulatory      193399..193404
FT                   /locus_tag="STM0164"
FT                   /note="putative RBS for STM0164; RegulonDB:STMS1H000543"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193404..194171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0164"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="similar to E. coli putative DEOR-type
FT                   transcriptional regulator (AAC75777.1); Blastp hit to
FT                   AAC75777.1 (265 aa), 34% identity in aa 16 - 265"
FT                   /db_xref="EnsemblGenomes-Gn:STM0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19128"
FT                   /db_xref="GOA:Q7CR73"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR73"
FT                   /protein_id="AAL19128.1"
FT                   /translation="MKGQHRLDLIVAYLKNHTLVTVEQLVEAVDASPATIRRDLIKLDE
FT                   QGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARVAASLVNAGDAVVLDAGTTM
FT                   MELAKCLTHLPLRVITVDLHIALFLAEFRQIEVTIVGGRIDDSSQSCIGEHGRKLLRSV
FT                   YPNIAFMSCNSWGVKTGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGAHSLFNVVPL
FT                   ERFNDVITDVNLPPSAQVELKGRAFALTLVQPE"
FT   gene            complement(194201..195011)
FT                   /gene="speD"
FT                   /locus_tag="STM0165"
FT   CDS_pept        complement(194201..194995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="STM0165"
FT                   /product="S-adenosylmethionine decarboxylase, proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /note="similar to E. coli S-adenosylmethionine
FT                   decarboxylase (AAC73231.1); Blastp hit to AAC73231.1 (264
FT                   aa), 96% identity in aa 1 - 264"
FT                   /db_xref="EnsemblGenomes-Gn:STM0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19129"
FT                   /db_xref="GOA:Q8ZRS4"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS4"
FT                   /protein_id="AAL19129.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPIDPKLIDQTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV"
FT   regulatory      complement(195006..195011)
FT                   /gene="speD"
FT                   /locus_tag="STM0165"
FT                   /note="putative RBS for speD; RegulonDB:STMS1H000544"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(195016..195889)
FT                   /gene="speE"
FT                   /locus_tag="STM0166"
FT   CDS_pept        complement(195016..195876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="STM0166"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="similar to E. coli spermidine synthase = putrescine
FT                   aminopropyltransferase (AAC73232.1); Blastp hit to
FT                   AAC73232.1 (288 aa), 94% identity in aa 1 - 286"
FT                   /db_xref="EnsemblGenomes-Gn:STM0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19130"
FT                   /db_xref="GOA:Q8ZRS3"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS3"
FT                   /protein_id="AAL19130.1"
FT                   /translation="MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSSEIIQARFHAAGLKCRYYNPAIHAAAFALPQYLHD
FT                   ALSAQ"
FT   regulatory      complement(195884..195889)
FT                   /gene="speE"
FT                   /locus_tag="STM0166"
FT                   /note="putative RBS for speE; RegulonDB:STMS1H000545"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(195983..196342)
FT                   /gene="yacC"
FT                   /locus_tag="STM0167"
FT   CDS_pept        complement(195983..196330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="STM0167"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73233.1); Blastp hit to AAC73233.1 (156 aa), 95%
FT                   identity in aa 42 - 156"
FT                   /db_xref="EnsemblGenomes-Gn:STM0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19131"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR72"
FT                   /protein_id="AAL19131.1"
FT                   /translation="MKTFFRPVLFGSLMALCANSYALTESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNSQIRRALVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
FT   regulatory      complement(196337..196342)
FT                   /gene="yacC"
FT                   /locus_tag="STM0167"
FT                   /note="putative RBS for yacC; RegulonDB:STMS1H000546"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            196520..198142
FT                   /gene="cueO"
FT                   /locus_tag="STM0168"
FT   regulatory      196520..196525
FT                   /gene="cueO"
FT                   /locus_tag="STM0168"
FT                   /note="putative RBS for cueO; RegulonDB:STMS1H000547"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196532..198142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="STM0168"
FT                   /product="putative multicopper oxidase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73234.1); Blastp hit to AAC73234.1 (516 aa), 80%
FT                   identity in aa 1 - 516"
FT                   /db_xref="EnsemblGenomes-Gn:STM0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19132"
FT                   /db_xref="GOA:Q8ZRS2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS2"
FT                   /protein_id="AAL19132.1"
FT                   /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADAS
FT                   NRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHWHG
FT                   LEIPGIVDGGPQGIIPAGGTRTVTFTPEQRAATCWIHPHKHGKTGRQVAMGLAGLVLIE
FT                   DDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNGAIYP
FT                   QHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLLMGERF
FT                   EVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTLTTMPAL
FT                   PSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGNMGHGEMD
FT                   HGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHERWVISGVG
FT                   DMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDHDAPKEHAYM
FT                   AHCHLLEHEDTGMMLGFTV"
FT   gene            complement(198220..200623)
FT                   /gene="gcd"
FT                   /locus_tag="STM0169"
FT   CDS_pept        complement(198220..200610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="STM0169"
FT                   /product="glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /note="similar to E. coli glucose dehydrogenase
FT                   (AAC73235.1); Blastp hit to AAC73235.1 (796 aa), 92%
FT                   identity in aa 1 - 796"
FT                   /db_xref="EnsemblGenomes-Gn:STM0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19133"
FT                   /db_xref="GOA:Q8ZRS1"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRS1"
FT                   /protein_id="AAL19133.1"
FT                   /translation="MAENNARSPRLLVTLTALFAALCGLYLLIGGVWLVAIGGSWYYPI
FT                   AGLVMLVVAGLLWRSKRAALWLYAALLLATMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWHRLVVPSSGAVAALVVALLISGGILTWAGFNDPQEINGTLRADATPAATSSSI
FT                   ADEDWPAYGRNQEGQRYSPLKQITADNVHQLKEAWVFRTGDLKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHFDPQLKTDSSFQHVTCRGVSYHEAKADTASPE
FT                   VIADCPRRIILPVNDGRLFAVNAETGKLCETFANKGVLNLQTNMPDTTPGLYEPTSPPI
FT                   ITDKTIVIAGSVTDNFSTRETSGVIRGFDVNSGKLMWAFDPGAKDPNAIPADEHAFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVDGTTVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVAKTQPFSDLTFRPKKDLSGADMWGATMFDQLVCRVMFHQLRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPDRQVAIANPMALPFVSKLIPRGPGNPMEPPKDAKGT
FT                   GTEAGIQPQYGVPFGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEIVWKKRIGTPRDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVVSAGGHGSFGTKMGDYIVAYALPDDAK"
FT   regulatory      complement(200618..200623)
FT                   /gene="gcd"
FT                   /locus_tag="STM0169"
FT                   /note="putative RBS for gcd; RegulonDB:STMS1H000548"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            200804..201352
FT                   /gene="hpt"
FT                   /locus_tag="STM0170"
FT   regulatory      200804..200809
FT                   /gene="hpt"
FT                   /locus_tag="STM0170"
FT                   /note="putative RBS for hpt; RegulonDB:STMS1H000549"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        200816..201352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="STM0170"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="hypoxanthine phosphoribosyltransferase.
FT                   (SW:HPRT_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19134"
FT                   /db_xref="GOA:O33799"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="PDB:1J7J"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33799"
FT                   /protein_id="AAL19134.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGLLRGS
FT                   FMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYVGKVVLLDE"
FT   gene            complement(201410..202088)
FT                   /gene="yadF"
FT                   /locus_tag="STM0171"
FT   CDS_pept        complement(201410..202072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadF"
FT                   /locus_tag="STM0171"
FT                   /product="putative carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="similar to E. coli putative carbonic anhdrase
FT                   (AAC73237.1); Blastp hit to AAC73237.1 (220 aa), 90%
FT                   identity in aa 1 - 220"
FT                   /db_xref="EnsemblGenomes-Gn:STM0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19135"
FT                   /db_xref="GOA:Q8ZRS0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="PDB:3QY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRS0"
FT                   /protein_id="AAL19135.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHSGCGGI
FT                   KAAVENPELGLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGHSTI
FT                   MQSAWKRGQNVTIHGWAYSINDGLLRDLDVTATNRETLENGYHKGISALSLKYIPHQ"
FT   regulatory      complement(202083..202088)
FT                   /gene="yadF"
FT                   /locus_tag="STM0171"
FT                   /note="putative RBS for yadF; RegulonDB:STMS1H000550"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            202173..203107
FT                   /gene="yadG"
FT                   /locus_tag="STM0172"
FT   regulatory      202173..202178
FT                   /gene="yadG"
FT                   /locus_tag="STM0172"
FT                   /note="putative RBS for yadG; RegulonDB:STMS1H000551"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        202181..203107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="STM0172"
FT                   /product="putative ABC-type multidrug transport system,
FT                   ATPase component"
FT                   /note="similar to E. coli putative ATP-binding component of
FT                   a transport system (AAC73238.1); Blastp hit to AAC73238.1
FT                   (308 aa), 95% identity in aa 1 - 308"
FT                   /db_xref="EnsemblGenomes-Gn:STM0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19136"
FT                   /db_xref="GOA:Q8ZRR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR9"
FT                   /protein_id="AAL19136.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVNVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVEHKEAVLRSEKYLKQLDLWEKRHERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNAKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKN
FT                   LLSKLKSETFILDLAPKSPLPKLTGYQYRLVDTSTLEVEVLREQGVNSVFSQLSEQGVQ
FT                   VLSMRNKANRLEELFVSLVHEKQGDRA"
FT   gene            203091..203874
FT                   /gene="yadH"
FT                   /locus_tag="STM0173"
FT   regulatory      203091..203096
FT                   /gene="yadH"
FT                   /locus_tag="STM0173"
FT                   /note="putative RBS for yadH; RegulonDB:STMS1H000552"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203104..203874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="STM0173"
FT                   /product="putative transport protein"
FT                   /note="ABC superfamily (membrane); similar to E. coli orf,
FT                   hypothetical protein (AAC73239.1); Blastp hit to AAC73239.1
FT                   (256 aa), 94% identity in aa 1 - 256"
FT                   /db_xref="EnsemblGenomes-Gn:STM0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19137"
FT                   /db_xref="GOA:Q8ZRR8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR8"
FT                   /protein_id="AAL19137.1"
FT                   /translation="MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIH
FT                   DVPLVTTFGVLVIFIAAFYLLCWSLIQRGRGLRS"
FT   gene            complement(203991..205077)
FT                   /gene="stiH"
FT                   /locus_tag="STM0174"
FT   CDS_pept        complement(203991..205070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stiH"
FT                   /locus_tag="STM0174"
FT                   /product="putative fimbriae"
FT                   /note="lpfd protein precursor (SW:LPFD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19138"
FT                   /db_xref="GOA:Q8ZRR7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR7"
FT                   /protein_id="AAL19138.1"
FT                   /translation="MKNLWMLLALSLFSGHALADGTMGNGSGWCQPTSGTHNFFFPLDQ
FT                   TITDTDENQAGKIVKESWSVGGEYSARCDCDNKDYQGVNYFTATTGDLTQKGTYSEAGS
FT                   NGQQMDFYVLVAGKLEIGTETYIVGNLKQYIPVPFSAISNQDPTAGGCTGADINKMSAG
FT                   NKGNVRIYITHPLVGEITIPETTIMNLYLSKTPGSSGDNIPPSVPPMAHVTMSGTITVP
FT                   QSCSINAGQVIEVRLPDIEGKDIRHLGDSPQNSHVTTQVNFTCSNVADGTNLSMSLNGA
FT                   TDPHNPDYLKTDNENLGIRISDKYDNTIVPGGSAELPIEDYTDGRGSTEFTAAPVNTTG
FT                   HVPHTGEYQATATLEIQIR"
FT   regulatory      complement(205072..205077)
FT                   /gene="stiH"
FT                   /locus_tag="STM0174"
FT                   /note="putative RBS for stiH; RegulonDB:STMS1H000553"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(205079..207631)
FT                   /gene="stiC"
FT                   /locus_tag="STM0175"
FT   CDS_pept        complement(205079..207625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stiC"
FT                   /locus_tag="STM0175"
FT                   /product="putative fimbrial usher"
FT                   /note="similar to E. coli putative outer membrane protein
FT                   (AAC76178.1); Blastp hit to AAC76178.1 (838 aa), 39%
FT                   identity in aa 20 - 558, 34% identity in aa 493 - 837"
FT                   /db_xref="EnsemblGenomes-Gn:STM0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19139"
FT                   /db_xref="GOA:Q8ZRR6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR6"
FT                   /protein_id="AAL19139.1"
FT                   /translation="MRKRQHRVFYLSRCAVCIALGSTFTHVAWARDYFNPAFIENHGQA
FT                   NRTSVDLSTFDNDKSQLPGTYYVTININKTEIGARNVDFQLATLSDGQQALQGCLRLQE
FT                   LKDNGVKTDLFPTLESEKGCVDLSVIPGASQRFDFQQQALSVSIPQLYIANNARGYVPP
FT                   EKWQEGITALMLNYSFSGYKEYGSSEDSDDAESKYLALQPGFNLGPWRFRNYSNWSSNN
FT                   GENGSWNSVYNYLQRDIIALKSQFTAGDSNTPSDVFDSVPFRGLQLTSDDQMQPNSQRG
FT                   YAPTIRGIARSNAQVIVRQNGYIAYQTAVSPGEFEINDMFPTGSNGDYDVTVKEADGSE
FT                   QHFIVPYSSLPILQRTGRAKYSVTVGKYRDYNNHALDDFGQATLLYGLPWGITLYGGSQ
FT                   IAGDKYQSVAFGVGQNMQMLGAISLDGIWSHAKFDDGRKEIGQSWHVRYSKGVVSTGTT
FT                   FSLAGYRYASENYNSLSEVINPDDDFYDNYGKRHNRFEASVNQQISNTLGSLTLSWVKE
FT                   DYWHSAQQMESLSASYNNSWGPVSYTLSYSYNKNTYQYRSDNDDDDNDDDRYNQNDRLF
FT                   TLSLHVPFTVFDSRLYASYMLNTRKHDATVNSTTLSGTALRDRNLNWSLQQSHSTQDGD
FT                   SGGVNASYKGTYANLNAGYNQSPDSQQVSYGISGGILAHENGITLSQPITGAAILIKAP
FT                   GASGVSVENQTGVATDFRGYTVIPNVTPYYRYDISLDSSTFADNVDIPLNNQTVYPTRN
FT                   AVVRAAYDTHKGYRVLLTLTRSNGEPVPFGATASVDGQDANLASIVGDKGQVFLSGLPE
FT                   EGLLLVNWGSASCRADYRLDISKNMNGIVMANAVCQ"
FT   regulatory      complement(207626..207631)
FT                   /gene="stiC"
FT                   /locus_tag="STM0175"
FT                   /note="putative RBS for stiC; RegulonDB:STMS1H000554"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(207652..208341)
FT                   /gene="stiB"
FT                   /locus_tag="STM0176"
FT   CDS_pept        complement(207652..208335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stiB"
FT                   /locus_tag="STM0176"
FT                   /product="putative fimbrial chaparone"
FT                   /note="similar to E. coli periplasmic chaperone, required
FT                   for type 1 fimbriae (AAC77272.1); Blastp hit to AAC77272.1
FT                   (241 aa), 39% identity in aa 20 - 235"
FT                   /db_xref="EnsemblGenomes-Gn:STM0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19140"
FT                   /db_xref="GOA:Q8ZRR5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR5"
FT                   /protein_id="AAL19140.1"
FT                   /translation="MNSLAKAGLLCCLLCGSLAHAAGINIGTTRVIFHGDAKDASISIS
FT                   NSDNVPYLIQSWAQSISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGGNLPEDRES
FT                   LYWLDIKSIPSSNPDNKHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGRTLT
FT                   VKNPTPYYMNFATLSVGSQKVKAPRYVAPFGNAQYTLPAAASGPIVWSIINDFGGTGPE
FT                   HKQTP"
FT   regulatory      complement(208336..208341)
FT                   /gene="stiB"
FT                   /locus_tag="STM0176"
FT                   /note="putative RBS for stiB; RegulonDB:STMS1H000555"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(208383..208928)
FT                   /gene="stiA"
FT                   /locus_tag="STM0177"
FT   CDS_pept        complement(208383..208922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stiA"
FT                   /locus_tag="STM0177"
FT                   /product="putative fimbrial subunit"
FT                   /note="similar to E. coli major type 1 subunit fimbrin
FT                   (pilin) (AAC77270.1); Blastp hit to AAC77270.1 (182 aa),
FT                   37% identity in aa 1 - 181"
FT                   /db_xref="EnsemblGenomes-Gn:STM0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19141"
FT                   /db_xref="GOA:Q8ZRR4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR4"
FT                   /protein_id="AAL19141.1"
FT                   /translation="MKLSLKTLTVALAAITLSPAALADTAKDGTVHITGLIKQNACTVK
FT                   TDSVEVTLQEEFASLFTAAGQTAGDTDFTIELENCDANVYSSVQARFEGTLDGTDATIL
FT                   KNEDDAENIGVQILDKTSTPMTFNDLQAWSAPVNLPTAEGVTELSMPFTARYIATAVPV
FT                   KSGTVDATATFYLQYN"
FT   regulatory      complement(208923..208928)
FT                   /gene="stiA"
FT                   /locus_tag="STM0177"
FT                   /note="putative RBS for stiA; RegulonDB:STMS1H000556"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            209282..209733
FT                   /gene="yadI"
FT                   /locus_tag="STM0178"
FT   regulatory      209282..209287
FT                   /gene="yadI"
FT                   /locus_tag="STM0178"
FT                   /note="putative RBS for yadI; RegulonDB:STMS1H000557"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        209293..209733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="STM0178"
FT                   /product="putative PTS enzyme"
FT                   /note="similar to E. coli putative PTS enzyme II B
FT                   component (AAC73240.1); Blastp hit to AAC73240.1 (146 aa),
FT                   76% identity in aa 1 - 146"
FT                   /db_xref="EnsemblGenomes-Gn:STM0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19142"
FT                   /db_xref="GOA:Q8ZRR3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR3"
FT                   /protein_id="AAL19142.1"
FT                   /translation="MLGWVISCHDDRAQEMLEGLEKKYGPLAQCRAVNFWRGLSVNMLS
FT                   RMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHSQCEVISGVSYSLMEEMITWR
FT                   ESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDSYEF"
FT   gene            209795..211024
FT                   /gene="yadE"
FT                   /locus_tag="STM0179"
FT   CDS_pept        209795..211024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="STM0179"
FT                   /product="putative xylanase/chitin deacetylase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73241.1); Blastp hit to AAC73241.1 (409 aa), 81%
FT                   identity in aa 1 - 409"
FT                   /db_xref="EnsemblGenomes-Gn:STM0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19143"
FT                   /db_xref="GOA:Q8ZRR2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR2"
FT                   /protein_id="AAL19143.1"
FT                   /translation="MVMRVVLILLFFFAGNVLAALPARYMQTTKDAAIWSQIGDKMVTV
FT                   GNIRAGQILSVTPVAADYYAFKFGFGVGFIDKGHLESVQGKQKVEDGLGDLNKPLSNQN
FT                   LVTWKDTPVYNAPDISSAPFGVLVDNLRYPIISKLKGRLHQTWYQIRIGDRLAYVNAMD
FT                   AQEDNGIPILTYHHILRDEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMYQLEDY
FT                   IYNRANFPARAVAITFDDGLKSVSRYAYPVLKQYDMKATAFIISSRIKRHPQKWNPRSL
FT                   QFMSVSELRKISDVFDFQSHTHFLHRVDGHRRPILYSRSYHNILFDFERSRRALAQFTP
FT                   HVFYLSYPFGGYNATAIKAAKDAGFHLAVTTVRGKVKPGDNPMLLKRLYILRTDSLETM
FT                   SRLISNQPQG"
FT   gene            complement(211031..211426)
FT                   /gene="panD"
FT                   /locus_tag="STM0180"
FT   CDS_pept        complement(211031..211411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="STM0180"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="similar to E. coli aspartate 1-decarboxylase
FT                   (AAC73242.1); Blastp hit to AAC73242.1 (126 aa), 96%
FT                   identity in aa 1 - 126"
FT                   /db_xref="EnsemblGenomes-Gn:STM0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19144"
FT                   /db_xref="GOA:P65662"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65662"
FT                   /protein_id="AAL19144.1"
FT                   /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPK
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   regulatory      complement(211421..211426)
FT                   /gene="panD"
FT                   /locus_tag="STM0180"
FT                   /note="putative RBS for panD; RegulonDB:STMS1H000558"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(211506..212373)
FT                   /gene="panC"
FT                   /locus_tag="STM0181"
FT   CDS_pept        complement(211506..212360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="STM0181"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="similar to E. coli pantothenate synthetase
FT                   (AAC73244.1); Blastp hit to AAC73244.1 (283 aa), 87%
FT                   identity in aa 1 - 283"
FT                   /db_xref="EnsemblGenomes-Gn:STM0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19145"
FT                   /db_xref="GOA:Q8ZRR1"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="PDB:3MUE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRR1"
FT                   /protein_id="AAL19145.1"
FT                   /translation="MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPHGLE
FT                   GQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMV
FT                   ADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNREL
FT                   QEIIAIAEQELNEKGFRADDIQIRDADTLLELTETSKRAVILAAAWLGQARLIDNQSVT
FT                   LAQ"
FT   regulatory      complement(212368..212373)
FT                   /gene="panC"
FT                   /locus_tag="STM0181"
FT                   /note="putative RBS for panC; RegulonDB:STMS1H000559"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(212486..213288)
FT                   /gene="panB"
FT                   /locus_tag="STM0182"
FT   CDS_pept        complement(212486..213277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="STM0182"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="similar to E. coli 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase (AAC73245.1); Blastp hit to
FT                   AAC73245.1 (264 aa), 92% identity in aa 1 - 264"
FT                   /db_xref="EnsemblGenomes-Gn:STM0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19146"
FT                   /db_xref="GOA:Q8ZRR0"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRR0"
FT                   /protein_id="AAL19146.1"
FT                   /translation="MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGD
FT                   SLGMTIQGHDSTLPVTVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQACENAAIVM
FT                   RAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAGQVLL
FT                   DDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDAFGITG
FT                   GHIPKFAKNFLAEAGDMRAAVQQYMAEVESGVYPGEEHSFH"
FT   regulatory      complement(213283..213288)
FT                   /gene="panB"
FT                   /locus_tag="STM0182"
FT                   /note="putative RBS for panB; RegulonDB:STMS1H000560"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(213398..213888)
FT                   /gene="folK"
FT                   /locus_tag="STM0183"
FT   CDS_pept        complement(213398..213877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="STM0183"
FT                   /product="7,
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, PPPK"
FT                   /EC_number="2.7.6.3"
FT                   /note="similar to E. coli
FT                   7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase
FT                   (AAC73253.1); Blastp hit to AAC73253.1 (159 aa), 87%
FT                   identity in aa 1 - 148"
FT                   /db_xref="EnsemblGenomes-Gn:STM0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19147"
FT                   /db_xref="GOA:Q8ZRQ9"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRQ9"
FT                   /protein_id="AAL19147.1"
FT                   /translation="MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVAVSSFYRTPP
FT                   LGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGD
FT                   EVINTDRLTVPHYDMKNRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW"
FT   gene            complement(213874..215292)
FT                   /gene="pcnB"
FT                   /locus_tag="STM0184"
FT   CDS_pept        complement(213874..215292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="STM0184"
FT                   /product="poly(A) polymerase I"
FT                   /EC_number="2.7.7.19"
FT                   /note="similar to E. coli poly(A) polymerase I
FT                   (AAC73254.1); Blastp hit to AAC73254.1 (454 aa), 90%
FT                   identity in aa 1 - 453"
FT                   /db_xref="EnsemblGenomes-Gn:STM0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19148"
FT                   /db_xref="GOA:Q8ZRQ8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRQ8"
FT                   /protein_id="AAL19148.1"
FT                   /translation="MTLPRCAIFTRVANFCRKVLSREESEAEQAVARPHMTIIPREQHA
FT                   ISRKDISENALKVLYRLNKAGYEAYLVGGGVRDLLLGKKPKDFDVTTNATPDQVRKLFR
FT                   NCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGSESDRTTSQRGQNGMLLRDNIFGSIEE
FT                   DAQRRDFTINSLYYSVADFTVRDYVGGMQDLQEGVIRLIGNPETRYREDPVRMLRAVRF
FT                   AAKLNMHISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGNGYETYQQLREYHLFQP
FT                   LFPTITRYFTENGDSAMERIIAQVLKNTDNRIRNEMRVNPAFLFAAMFWYPLLEMAQKI
FT                   AQESGLAYYDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLM
FT                   EHPKFRAAFDLLELRAQVENNTELQRLAQWWAEFQASAPPEQKGMLNELDDDPAPRRRR
FT                   SRPRKRAPRREGTV"
FT   regulatory      complement(213883..213888)
FT                   /gene="folK"
FT                   /locus_tag="STM0183"
FT                   /note="putative RBS for folK; RegulonDB:STMS1H000561"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(215433..216374)
FT                   /gene="yadB"
FT                   /locus_tag="STM0185"
FT   CDS_pept        complement(215433..216374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="STM0185"
FT                   /product="putative glutamyl t-RNA synthetase"
FT                   /note="similar to E. coli putative tRNA synthetase
FT                   (AAC73255.1); Blastp hit to AAC73255.1 (308 aa), 79%
FT                   identity in aa 5 - 307"
FT                   /db_xref="EnsemblGenomes-Gn:STM0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19149"
FT                   /db_xref="GOA:Q8ZRQ7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRQ7"
FT                   /protein_id="AAL19149.1"
FT                   /translation="MTGGSFPALFFIARSMTDSHYIGRFAPSPSGELHFGSLIAALGSY
FT                   LQARAQRGIWRVRIEDIDPPREVPGAAATILRQLEHYGLHWDGEVLWQSQRHEAYREAL
FT                   AWLHEQGLSYYCTCPRSRIQRLGGIYDGHCRTLCHGPENAAVRIKQQHPVMHFHDALRG
FT                   DIQADPQLASEDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQLSLYKQ
FT                   FGWRAPGYVHLPLALNEQGAKLSKQNHAPALATGDPRPVLVQALRFLGQRDVVAWQEMS
FT                   VEELLRFAVAHWRLTAVPTSANVNPAFSNASR"
FT   gene            complement(216398..216866)
FT                   /gene="dksA"
FT                   /locus_tag="STM0186"
FT   CDS_pept        complement(216398..216853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="STM0186"
FT                   /product="dnaK suppressor protein"
FT                   /note="dnaK suppressor protein. (SW:DKSA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19150"
FT                   /db_xref="GOA:P0A1G5"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1G5"
FT                   /protein_id="AAL19150.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   regulatory      complement(216861..216866)
FT                   /gene="dksA"
FT                   /locus_tag="STM0186"
FT                   /note="putative RBS for dksA; RegulonDB:STMS1H000562"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(217030..217745)
FT                   /gene="sfsA"
FT                   /locus_tag="STM0187"
FT   CDS_pept        complement(217030..217734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="STM0187"
FT                   /product="regulator for maltose metabolism"
FT                   /note="similar to E. coli probable regulator for maltose
FT                   metabolism (AAC73257.1); Blastp hit to AAC73257.1 (234 aa),
FT                   82% identity in aa 1 - 234"
FT                   /db_xref="EnsemblGenomes-Gn:STM0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19151"
FT                   /db_xref="GOA:Q8ZRQ6"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRQ6"
FT                   /protein_id="AAL19151.1"
FT                   /translation="MLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSENTKRKYPHTWELTETQSGAFICVNTLRANQLTKEAIQENRLPALAGY
FT                   NILKSEVKYGAERSRIDFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKHLRE
FT                   LMGVAAAGHRAVVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQ
FT                   KMELNEPVPITL"
FT   regulatory      complement(217740..217745)
FT                   /gene="sfsA"
FT                   /locus_tag="STM0187"
FT                   /note="putative RBS for sfsA; RegulonDB:STMS1H000563"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(217751..218281)
FT                   /gene="ligT"
FT                   /locus_tag="STM0188"
FT   CDS_pept        complement(217751..218281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="STM0188"
FT                   /product="2'-5' RNA ligase"
FT                   /EC_number="6.5.1.-"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73258.1); Blastp hit to AAC73258.1 (179 aa), 77%
FT                   identity in aa 4 - 177"
FT                   /db_xref="EnsemblGenomes-Gn:STM0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19152"
FT                   /db_xref="GOA:Q8ZRQ5"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRQ5"
FT                   /protein_id="AAL19152.1"
FT                   /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHLT
FT                   LAFLGDVSSDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQLAN
FT                   MLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYGQGR
FT                   TRYAELQRWTLGE"
FT   gene            218296..220783
FT                   /gene="hrpB"
FT                   /locus_tag="STM0189"
FT   regulatory      218296..218301
FT                   /gene="hrpB"
FT                   /locus_tag="STM0189"
FT                   /note="putative RBS for hrpB; RegulonDB:STMS1H000564"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        218309..220783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="STM0189"
FT                   /product="ATP-dependent helicase"
FT                   /note="similar to E. coli helicase, ATP-dependent
FT                   (AAC73259.1); Blastp hit to AAC73259.1 (824 aa), 84%
FT                   identity in aa 1 - 824"
FT                   /db_xref="EnsemblGenomes-Gn:STM0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19153"
FT                   /db_xref="GOA:Q8ZRQ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRQ4"
FT                   /protein_id="AAL19153.1"
FT                   /translation="MLQCGAKKVNPVEPFVTSLPVAAVLPELLTALKIAPQVLLSAPTG
FT                   AGKSTWLPLQLLQQGPVAGKILLLEPRRLAARNVAQRLAEALNEKPGETVGYRMRAQSC
FT                   VGPRTRLEVVTEGVLTRMIQRDPELRGVGLVILDEFHERSLQADLALALLLDIQQGLRD
FT                   DLRLLIMSATLDNDRLCQRLPDAPTIVSEGRAFPVERRYQPLAAHLRFDEAVAMATAEL
FT                   LRNENGSLLLFLPGVGEIQRVHEHLASRVGSDVLLCPLYGALSLEAQRKAIVPAPAGMR
FT                   KVVLATNIAETSLTIEGIRLVVDSAQERVARFDARTGLTRLVTQRISQASMTQRAGRAG
FT                   RLAPGICLHLLAKEQAERAAAQSDPEILHSDLSGLLMEVLQWGCHDPASLFWLDRPPEV
FT                   NLQAARRLLLMLGALEGERLSARGRKMAAMGNDPRLAAMLVNAGEGDSAATAAMLAAIL
FT                   EDPPRGGGTDLSVVFSRRQPGWQQRSQQLLKRLQVRNGEPDSALIMPLLARAFSDRIAR
FT                   RRGQEGRYQLANGMGAMLDADDALGRHEWLIAPLLLQGSASPDARILLAQPLDIASLIQ
FT                   ACPDLLRQSDTVEWDEAQGTLKAWRRMRIGQLTVSVQPLAKPSEEELHQAMLNGIRDKG
FT                   LSVLNWTPEAEQFRLRLHCAAKWLPEYDWPAVDEASLLATLENWLLPHMTGVQSLRGLK
FT                   SLNVNQALRGLLDYAMLQRLDSELPGHYTVPTGSRITIRYHEDNPPALAVRMQEMFGEA
FT                   KTPTIAQGRVPLVLELLSPAQRPLQITRDLSAFWQGAYREVQKEMKGRYPKHVWPDDPA
FT                   NTAPTRRTKKYS"
FT   gene            220911..223446
FT                   /gene="mrcB"
FT                   /locus_tag="STM0190"
FT   regulatory      220911..220916
FT                   /gene="mrcB"
FT                   /locus_tag="STM0190"
FT                   /note="putative RBS for mrcB; RegulonDB:STMS1H000565"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220924..223446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="STM0190"
FT                   /product="transpeptidase of penicillin-binding protein 1b"
FT                   /note="similar to E. coli peptidoglycan synthetase;
FT                   penicillin-binding protein 1B (AAC73260.1); Blastp hit to
FT                   AAC73260.1 (844 aa), 92% identity in aa 1 - 844"
FT                   /db_xref="EnsemblGenomes-Gn:STM0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19154"
FT                   /db_xref="GOA:Q8ZRQ3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRQ3"
FT                   /protein_id="AAL19154.1"
FT                   /translation="MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPR
FT                   KGKGKGRKPRGKRGWLWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGR
FT                   MVNLEPDMPVSKNEMVKLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQ
FT                   VRARLTFSDGRLETIVNLDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVD
FT                   TLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWR
FT                   KANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLD
FT                   QQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPR
FT                   GGVISPQPAFMQMVRQELQAKLGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKK
FT                   QRKLSDLETAMVVVDRFSGEVRAMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALS
FT                   QPNLYRLNTWIADAPISLRQPNGQVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLG
FT                   MALGLPAVTDTWTKLGVPKDQLNPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSAL
FT                   RSVIAEDGKVLYQSYPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKT
FT                   GTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMAIYQRYLANQTPTPLVLT
FT                   PPEDVVDMGVDYDGNFVCSGGMRTLPVWTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQP
FT                   QQPAQQQPPKEEKSDGVAGWIKEMFGGN"
FT   gene            223726..225928
FT                   /gene="fhuA"
FT                   /locus_tag="STM0191"
FT   regulatory      223726..223731
FT                   /gene="fhuA"
FT                   /locus_tag="STM0191"
FT                   /note="putative RBS for fhuA; RegulonDB:STMS1H000566"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        223739..225928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="STM0191"
FT                   /product="outer membrane protein receptor / transporter for
FT                   ferrichrome, colicin M, and phages T1, T5, and phi80"
FT                   /note="similar to E. coli outer membrane protein receptor
FT                   for ferrichrome, colicin M, and phages T1, T5, and phi80
FT                   (AAC73261.1); Blastp hit to AAC73261.1 (747 aa), 68%
FT                   identity in aa 1 - 747"
FT                   /db_xref="EnsemblGenomes-Gn:STM0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19155"
FT                   /db_xref="GOA:Q8ZRQ2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRQ2"
FT                   /protein_id="AAL19155.1"
FT                   /translation="MARLKTAQPNSSLRKIAVVVATAVSGMSVYAQAAVQPKEETITVT
FT                   AAPAAQESAWGPAPTIAAKRSATTTKTDTPIEKTPQSVSVVTNEEMQMHQFQSVKEALG
FT                   YTPGVTVSSRGASNTYDFVIIRGFSSVGLSQNNYLDGLKLQGNFYNDAVIDPYMLERVE
FT                   LMRGPTSVLYGKSNPGGIISMVSKRPTTEPLKEIQFKMGTDNLFQTGFDFSDSLDDNGE
FT                   FSYRLTGLARSTNEQQKSSESQRYAIAPSFTWRPDEKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGASNNTYSRNEKMVGYSFEHGFNDTFTVRQNLRFVEMKT
FT                   AQKSVYGTGIAADGHTLNRGTIVDNERLQNFSVDTQLESKFATGDIDHTLLTGVDFMRM
FT                   RNDINATFGSAPSIDLYNNYHPEYFAFGGAEPYQMNESKQTGLYVQDQAEWNKWVFTLG
FT                   GRYDWSKQATTVRQNSTTPTEGYIERNDHQFTWRGGVNYVFDNGISPYFSYSQSFEPSA
FT                   FDLWSTPRVSYKPSKGEQYEAGVKYVPKDMPVVVTGAVYQLTKTNNLTADPTNPLAQVP
FT                   AGEIRARGVELEAKAALTANINMTASYTYTDAEYTKDTNLKGNTPEQVPEHMASLWGDY
FT                   TFNEGPLSGLTLGTGGRFIGSSYGDPANSFKVGSAAVMDAVVKYDLARFGMAGSSIAVN
FT                   VNNLLDREYVASCFQTYGCFWGAERQVVATATFRF"
FT   gene            225977..226774
FT                   /gene="fhuC"
FT                   /locus_tag="STM0192"
FT   CDS_pept        225977..226774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="STM0192"
FT                   /product="hydroxymate-dependent iron transport"
FT                   /note="ABC superfamily (atp_bind); similar to E. coli
FT                   ATP-binding component of hydroxymate-dependent iron
FT                   transport (AAC73262.1); Blastp hit to AAC73262.1 (265 aa),
FT                   92% identity in aa 1 - 265"
FT                   /db_xref="EnsemblGenomes-Gn:STM0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19156"
FT                   /db_xref="GOA:Q8ZRQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRQ1"
FT                   /protein_id="AAL19156.1"
FT                   /translation="MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTVRE
FT                   LVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY"
FT   gene            226774..227664
FT                   /gene="fhuD"
FT                   /locus_tag="STM0193"
FT   CDS_pept        226774..227664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="STM0193"
FT                   /product="hydroxamate-dependent iron uptake"
FT                   /note="ABC superfamily (bind _prot); similar to E. coli
FT                   hydroxamate-dependent iron uptake, cytoplasmic membrane
FT                   component (AAC73263.1); Blastp hit to AAC73263.1 (296 aa),
FT                   82% identity in aa 1 - 296"
FT                   /db_xref="EnsemblGenomes-Gn:STM0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19157"
FT                   /db_xref="GOA:Q8ZRQ0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRQ0"
FT                   /protein_id="AAL19157.1"
FT                   /translation="MRDLYPLTRRRLLTAMALSPLLWQMNTAQAAAIDPRRIVALEWLP
FT                   VELLLALGITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEKLARIAPGRGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDRFIA
FT                   SQKPHFIRRGGRPLLMTTLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWGSTAV
FT                   SIDRLAMYKEADVICFDHGNNTDMNALMATPLWQAMPFVRAGRFHRVPAVWFYGATLST
FT                   MHFVRILNNVLGGKA"
FT   gene            227651..229718
FT                   /gene="fhuB"
FT                   /locus_tag="STM0194"
FT   regulatory      227651..227656
FT                   /gene="fhuD"
FT                   /locus_tag="STM0193"
FT                   /note="putative RBS for fhuB; RegulonDB:STMS1H000567"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        227661..229718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="STM0194"
FT                   /product="hydroxamate-dependent iron uptake"
FT                   /note="ABC superfamily (membrane); similar to E. coli
FT                   hydroxamate-dependent iron uptake, cytoplasmic membrane
FT                   component (AAC73264.1); Blastp hit to AAC73264.1 (660 aa),
FT                   90% identity in aa 9 - 660"
FT                   /db_xref="EnsemblGenomes-Gn:STM0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19158"
FT                   /db_xref="GOA:O87656"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87656"
FT                   /protein_id="AAL19158.1"
FT                   /translation="MSRKREMPDGGAKSVLSDLRFGRFVGRIRRSRHPALLLLALFVAA
FT                   CWLTWVNFSVALPRSQWQQAIWSPDIDIIEQMIFHYSQLPRLAISLLVGAGLGLVGVLF
FT                   QQVLRNPLAEPTTLGVATGAQLGITVTTLWAIPGALTTQFAALTGACIVGALVFGVAWG
FT                   KRLSPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQ
FT                   LLGGVMLTLLLLRPMTLMGLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGF
FT                   IGLFAPLLAKMLGARRLLARLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIG
FT                   APLLLWLLPRLKSMSAPDMNASDRVAAERRHVLAFAVAGGALLLLATWVALSFGRDAHG
FT                   WTWASGTLLEELMPWRWPRILAALMAGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAF
FT                   GVVLMLFLVPGNAFGWLLPAGSLGAAATLLIIMIAAGRGGFSPQRMLLAGMALSTAFTM
FT                   LLMMLQASGDPRMAEVLTWLSGSTYNATGGQVTRTAIVMVILLAIVPLCRRWLTILPLG
FT                   GDAARAVGMALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIARMLGFRRTMPHM
FT                   VISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRKQSR"
FT   gene            230647..231218
FT                   /gene="stfA"
FT                   /locus_tag="STM0195"
FT   regulatory      230647..230652
FT                   /gene="stfA"
FT                   /locus_tag="STM0195"
FT                   /note="putative RBS for stfA; RegulonDB:STMS1H000568"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        230658..231218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfA"
FT                   /locus_tag="STM0195"
FT                   /product="putative fimbrial subunit"
FT                   /note="major fimbrial subunit StfA (gi|3747029)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19159"
FT                   /db_xref="GOA:H9L482"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L482"
FT                   /protein_id="AAL19159.1"
FT                   /translation="MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIV
FT                   VGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANP
FT                   GSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKG
FT                   DSAATTIDTGEFSSTVNFTISYL"
FT   gene            231287..233961
FT                   /gene="stfC"
FT                   /locus_tag="STM0196"
FT   regulatory      231287..231292
FT                   /gene="stfC"
FT                   /locus_tag="STM0196"
FT                   /note="putative RBS for stfC; RegulonDB:STMS1H000569"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        231304..233961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfC"
FT                   /locus_tag="STM0196"
FT                   /product="putative fimbrial outer membrane usher"
FT                   /note="outer membrane usher protein StfC (gi|3747030)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19160"
FT                   /db_xref="GOA:H9L4A4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:H9L4A4"
FT                   /protein_id="AAL19160.1"
FT                   /translation="MAHYKKFRLSTLAAVVGIVLAVGPENSYAEAPIQFNTRFLDVKDD
FT                   ASLDLSRFSRKGYIMPGSYHLQVLVNQSQIVQDNVITYSVDNNDPDNTYPCLSPELVSL
FT                   LGLKPEIADKMIWINAGQCLQPDQLEGMETQTDLSQSTLTVIIPQAYLEYSDEEWDPPS
FT                   RWDEGIPGVLFDYNVNSQWRHAEHDDGDEYDISGNGTVGANLGAWRLRADWQANYRHEN
FT                   DSEDKDNFGSSSEQNWDWNRYYAWRAIPQLRAQLTLGEGSLESDIFDGFNYVGGSLITD
FT                   DQMLPPNLRGYAPDISGVARTNAKVTVTQRGRVIYESQVPAGPFRIQDINETVSGDLHV
FT                   KIEEQSGQVQEYDVSTASIPFLTRPGQVRYKLAAGRPQDWDHNMEGGFFTSAEASWGIA
FT                   NGWSLYGGAIGEQDYQALALGLGRDLALLGAFSVDVTHSRATLPEGSAYGDGTIQGNSF
FT                   RASYAKDFDDIDSRLTFAGYRFSEENYMTMDEFIDTHNDDNDRQRTGHDKEMYTLTYSQ
FT                   NFSAINVNAYINYTHRTYWNQPNQDSYNLTLSHYFDVGEVRGISLSVNGFRNEYDNERD
FT                   DGVYVSLSIPWGNNRTLSYNGSFSDDNNSNQVGYYERIDDRNNYQINAGRADNGATLDG
FT                   YYRYQASYADIDVSANYQEGDYTSGGLNIQGGATLTAKGGALHRTSVNGGSRLLVDVGD
FT                   EANVPISGYSTPVYTNAFGKAVIVDVNDYYRNQVKIDITQLPEDAEAILSIAQATLTEG
FT                   AIGYRRMEVLSGKKAMASIRLRDGGTPPFGAEVYNSRQQQLGIVGEDGSVYLIGINPGE
FT                   RLQVTWEGKTQCEATLPDPLPGDLFSGLLLPCIGDASSPEATQPEEKPLLQLHTQRRTS
FT                   STQPEALSSRYPTH"
FT   gene            233964..234731
FT                   /gene="stfD"
FT                   /locus_tag="STM0197"
FT   regulatory      233964..233969
FT                   /gene="stfD"
FT                   /locus_tag="STM0197"
FT                   /note="putative RBS for stfD; RegulonDB:STMS1H000570"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        233979..234731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfD"
FT                   /locus_tag="STM0197"
FT                   /product="putative periplasmic fimbrial chaperone"
FT                   /note="periplasmic fimbrial chaperone StfD (gi|3747031)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19161"
FT                   /db_xref="GOA:H9L411"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:H9L411"
FT                   /protein_id="AAL19161.1"
FT                   /translation="MMSLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSISV
FT                   DLKNANSKLPYLAQSWVEDEKGVKITSPLIVVPPVQRIEPSAIGQVKIQGMPALASLPQ
FT                   DRETLFYYNVREIPPQSDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQRQG
FT                   NGYQVSNTTGYYVVLSNASNRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPVLTYV
FT                   NDYGARLPLIFNCTDNSCAVDEAKSRKS"
FT   gene            234737..235262
FT                   /gene="stfE"
FT                   /locus_tag="STM0198"
FT   regulatory      234737..234742
FT                   /gene="stfE"
FT                   /locus_tag="STM0198"
FT                   /note="putative RBS for stfE; RegulonDB:STMS1H000571"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234750..235262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfE"
FT                   /locus_tag="STM0198"
FT                   /product="putative minor fimbrial subunit"
FT                   /note="minor fimbrial subunit StfE (gi|3747032)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19162"
FT                   /db_xref="GOA:H9L409"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L409"
FT                   /protein_id="AAL19162.1"
FT                   /translation="MRQWRLRLGTVTCAAMLSAVSMPLAAGSKTVNMTLTIVVNAAPPC
FT                   TVTGGEVEFGNVLTTKVDGVNYRQAVGYRLSCNGRVSDYLKLQIQGNAVTINGESVLQT
FT                   DVDGLGIRLQTATDGALISPGNTQWLSFQYSGGSGPAIEAIPVKNNGVTLTGGAFNAGA
FT                   TLVVDYQ"
FT   gene            235245..235735
FT                   /gene="stfF"
FT                   /locus_tag="STM0199"
FT   regulatory      235245..235250
FT                   /gene="stfF"
FT                   /locus_tag="STM0199"
FT                   /note="putative RBS for stfF; RegulonDB:STMS1H000572"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        235259..235735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfF"
FT                   /locus_tag="STM0199"
FT                   /product="putative minor fimbrial subunit"
FT                   /note="minor fimbrial subunit StfF (gi|3747033)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19163"
FT                   /db_xref="GOA:H9L4A9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L4A9"
FT                   /protein_id="AAL19163.1"
FT                   /translation="MKKIVLTMLMGGSLAAQAADNLKFHGTLISPPNCTINNDQTIDVK
FT                   FGNLLINKIDGTRYAQNVPYEITCDSTVRDETMAMTLTLSGSVSDFNPAAVNTSVAGLG
FT                   IELRQNDQPFTLGSTITVNEQSIPVLKAIPVKKSGASLKEGGFDATATLQVDYQ"
FT   gene            235718..236265
FT                   /gene="stfG"
FT                   /locus_tag="STM0200"
FT   regulatory      235718..235723
FT                   /gene="stfF"
FT                   /locus_tag="STM0199"
FT                   /note="putative RBS for stfG; RegulonDB:STMS1H000573"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        235735..236265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfG"
FT                   /locus_tag="STM0200"
FT                   /product="putative minor fimbrial subunit"
FT                   /note="putative adhesin; minor fimbrial subunit StfG
FT                   (gi|3747034)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19164"
FT                   /db_xref="GOA:Q8ZRP9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRP9"
FT                   /protein_id="AAL19164.1"
FT                   /translation="MAKRQALLHGAACILCGALILPVSAADNLHFSGSLVASPCTLTMQ
FT                   GTGIAEVDFSSLDSSDFTPDGQSARKPLVFELTDCDSALSNGVQVTFTGTEATGMRGIL
FT                   AIDSYSGASGIGIGIETLSGVPVGMNDKEGAIFTLVTGKNTLNLNAWVQRLPGEDLIPG
FT                   RFSASALATFEYL"
FT   gene            236265..237104
FT                   /locus_tag="STM0201"
FT   CDS_pept        236265..237104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0201"
FT                   /product="putative outer membrane protein"
FT                   /note="hypothetical 30.2 da protein in stfG 3'region
FT                   precursor. (SW:YADU_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19165"
FT                   /db_xref="InterPro:IPR021407"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87663"
FT                   /protein_id="AAL19165.1"
FT                   /translation="MKIIRTLFLLLIAVYGSSVVAKPMLKATFSSTTMYYGIGPNSDKS
FT                   IVAEVTIATPEGVYYGSWNLSGHRKGETLTADSWSGPEPAPKVVLKDFDNTVSRSACKN
FT                   LPSNWRGCGSFTLEITVQSDDYGCPWLASSHIVATTFITNETYSPPDTRSSVCPKVPVD
FT                   TFDISWDANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDNRGAYCRFVSSG
FT                   ITLNVLGCDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL"
FT   gene            complement(237212..238505)
FT                   /gene="hemL"
FT                   /locus_tag="STM0202"
FT   CDS_pept        complement(237212..238492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="STM0202"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /EC_number="5.4.3.8"
FT                   /note="glutamate-1-semialdehyde 2,1-aminomutase.
FT                   (SW:GSA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19166"
FT                   /db_xref="GOA:P0CL07"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CL07"
FT                   /protein_id="AAL19166.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIASIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLCEAAQ
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSMDDINNTIDAARRVFAKL"
FT   regulatory      complement(238500..238505)
FT                   /gene="hemL"
FT                   /locus_tag="STM0202"
FT                   /note="putative RBS for hemL; RegulonDB:STMS1H000574"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            238662..240083
FT                   /gene="yadQ"
FT                   /locus_tag="STM0203"
FT   CDS_pept        238662..240083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadQ"
FT                   /locus_tag="STM0203"
FT                   /product="putative ClC family chlorine transport protein"
FT                   /note="similar to E. coli putative channel transporter
FT                   (AAC73266.1); Blastp hit to AAC73266.1 (473 aa), 78%
FT                   identity in aa 1 - 473"
FT                   /db_xref="EnsemblGenomes-Gn:STM0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19167"
FT                   /db_xref="GOA:Q8ZRP8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="PDB:1KPL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP8"
FT                   /protein_id="AAL19167.1"
FT                   /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGTL
FT                   TGLVGVAFEKAVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGRMVL
FT                   DVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRTQDMFQ
FT                   RFHGGEIKKWVLMGGAIGGLCGILGLIEPAAAGGGFNLIPIAAAGNFSVGLLLFIFITR
FT                   VVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIAGMGALMA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQDA
FT                   EQAEKNQNAPADENT"
FT   gene            240120..240509
FT                   /gene="yadR"
FT                   /locus_tag="STM0204"
FT   CDS_pept        240120..240509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="STM0204"
FT                   /product="putative HesB-like domain protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73267.1); Blastp hit to AAC73267.1 (114 aa), 99%
FT                   identity in aa 1 - 114"
FT                   /db_xref="EnsemblGenomes-Gn:STM0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19168"
FT                   /db_xref="GOA:Q7CR66"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR66"
FT                   /protein_id="AAL19168.1"
FT                   /translation="MGENLSNYRCRLEQNMSDDVALPLQFTDAAANKVKSLIADEDNPN
FT                   LKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEG
FT                   LEGSRFIVTNPNAKSTCGCGSSFSI"
FT   gene            complement(240610..241247)
FT                   /gene="yadS"
FT                   /locus_tag="STM0205"
FT   CDS_pept        complement(240610..241233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="STM0205"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73268.1); Blastp hit to AAC73268.1 (207 aa), 96%
FT                   identity in aa 1 - 207"
FT                   /db_xref="EnsemblGenomes-Gn:STM0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19169"
FT                   /db_xref="GOA:Q7CR65"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR65"
FT                   /protein_id="AAL19169.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
FT   regulatory      complement(241242..241247)
FT                   /gene="yadS"
FT                   /locus_tag="STM0205"
FT                   /note="putative RBS for yadS; RegulonDB:STMS1H000575"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(241270..242077)
FT                   /gene="btuF"
FT                   /locus_tag="STM0206"
FT   CDS_pept        complement(241270..242070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="STM0206"
FT                   /product="putative cobalamin periplasmic binding protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73269.1); Blastp hit to AAC73269.1 (266 aa), 81%
FT                   identity in aa 1 - 266"
FT                   /db_xref="EnsemblGenomes-Gn:STM0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19170"
FT                   /db_xref="GOA:Q8ZRP7"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP7"
FT                   /protein_id="AAL19170.1"
FT                   /translation="MAKQMFRALVALLLTLPVWLYAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPEAQKIEQVSTWQGMNLERIVALKPDLVVAWRGGNAERQVNQLTSLGIKV
FT                   MWVDAVTIEQIADTLRQLAAWSPQPEKAQQAAQTLLNEYAALNAEYAGKAKKRVFLQFG
FT                   MNPLFTSGKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKAGEIL
FT                   KIEQYWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
FT   gene            complement(242063..242761)
FT                   /gene="pfs"
FT                   /locus_tag="STM0207"
FT   CDS_pept        complement(242063..242761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="STM0207"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73270.1); Blastp hit to AAC73270.1 (232 aa), 96%
FT                   identity in aa 1 - 232"
FT                   /db_xref="EnsemblGenomes-Gn:STM0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19171"
FT                   /db_xref="GOA:P60217"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60217"
FT                   /protein_id="AAL19171.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMV
FT                   ETLVQKLAHG"
FT   regulatory      complement(242072..242077)
FT                   /gene="pfs"
FT                   /locus_tag="STM0207"
FT                   /note="putative RBS for btuF; RegulonDB:STMS1H000576"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            242840..244363
FT                   /gene="dgt"
FT                   /locus_tag="STM0208"
FT   regulatory      242840..242845
FT                   /gene="dgt"
FT                   /locus_tag="STM0208"
FT                   /note="putative RBS for dgt; RegulonDB:STMS1H000577"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        242846..244363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="STM0208"
FT                   /product="deoxyguanosine triphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /note="deoxyguanosinetriphosphate triphosphohydrolase.
FT                   (SW:DGTP_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19172"
FT                   /db_xref="GOA:P40733"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40733"
FT                   /protein_id="AAL19172.1"
FT                   /translation="MASIDFRNKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKEQDRLEEYGLDALTG
FT                   PFESIVEMACLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTHDRCVVSSLRLQ
FT                   EGEENLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGPV
FT                   PDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFSVEQLYHHLYHAWCHHEKDSLFELVVGNAWEKSRANTLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLPQIFAGTFNQALLEDASGFSRLLELYKNVAVEHVFSHPDVEQL
FT                   ELQGYRVISGLLDIYQPLLSLSLNDFRELVEKERLKRFPIESRLFQKLSTRHRLAYVEV
FT                   VSKLPTDSAEYPVLEYYYRCRLIQDYISGMTDLYAWDEYRRLMAVEQ"
FT   gene            244493..245920
FT                   /gene="htrA"
FT                   /locus_tag="STM0209"
FT   CDS_pept        244493..245920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="STM0209"
FT                   /product="periplasmic serine protease Do, heat shock
FT                   protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="protease DO precursor. (SW:DEGP_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19173"
FT                   /db_xref="GOA:P26982"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26982"
FT                   /protein_id="AAL19173.1"
FT                   /translation="MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAPM
FT                   LEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNGGN
FT                   GGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDI
FT                   ALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENY
FT                   ENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQM
FT                   VEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSL
FT                   NGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIE
FT                   GAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSKPSV
FT                   LALNIQRGDSSIYLLMQ"
FT   gene            246061..247230
FT                   /gene="cdaR"
FT                   /locus_tag="STM0210"
FT   regulatory      246061..246066
FT                   /gene="cdaR"
FT                   /locus_tag="STM0210"
FT                   /note="putative RBS for cdaR; RegulonDB:STMS1H000578"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        246073..247230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="STM0210"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73273.1); Blastp hit to AAC73273.1 (391 aa), 95%
FT                   identity in aa 7 - 391"
FT                   /db_xref="EnsemblGenomes-Gn:STM0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19174"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRP6"
FT                   /protein_id="AAL19174.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQP
FT                   RVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRW
FT                   DAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPES
FT                   RSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEQR"
FT   gene            complement(247319..247717)
FT                   /gene="yaeH"
FT                   /locus_tag="STM0211"
FT   CDS_pept        complement(247319..247705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="STM0211"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli putative structural protein
FT                   (AAC73274.1); Blastp hit to AAC73274.1 (128 aa), 95%
FT                   identity in aa 1 - 128"
FT                   /db_xref="EnsemblGenomes-Gn:STM0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19175"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR64"
FT                   /protein_id="AAL19175.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKS
FT                   VKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDL
FT                   RHLESVVANKISEIEADLDKLTRK"
FT   regulatory      complement(247712..247717)
FT                   /gene="yaeH"
FT                   /locus_tag="STM0211"
FT                   /note="putative RBS for yaeH; RegulonDB:STMS1H000579"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            247943..249253
FT                   /locus_tag="STM0212"
FT   regulatory      247943..247948
FT                   /locus_tag="STM0212"
FT                   /note="putative RBS for STM0212; RegulonDB:STMS1H000580"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        247952..249253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0212"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli putative transport protein,
FT                   shikimate (AAC75045.1); Blastp hit to AAC75045.1 (438 aa),
FT                   40% identity in aa 13 - 435"
FT                   /db_xref="EnsemblGenomes-Gn:STM0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19176"
FT                   /db_xref="GOA:Q8ZRP5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRP5"
FT                   /protein_id="AAL19176.1"
FT                   /translation="MSGTYNATIRRVVVSAWIGNSIEYYDFLLYGLASALVFGPLFFPG
FT                   ASPLTATLSSFASFGVGFISRPLGALFFGNRGDTLGRKNTLLITLGGMGAVTFLIGCLP
FT                   SYASIGALAPALLVILRFLQGFMVGGEWGGAMLMVVEYAAGKHRGRLSALSQTGGLTGQ
FT                   LLATGVFIVVTQLPQEALLSWGWRIPFLLSALLVLPGLYMRHRLDETPVFRAFKKQQAI
FT                   NHRQQREERPVVKVVREQWRSILLIIILRFAESVPFFLATVFAVSWATTQLGIASLTIL
FT                   YIVMFTCLLAYPMHVLFGIMSDRRGCRQVYIFGALFVAAMAFPFFWLLESRSLILMTMG
FT                   YVLLINIGHNSLNAVQPSFFAGLFHPPVRYSGSSIGAQLGAVVAGGFTPFIAKALSAVY
FT                   DNSWALVAGYVVLTALASAFAAKIAPETVLPHSP"
FT   gene            complement(249290..250114)
FT                   /gene="dapD"
FT                   /locus_tag="STM0213"
FT   CDS_pept        complement(249290..250114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="STM0213"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="similar to E. coli
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase (AAC73277.1); Blastp hit to
FT                   AAC73277.1 (274 aa), 97% identity in aa 1 - 274"
FT                   /db_xref="EnsemblGenomes-Gn:STM0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19177"
FT                   /db_xref="GOA:Q8ZRP4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP4"
FT                   /protein_id="AAL19177.1"
FT                   /translation="MQQLQNVIETAFERRADITPANVDTVTREAVNQVISLLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEV
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(250144..252825)
FT                   /gene="glnD"
FT                   /locus_tag="STM0214"
FT   CDS_pept        complement(250144..252816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="STM0214"
FT                   /product="uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="[protein-PII] uridylyltransferase. (SW:GLND_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19178"
FT                   /db_xref="GOA:P23679"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23679"
FT                   /protein_id="AAL19178.1"
FT                   /translation="MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQH
FT                   WLGEAFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVATNLI
FT                   ETRLLIGDVALFLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGIYSTTLRH
FT                   LRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELILIAALFHDIA
FT                   KGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTETRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAWHARHLLQHDLRQ
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLAADRHDVIRTGLEQTITQRSWQPPQPRRQPAKLRHFTVETEVNFLPTHTD
FT                   RKSFMELIALDQPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNNV
FT                   LQLEVQQRLTAALNPNDKG"
FT   regulatory      complement(252820..252825)
FT                   /gene="glnD"
FT                   /locus_tag="STM0214"
FT                   /note="putative RBS for glnD; RegulonDB:STMS1H000581"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(253053..253860)
FT                   /gene="map"
FT                   /locus_tag="STM0215"
FT   CDS_pept        complement(253053..253847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="STM0215"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="methionine aminopeptidase. (SW:AMPM_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19179"
FT                   /db_xref="GOA:P0A1X6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1X6"
FT                   /protein_id="AAL19179.1"
FT                   /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRIC
FT                   NDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDE
FT                   FHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE"
FT   regulatory      complement(253855..253860)
FT                   /gene="map"
FT                   /locus_tag="STM0215"
FT                   /note="putative RBS for map; RegulonDB:STMS1H000582"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            254285..255023
FT                   /gene="rpsB"
FT                   /locus_tag="STM0216"
FT   regulatory      254285..254290
FT                   /gene="rpsB"
FT                   /locus_tag="STM0216"
FT                   /note="putative RBS for rpsB; RegulonDB:STMS1H000583"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        254298..255023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="STM0216"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /note="similar to E. coli 30S ribosomal subunit protein S2
FT                   (AAC73280.1); Blastp hit to AAC73280.1 (241 aa), 97%
FT                   identity in aa 1 - 241"
FT                   /db_xref="EnsemblGenomes-Gn:STM0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19180"
FT                   /db_xref="GOA:P66541"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66541"
FT                   /protein_id="AAL19180.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   gene            255269..256132
FT                   /gene="tsf"
FT                   /locus_tag="STM0217"
FT   regulatory      255269..255274
FT                   /gene="tsf"
FT                   /locus_tag="STM0217"
FT                   /note="putative RBS for tsf; RegulonDB:STMS1H000584"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        255281..256132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="STM0217"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /note="similar to E. coli protein chain elongation factor
FT                   EF-Ts (AAC73281.1); Blastp hit to AAC73281.1 (283 aa), 96%
FT                   identity in aa 1 - 283"
FT                   /db_xref="EnsemblGenomes-Gn:STM0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19181"
FT                   /db_xref="GOA:P64052"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64052"
FT                   /protein_id="AAL19181.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNVAFILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVASLEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            256265..257002
FT                   /gene="pyrH"
FT                   /locus_tag="STM0218"
FT   regulatory      256265..256270
FT                   /gene="pyrH"
FT                   /locus_tag="STM0218"
FT                   /note="putative RBS for pyrH; RegulonDB:STMS1H000585"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        256277..257002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="STM0218"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="similar to E. coli uridylate kinase (AAC73282.1);
FT                   Blastp hit to AAC73282.1 (241 aa), 98% identity in aa 1 -
FT                   241"
FT                   /db_xref="EnsemblGenomes-Gn:STM0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19182"
FT                   /db_xref="GOA:P65933"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65933"
FT                   /protein_id="AAL19182.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            257136..257706
FT                   /gene="frr"
FT                   /locus_tag="STM0219"
FT   regulatory      257136..257141
FT                   /gene="frr"
FT                   /locus_tag="STM0219"
FT                   /note="putative RBS for frr; RegulonDB:STMS1H000586"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        257149..257706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="STM0219"
FT                   /product="ribosome releasing factor"
FT                   /note="similar to E. coli ribosome releasing factor
FT                   (AAC73283.1); Blastp hit to AAC73283.1 (185 aa), 93%
FT                   identity in aa 1 - 185"
FT                   /db_xref="EnsemblGenomes-Gn:STM0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19183"
FT                   /db_xref="GOA:P66738"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66738"
FT                   /protein_id="AAL19183.1"
FT                   /translation="MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEVQKM
FT                   TDAAIKKVDAALADKEAELMQF"
FT   gene            257836..259043
FT                   /gene="dxr"
FT                   /locus_tag="STM0220"
FT   regulatory      257836..257841
FT                   /gene="dxr"
FT                   /locus_tag="STM0220"
FT                   /note="putative RBS for dxr; RegulonDB:STMS1H000587"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        257847..259043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="STM0220"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.-"
FT                   /note="similar to E. coli putative ATP-binding component of
FT                   a transport system (AAC73284.1); Blastp hit to AAC73284.1
FT                   (398 aa), 88% identity in aa 1 - 397"
FT                   /db_xref="EnsemblGenomes-Gn:STM0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19184"
FT                   /db_xref="GOA:Q8ZRP3"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP3"
FT                   /protein_id="AAL19184.1"
FT                   /translation="MKQLTILGSTGSIGCSTLDVVRHNPDSFRVIALVAGKNVARMAEQ
FT                   CLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAALDEVGHVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQS
FT                   IQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAATTALNAANE
FT                   ITVAAFLAQQIRFTDIAGLNLAVLERMDLQEPASVEDVLQVDAIAREVARKQVIRLSR"
FT   gene            259337..260114
FT                   /gene="uppS"
FT                   /locus_tag="STM0221"
FT   regulatory      259337..259342
FT                   /gene="uppS"
FT                   /locus_tag="STM0221"
FT                   /note="putative RBS for uppS; RegulonDB:STMS1H000588"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        259356..260114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="STM0221"
FT                   /product="undecaprenyl pyrophosphate synthetase (di-trans,
FT                   poly-cis-decaprenylcistransferase)"
FT                   /EC_number="2.5.1.31"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73285.1); Blastp hit to AAC73285.1 (253 aa), 93%
FT                   identity in aa 2 - 253"
FT                   /db_xref="EnsemblGenomes-Gn:STM0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19185"
FT                   /db_xref="GOA:Q8ZRP2"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP2"
FT                   /protein_id="AAL19185.1"
FT                   /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGRWDIVQGVRQLAEQVQA
FT                   GVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALHAFANRERRFGGTEPGDDKA"
FT   gene            260114..260984
FT                   /gene="cdsA"
FT                   /locus_tag="STM0222"
FT   regulatory      260114..260119
FT                   /gene="cdsA"
FT                   /locus_tag="STM0222"
FT                   /note="putative RBS for cdsA; RegulonDB:STMS1H000589"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        260127..260984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="STM0222"
FT                   /product="CDP-diglyceride synthase"
FT                   /EC_number="2.7.7.41"
FT                   /note="similar to E. coli CDP-diglyceride synthetase
FT                   (AAC73286.1); Blastp hit to AAC73286.1 (249 aa), 95%
FT                   identity in aa 1 - 249"
FT                   /db_xref="EnsemblGenomes-Gn:STM0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19186"
FT                   /db_xref="GOA:Q7CR63"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR63"
FT                   /protein_id="AAL19186.1"
FT                   /translation="MLKYRLISAFVLIPAVIAALFLLPPVGFAIITLVVCMLAAWEWGQ
FT                   LSGFAARSQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEMSLWASLGWWVVALLLVL
FT                   FYPGSAAIWRNSKTLRLIFGLLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLNVAPVILLI
FT                   CSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FRTL"
FT   gene            260988..262348
FT                   /gene="yaeL"
FT                   /locus_tag="STM0223"
FT   regulatory      260988..260993
FT                   /gene="yaeL"
FT                   /locus_tag="STM0223"
FT                   /note="putative RBS for yaeL; RegulonDB:STMS1H000590"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        260996..262348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="STM0223"
FT                   /product="putative membrane-associated Zn-dependent
FT                   protease"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73287.1); Blastp hit to AAC73287.1 (450 aa), 88%
FT                   identity in aa 1 - 450"
FT                   /db_xref="EnsemblGenomes-Gn:STM0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19187"
FT                   /db_xref="GOA:Q8ZRP1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP1"
FT                   /protein_id="AAL19187.1"
FT                   /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQI
FT                   EPVLSEVQANSAASKAGLQAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEIERQGS
FT                   ALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   gene            262380..264794
FT                   /gene="yaeT"
FT                   /locus_tag="STM0224"
FT   CDS_pept        262380..264794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="STM0224"
FT                   /product="putative outer membrane antigen"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73288.1); Blastp hit to AAC73288.1 (810 aa), 92%
FT                   identity in aa 1 - 810"
FT                   /db_xref="EnsemblGenomes-Gn:STM0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19188"
FT                   /db_xref="GOA:Q8ZRP0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="PDB:5OR1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP0"
FT                   /protein_id="AAL19188.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHS
FT                   AEIENLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGI
FT                   NGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNK
FT                   LDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGD
FT                   GLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYKNGAHTSWDDNDDYEDCTQESGCK
FT                   SDDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPD
FT                   YSDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            264905..265402
FT                   /gene="hlpA"
FT                   /locus_tag="STM0225"
FT   regulatory      264905..264910
FT                   /gene="hlpA"
FT                   /locus_tag="STM0225"
FT                   /note="putative RBS for hlpA; RegulonDB:STMS1H000591"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        264917..265402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="STM0225"
FT                   /product="histone-like protein, located in outer membrane"
FT                   /note="outer membrane protein OMPH precursor.
FT                   (SW:OMPH_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19189"
FT                   /db_xref="GOA:P0A1Z2"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1Z2"
FT                   /protein_id="AAL19189.1"
FT                   /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNT
FT                   LENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFEKD
FT                   RARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK"
FT   gene            265391..266431
FT                   /gene="lpxD"
FT                   /locus_tag="STM0226"
FT   regulatory      265391..265396
FT                   /gene="hlpA"
FT                   /locus_tag="STM0225"
FT                   /note="putative RBS for lpxD; RegulonDB:STMS1H000592"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        265406..266431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="STM0226"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   n-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase. (SW:LPXD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19190"
FT                   /db_xref="GOA:P0A1X4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1X4"
FT                   /protein_id="AAL19190.1"
FT                   /translation="MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHD
FT                   IQIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIERKVNQQ
FT                   D"
FT   gene            266524..266992
FT                   /gene="fabZ"
FT                   /locus_tag="STM0227"
FT   regulatory      266524..266529
FT                   /gene="fabZ"
FT                   /locus_tag="STM0227"
FT                   /note="putative RBS for fabZ; RegulonDB:STMS1H000593"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        266537..266992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="STM0227"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase. (SW:FABZ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19191"
FT                   /db_xref="GOA:P0A1H9"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1H9"
FT                   /protein_id="AAL19191.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            266984..267784
FT                   /gene="lpxA"
FT                   /locus_tag="STM0228"
FT   regulatory      266984..266989
FT                   /gene="fabZ"
FT                   /locus_tag="STM0227"
FT                   /note="putative RBS for lpxA; RegulonDB:STMS1H000594"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        266996..267784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="STM0228"
FT                   /product="UDP-N-acetylglucosamine acetyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
FT                   O-acyltransferase. (SW:LPXA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19192"
FT                   /db_xref="GOA:P32200"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32200"
FT                   /protein_id="AAL19192.1"
FT                   /translation="MIDKSAFIHPTAIVEDGAVIGANAHIGPFCIVGPQVEIGEGTVLK
FT                   SHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREGLVAIRNAYKLL
FT                   YRSGKTLDEAKLEIAELAEKHPEVKAFTEFFERSTRGPIR"
FT   gene            267768..268932
FT                   /gene="lpxB"
FT                   /locus_tag="STM0229"
FT   regulatory      267768..267773
FT                   /gene="lpxA"
FT                   /locus_tag="STM0228"
FT                   /note="putative RBS for lpxB; RegulonDB:STMS1H000595"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        267784..268932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="STM0229"
FT                   /product="tetraacyldisaccharide-1-P"
FT                   /EC_number="2.4.1.182"
FT                   /note="similar to E. coli tetraacyldisaccharide-1-P; lipid
FT                   A biosynthesis, penultimate step (AAC73293.1); Blastp hit
FT                   to AAC73293.1 (382 aa), 94% identity in aa 1 - 382"
FT                   /db_xref="EnsemblGenomes-Gn:STM0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19193"
FT                   /db_xref="GOA:Q8ZRN9"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRN9"
FT                   /protein_id="AAL19193.1"
FT                   /translation="MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNI
FT                   TLEGNLKKKGIKTIHYVSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVPCRF
FT                   IGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQR
FT                   YPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAADAVLELAQ"
FT   gene            268915..269525
FT                   /gene="rnhB"
FT                   /locus_tag="STM0230"
FT   regulatory      268915..268920
FT                   /gene="rnhB"
FT                   /locus_tag="STM0230"
FT                   /note="putative RBS for rnhB; RegulonDB:STMS1H000596"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        268929..269525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="STM0230"
FT                   /product="RNAse HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="ribonuclease HII. (SW:RNH2_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19194"
FT                   /db_xref="GOA:P0A2C1"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="PDB:1LJC"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2C1"
FT                   /protein_id="AAL19194.1"
FT                   /translation="MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLND
FT                   SKKLSEKRRLSLYDEIKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPELPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAQYGATAHHRRSFAPVKRALGLVS"
FT   gene            269536..273031
FT                   /gene="dnaE"
FT                   /locus_tag="STM0231"
FT   regulatory      269536..269541
FT                   /gene="dnaE"
FT                   /locus_tag="STM0231"
FT                   /note="putative RBS for dnaE; RegulonDB:STMS1H000597"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        269549..273031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="STM0231"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase III, alpha chain. (SW:DP3A_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19195"
FT                   /db_xref="GOA:P14567"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14567"
FT                   /protein_id="AAL19195.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIERDWLVELKEGLILLSGGRMGDVGRCLLRGNQALVEECVAFYEAHFP
FT                   DRYFLELIRTGRQDEETYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMTTEDYLVKKAKEGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREELSYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDEGEIVYGIGAIKGVGEGPIEAIIDARNQGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQTDMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            272938..274003
FT                   /gene="accA"
FT                   /locus_tag="STM0232"
FT   regulatory      272938..272946
FT                   /gene="accA"
FT                   /locus_tag="STM0232"
FT                   /note="putative -35_signal for accA;
FT                   RegulonDB:STMLTH004537"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      272964..272972
FT                   /gene="accA"
FT                   /locus_tag="STM0232"
FT                   /note="putative -10_signal for accA;
FT                   RegulonDB:STMLTH004537"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      273034..273039
FT                   /gene="accA"
FT                   /locus_tag="STM0232"
FT                   /note="putative RBS for accA; RegulonDB:STMS1H000598"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        273044..274003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="STM0232"
FT                   /product="acetylCoA carboxylase, carboxytransferase
FT                   component, alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="acetyl-coenzyme A carboxylase carboxyl transferase
FT                   subunit alpha. (SW:ACCA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19196"
FT                   /db_xref="GOA:P0A1C3"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1C3"
FT                   /protein_id="AAL19196.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
FT   gene            274177..275947
FT                   /locus_tag="STM0233"
FT   regulatory      274177..274182
FT                   /locus_tag="STM0233"
FT                   /note="putative RBS for STM0233; RegulonDB:STMS1H000599"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        274184..275947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0233"
FT                   /product="putative endochitinase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19197"
FT                   /db_xref="GOA:Q8ZRN8"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRN8"
FT                   /protein_id="AAL19197.1"
FT                   /translation="MGLQKTLALSAVAAGIMLSLSGAQAAPLLSSSEPMTINASDLAAK
FT                   EKALTDFPLMEAVKSSIQTLDNSAVEQIEPGRAANPANVKRVESILKEADWDYLFPMRA
FT                   PEYTYSNFLKAIGKFPAVCGTYTDGRDSDAICRKTLATMFAHFAQETGGHESWRDIPEW
FT                   RQALVYLREVGWTEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNY
FT                   NYGPFSDAMYGDVRPLLDKPELVADTWMNLASAVFFFVYPQPPKPSMLHVIDGTWQPND
FT                   RDKANGLVSGFGVTIQIINGGVECGGADENAQSLNRIAYYKEFANYLKVPVPADEVLGC
FT                   KKMKQFDEGGAGALPIYWEQDWGWSADTADGKTYSCQLVGYQTPYTAFKEGDYTKCVQH
FT                   YFNVNVVDDNGTTEPDVTPTPAPVTDENVAPVARIAGPVGAVEAGSPVSLSAEGSTDAN
FT                   GDKLTYTWMSQDGKTLSGQDKAVVIFNAPDVTQNTQYVVNLTVSDGTLSSTAVYTLNVK
FT                   AKAAAADDEDKTTSYPAWSSSQKWNPGDIVNSNGALYQCKPFPEGSWCNVAPAYYEPGV
FT                   GIAWADAWNAL"
FT   gene            276012..278164
FT                   /gene="ldcC"
FT                   /locus_tag="STM0234"
FT   regulatory      276012..276017
FT                   /gene="ldcC"
FT                   /locus_tag="STM0234"
FT                   /note="putative RBS for ldcC; RegulonDB:STMS1H000600"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        276023..278164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="STM0234"
FT                   /product="lysine decarboxylase 2, constitutive"
FT                   /EC_number="4.1.1.18"
FT                   /note="similar to E. coli lysine decarboxylase 2,
FT                   constitutive (AAC73297.1); Blastp hit to AAC73297.1 (713
FT                   aa), 91% identity in aa 1 - 712"
FT                   /db_xref="EnsemblGenomes-Gn:STM0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19198"
FT                   /db_xref="GOA:Q8ZRN7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRN7"
FT                   /protein_id="AAL19198.1"
FT                   /translation="MNIIAIMGPHGVYYKDEPIKELERALQSLGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSEINQLNEYLPLYAFINTNSTLDVSVHDMRMALWFFE
FT                   YALGLAEDIATRIHQYTNEYLDNITPPFTKALFTYAKEGKYTFCTPGHMAGTAYQKSPP
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTNGTST
FT                   SNKIVGMYAAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIPRREFT
FT                   RASIESKIEETPQAQWPVHAVITNSTYDGLLYNTNWIKQMLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGDRVPGKVIFETQSTHKMLAAFSQASLIHIKGEYDEETFNEAFMMHTST
FT                   SPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWFFDIWQPEE
FT                   VDEAECWPVTPGETWHGFTDADDDHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRVKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRQHDLPGLMLRAFEVLPEMIMTPHQAWQRQIKGEVETV
FT                   ALDQLPGRVSANMILPYPPGVPLLMPGERITQQSRAVLDFLLMLCSIGQHYPGFETDIH
FT                   GAKRNEDGVYQVRVLKHAC"
FT   gene            278209..278609
FT                   /gene="yaeR"
FT                   /locus_tag="STM0235"
FT   regulatory      278209..278214
FT                   /gene="yaeR"
FT                   /locus_tag="STM0235"
FT                   /note="putative RBS for yaeR; RegulonDB:STMS1H000601"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        278220..278609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="STM0235"
FT                   /product="putative lactoylglutathione lyase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73298.1); Blastp hit to AAC73298.1 (138 aa), 88%
FT                   identity in aa 10 - 138"
FT                   /db_xref="EnsemblGenomes-Gn:STM0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19199"
FT                   /db_xref="GOA:Q8ZRN6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRN6"
FT                   /protein_id="AAL19199.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFDLLSEVWREERDSWK
FT                   GDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIR
FT                   IDPYTGKRFTFFNDPDGLPLELYEQ"
FT   gene            278665..279964
FT                   /gene="mesJ"
FT                   /locus_tag="STM0236"
FT   regulatory      278665..278670
FT                   /gene="mesJ"
FT                   /locus_tag="STM0236"
FT                   /note="putative RBS for mesJ; RegulonDB:STMS1H000602"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        278672..279964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="STM0236"
FT                   /product="cell cycle protein"
FT                   /note="similar to E. coli cell cycle protein (AAC73299.1);
FT                   Blastp hit to AAC73299.1 (432 aa), 76% identity in aa 2 -
FT                   427"
FT                   /db_xref="EnsemblGenomes-Gn:STM0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19200"
FT                   /db_xref="GOA:Q8ZRN5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRN5"
FT                   /protein_id="AAL19200.1"
FT                   /translation="MTTLTLNTSLLSSRRILAAFSGGLDSTVLLHQLVLWRERHPDVTL
FT                   RAIHIHHGLSPHADSWVRHCETVCERWQVPLVVERVTLADNGLGIEAHAREARYRAFAQ
FT                   TLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRETRKT
FT                   LEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFPAAVARSATLCAEQER
FT                   LLDELLASDLTDCITAEGTLRLSPLMSMSDVRRAAILRRWLAMRNAPMPSRDALERIWQ
FT                   EVALARDDASPCLRFGDHEIRRYQSQLWWIKSVAGQHETTVAWPVWQTPLALPAGLGTV
FT                   QLVPGGELRRPREEESVSIRFKAPGVLHIVGRNGGRKLKKIWQEQGIPPWRRDTTPLLF
FT                   YGETLIAAAGVFVTREGAAEDKEGVSLVWHA"
FT   gene            complement(280048..280321)
FT                   /gene="rof"
FT                   /locus_tag="STM0237"
FT   CDS_pept        complement(280048..280308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="STM0237"
FT                   /product="modulator of Rho-dependent transcription
FT                   termination"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73300.1); Blastp hit to AAC73300.1 (86 aa), 81%
FT                   identity in aa 1 - 86"
FT                   /db_xref="EnsemblGenomes-Gn:STM0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19201"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRN4"
FT                   /protein_id="AAL19201.1"
FT                   /translation="MSMNETYQPINCDDYDSLELACMHHLILTLTLKDGEVLQAKANDL
FT                   ILRKNVEYLLAEVSGESCELRLDKIASFSHPEIGTVVVSES"
FT   gene            complement(280295..280517)
FT                   /gene="yaeP"
FT                   /locus_tag="STM0238"
FT   CDS_pept        complement(280295..280513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="STM0238"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19202"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67551"
FT                   /protein_id="AAL19202.1"
FT                   /translation="MLTGGHVEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAA
FT                   DSALSESVREKAAYAAANLLVSDYVNE"
FT   regulatory      complement(280316..280321)
FT                   /gene="yaeP"
FT                   /locus_tag="STM0238"
FT                   /note="putative RBS for rof; RegulonDB:STMS1H000603"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(280512..280517)
FT                   /gene="yaeP"
FT                   /locus_tag="STM0238"
FT                   /note="putative RBS for yaeP; RegulonDB:STMS1H000604"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            280680..281238
FT                   /gene="yaeQ"
FT                   /locus_tag="STM0239"
FT   regulatory      280680..280685
FT                   /gene="yaeQ"
FT                   /locus_tag="STM0239"
FT                   /note="putative RBS for yaeQ; RegulonDB:STMS1H000605"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        280693..281238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="STM0239"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical 20.8 Kda protein in mesJ-cutF
FT                   intergenic region. (SW:YAEQ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19203"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1S6"
FT                   /protein_id="AAL19203.1"
FT                   /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVAL
FT                   FAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWL
FT                   SDARNNLEIQLTAWQQPS"
FT   gene            281220..281657
FT                   /gene="yaeJ"
FT                   /locus_tag="STM0240"
FT   regulatory      281220..281225
FT                   /gene="yaeJ"
FT                   /locus_tag="STM0240"
FT                   /note="putative RBS for yaeJ; RegulonDB:STMS1H000606"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        281235..281657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="STM0240"
FT                   /product="putative-tRNA hydrolase domain protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73302.1); Blastp hit to AAC73302.1 (140 aa), 85%
FT                   identity in aa 1 - 136"
FT                   /db_xref="EnsemblGenomes-Gn:STM0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19204"
FT                   /db_xref="GOA:Q8ZRN3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="PDB:2JY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRN3"
FT                   /protein_id="AAL19204.1"
FT                   /translation="MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRA
FT                   SGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKS
FT                   RRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLD"
FT   gene            281689..282394
FT                   /pseudo
FT                   /gene="cutF"
FT                   /locus_tag="STM0241"
FT                   /note="pseudogene; frameshift relative to E. coli cutF
FT                   (SW:CUTF_ECOLI); copper homeostasis protein"
FT   gene            complement(282468..284202)
FT                   /gene="proS"
FT                   /locus_tag="STM0242"
FT   CDS_pept        complement(282468..284186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="STM0242"
FT                   /product="proline tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="similar to E. coli proline tRNA synthetase
FT                   (AAC73305.1); Blastp hit to AAC73305.1 (572 aa), 95%
FT                   identity in aa 1 - 572"
FT                   /db_xref="EnsemblGenomes-Gn:STM0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19205"
FT                   /db_xref="GOA:Q7CR62"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR62"
FT                   /protein_id="AAL19205.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSDVSDYAANIELAEAIAPQTPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTL
FT                   LVKAVKDSKSPLVALLVRGDHELNEVKAEKLPHVASPLTFATEEEIRAVINAGPGSLGP
FT                   VNMPIPVIIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPVVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NFDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLMDDRKERPG
FT                   VMFADMELIGIPHTIVIGDRNLDNDDIEYKYRRSGEKSLIKTGDIVDYLVKAIKG"
FT   regulatory      complement(284197..284202)
FT                   /gene="proS"
FT                   /locus_tag="STM0242"
FT                   /note="putative RBS for proS; RegulonDB:STMS1H000608"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(284297..285012)
FT                   /gene="yaeB"
FT                   /locus_tag="STM0243"
FT   CDS_pept        complement(284297..285004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="STM0243"
FT                   /product="putative regulator"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73306.1); Blastp hit to AAC73306.1 (235 aa), 89%
FT                   identity in aa 1 - 235"
FT                   /db_xref="EnsemblGenomes-Gn:STM0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19206"
FT                   /db_xref="GOA:Q8ZRN2"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRN2"
FT                   /protein_id="AAL19206.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSACGELHLIAPYNQA
FT                   DAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VALKGIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASYAQQAPIAEMPV
FT                   SFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   VNSGFEVFALEPR"
FT   gene            complement(285001..285416)
FT                   /gene="rcsF"
FT                   /locus_tag="STM0244"
FT   CDS_pept        complement(285001..285405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="STM0244"
FT                   /product="regulator in colanic acid synthesis"
FT                   /note="overexpression confers mucoid phenotype; increases
FT                   capsule synthesis; similar to E. coli regulator in colanic
FT                   acid synthesis; interacts with RcsB (AAC73307.1); Blastp
FT                   hit to AAC73307.1 (134 aa), 91% identity in aa 1 - 134"
FT                   /db_xref="EnsemblGenomes-Gn:STM0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19207"
FT                   /db_xref="GOA:Q7CR61"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR61"
FT                   /protein_id="AAL19207.1"
FT                   /translation="MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPR
FT                   AAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAV
FT                   LLHSCEITSGTPGCYRQAVCIGSALNISAK"
FT   regulatory      complement(285007..285012)
FT                   /gene="rcsF"
FT                   /locus_tag="STM0244"
FT                   /note="putative RBS for yaeB; RegulonDB:STMS1H000609"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(285411..285416)
FT                   /gene="rcsF"
FT                   /locus_tag="STM0244"
FT                   /note="putative RBS for rcsF; RegulonDB:STMS1H000610"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(285524..286351)
FT                   /gene="yaeC"
FT                   /locus_tag="STM0245"
FT   CDS_pept        complement(285524..286339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeC"
FT                   /locus_tag="STM0245"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to E. coli putative lipoprotein
FT                   (AAC73308.1); Blastp hit to AAC73308.1 (271 aa), 96%
FT                   identity in aa 1 - 271"
FT                   /db_xref="EnsemblGenomes-Gn:STM0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19208"
FT                   /db_xref="GOA:Q8ZRN1"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRN1"
FT                   /protein_id="AAL19208.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   SVGKTFVYPIAGYSKKIKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   regulatory      complement(286346..286351)
FT                   /gene="yaeC"
FT                   /locus_tag="STM0245"
FT                   /note="putative RBS for yaeC; RegulonDB:STMS1H000611"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(286378..287044)
FT                   /gene="yaeE"
FT                   /locus_tag="STM0246"
FT   CDS_pept        complement(286378..287031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="STM0246"
FT                   /product="putative ABC superfamily (membrane) transport
FT                   protein"
FT                   /note="similar to E. coli putative transport system
FT                   permease protein (AAC73309.1); Blastp hit to AAC73309.1
FT                   (217 aa), 93% identity in aa 1 - 217"
FT                   /db_xref="EnsemblGenomes-Gn:STM0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19209"
FT                   /db_xref="GOA:Q8ZRN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRN0"
FT                   /protein_id="AAL19209.1"
FT                   /translation="MSEAMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IMENARLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
FT   gene            complement(287024..288063)
FT                   /gene="abc"
FT                   /locus_tag="STM0247"
FT   CDS_pept        complement(287024..288055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abc"
FT                   /locus_tag="STM0247"
FT                   /product="putative ABC superfamily (atp_bind) transport
FT                   system"
FT                   /note="similar to E. coli ATP-binding component of a
FT                   transporter (AAC73310.1); Blastp hit to AAC73310.1 (343
FT                   aa), 95% identity in aa 1 - 343"
FT                   /db_xref="EnsemblGenomes-Gn:STM0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19210"
FT                   /db_xref="GOA:Q8ZRM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRM9"
FT                   /protein_id="AAL19210.1"
FT                   /translation="MIKLSNITKVFQQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVQVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPMLRMEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEETQAAIAWLQDHHVKVEVL
FT                   GYV"
FT   regulatory      complement(287039..287044)
FT                   /gene="yaeE"
FT                   /locus_tag="STM0246"
FT                   /note="putative RBS for yaeE; RegulonDB:STMS1H000612"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(288058..288063)
FT                   /gene="abc"
FT                   /locus_tag="STM0247"
FT                   /note="putative RBS for abc; RegulonDB:STMS1H000613"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            288230..288811
FT                   /gene="yaeD"
FT                   /locus_tag="STM0248"
FT   regulatory      288230..288235
FT                   /gene="yaeD"
FT                   /locus_tag="STM0248"
FT                   /note="putative RBS for yaeD; RegulonDB:STMS1H000614"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        288245..288811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeD"
FT                   /locus_tag="STM0248"
FT                   /product="putative dehydratase"
FT                   /note="similar to E. coli putative phosphatase
FT                   (AAC73311.1); Blastp hit to AAC73311.1 (191 aa), 94%
FT                   identity in aa 1 - 188"
FT                   /db_xref="EnsemblGenomes-Gn:STM0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19211"
FT                   /db_xref="GOA:Q8ZRM8"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRM8"
FT                   /protein_id="AAL19211.1"
FT                   /translation="MAKFVPAIFLDRDGTINVDHGYVHEIDAFEFIDGVIDAMRELKKM
FT                   GYALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSIEEFR
FT                   QVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKPVTA
FT                   EAENAADWVLNSLADLPSAIKKQQK"
FT   gene            289190..290733
FT                   /gene="rrsH"
FT                   /locus_tag="STM0249"
FT   rRNA            289190..290733
FT                   /gene="rrsH"
FT                   /locus_tag="STM0249"
FT                   /product="16S ribosomal RNA"
FT   gene            290801..290874
FT                   /gene="ileV"
FT                   /locus_tag="STM0250"
FT   tRNA            290801..290874
FT                   /gene="ileV"
FT                   /locus_tag="STM0250"
FT                   /product="tRNA-Ile"
FT   gene            290987..291059
FT                   /gene="alaV"
FT                   /locus_tag="STM0251"
FT   tRNA            290987..291059
FT                   /gene="alaV"
FT                   /locus_tag="STM0251"
FT                   /product="tRNA-Asx"
FT   gene            291245..294337
FT                   /gene="rrlH"
FT                   /locus_tag="STM0252"
FT   rRNA            291245..294337
FT                   /gene="rrlH"
FT                   /locus_tag="STM0252"
FT                   /product="23S ribosomal RNA"
FT   gene            294520..294641
FT                   /gene="rrfH"
FT                   /locus_tag="STM0253"
FT   rRNA            294520..294641
FT                   /gene="rrfH"
FT                   /locus_tag="STM0253"
FT                   /product="5S ribosomal RNA"
FT   gene            294839..294912
FT                   /gene="aspU"
FT                   /locus_tag="STM0254"
FT   tRNA            294839..294912
FT                   /gene="aspU"
FT                   /locus_tag="STM0254"
FT                   /product="tRNA-Val"
FT   gene            295060..295873
FT                   /gene="yafB"
FT                   /locus_tag="STM0255"
FT   regulatory      295060..295065
FT                   /gene="yafB"
FT                   /locus_tag="STM0255"
FT                   /note="putative RBS for yafB; RegulonDB:STMS1H000620"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        295070..295873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafB"
FT                   /locus_tag="STM0255"
FT                   /product="2,5-diketo-D-gluconate reductase B"
FT                   /EC_number="1.1.1.-"
FT                   /note="similar to E. coli putative aldose reductase
FT                   (AAC73312.1); Blastp hit to AAC73312.1 (267 aa), 92%
FT                   identity in aa 1 - 267"
FT                   /db_xref="EnsemblGenomes-Gn:STM0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19212"
FT                   /db_xref="GOA:Q8ZRM7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRM7"
FT                   /protein_id="AAL19212.1"
FT                   /translation="MTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQIYDNEAAV
FT                   GQAIAESGVPRNELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSPGDA
FT                   VSVEEFMQALLEAKKQGLTREIGISNFTIPLMEKAIAAVGADNIATNQIELSPYLQNRK
FT                   VVDWAKAHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSS
FT                   TRRENLASSLLAQDLHLDAEDKNAIAALDCNDRLVSPEGLAPAWD"
FT   gene            complement(295894..296819)
FT                   /gene="yafC"
FT                   /locus_tag="STM0256"
FT   CDS_pept        complement(295894..296808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="STM0256"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="similar to E. coli putative transcriptional
FT                   regulator LYSR-type (AAC73313.1); Blastp hit to AAC73313.1
FT                   (304 aa), 90% identity in aa 1 - 303"
FT                   /db_xref="EnsemblGenomes-Gn:STM0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19213"
FT                   /db_xref="GOA:Q8ZRM6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM6"
FT                   /protein_id="AAL19213.1"
FT                   /translation="MKATSEELAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQQILQEMAAAETEIMESRNTPRGLLRIDAATPVM
FT                   LHFLMPLIKPFRERYPEITLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLFTSY
FT                   RKIIASPDYIARFGKPETVEELKRHLCLGFSEPVSLNTWPIACSDGQLHEIKCGISSNS
FT                   GETLKQLCLNGNGIACLSDYMIDKEIARGELVELLADKRLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEYIRTAPAGAVKEG"
FT   regulatory      complement(296814..296819)
FT                   /gene="yafC"
FT                   /locus_tag="STM0256"
FT                   /note="putative RBS for yafC; RegulonDB:STMS1H000621"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            296901..298088
FT                   /locus_tag="STM0257"
FT   regulatory      296901..296906
FT                   /locus_tag="STM0257"
FT                   /note="putative RBS for STM0257; RegulonDB:STMS1H000622"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        296913..298088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0257"
FT                   /product="putative drug efflux protein (perhaps for
FT                   chloramphenicol)"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC74729.1); Blastp hit to AAC74729.1 (389 aa), 41%
FT                   identity in aa 7 - 378"
FT                   /db_xref="EnsemblGenomes-Gn:STM0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19214"
FT                   /db_xref="GOA:Q8ZRM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM5"
FT                   /protein_id="AAL19214.1"
FT                   /translation="MPLALFALTISAFAIGTTEFVIVGLVPTIAQQLAISLPSAGMLVS
FT                   IYALGVAIGAPVLTALTGRLPRKQLLVALMVLFTAGNLLAWQAPGYMTLIVARLLTGLA
FT                   HGVFFSIGSTIATSLVPKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETFLAV
FT                   SLLGVIALMSSQLLIPANIPGRAAASIRDQVKVLTHPRLLLIYAVTALGYGGVFTAFTF
FT                   LAPMMQDLAGFSPAAVSWILLGYGVSVAIGNIWGGKLADKHGAVPALKFIFAALFVLLM
FT                   VFQVTASTQYAALATILVMGVFAFGNVPGLQVYVVQKAEQFTPNAVDVASGLNIAAFNI
FT                   GIALGSVIGGQTVEHYGLAQTPWIGALIVLVAFLLMGVSGRLDKPVRIALE"
FT   gene            298241..299020
FT                   /gene="yafD"
FT                   /locus_tag="STM0258"
FT   CDS_pept        298241..299020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="STM0258"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73314.1); Blastp hit to AAC73314.1 (266 aa), 96%
FT                   identity in aa 8 - 266"
FT                   /db_xref="EnsemblGenomes-Gn:STM0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19215"
FT                   /db_xref="GOA:Q8ZRM4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRM4"
FT                   /protein_id="AAL19215.1"
FT                   /translation="MRYVAGQPAERILPPGSFASIGQALPAGEPLSNEERIRILVWNIF
FT                   KQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLPQHPSGVM
FT                   TLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNVHAVNFSLGVDVYSKQ
FT                   LLPIGDQIAHHSGPVIMAGDFNAWSRPRMNALYRFAREMSLRQVRFTDDQRRRAFGRPL
FT                   DFVFYRGLNVNEASVLVTRASDHNPLLVEFSPGKPEQ"
FT   gene            299083..299868
FT                   /gene="yafE"
FT                   /locus_tag="STM0259"
FT   regulatory      299083..299088
FT                   /gene="yafE"
FT                   /locus_tag="STM0259"
FT                   /note="putative RBS for yafE; RegulonDB:STMS1H000623"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        299098..299868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="STM0259"
FT                   /product="putative methyltransferase in menaquinone/biotin
FT                   biosynthesis"
FT                   /note="similar to E. coli putative biotin synthesis protein
FT                   (AAC73315.1); Blastp hit to AAC73315.1 (207 aa), 71%
FT                   identity in aa 3 - 206"
FT                   /db_xref="EnsemblGenomes-Gn:STM0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19216"
FT                   /db_xref="GOA:Q8ZRM3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM3"
FT                   /protein_id="AAL19216.1"
FT                   /translation="MTTHSHHDNVEKQFGSQANAYLHSAVHAAGRDLARLAQRLSDFSH
FT                   ASVLDMGCGAGHASFVAAQHANSVVAYDLSASMLEVVAGAAEERHLSNITLRQGYAEKL
FT                   PFEDASFEVVISRYSAHHWHDVGQALREVNRVLKPGGVLIIMDVMSPGHPVRDIWLQTV
FT                   EALRDTSHVRNYSSGEWLAMVNNAMLVTNTVITDRLSLEFRSWVTRMRTPAPLVEAIRL
FT                   YQASAPVEVKRYFELQDDGSFSSDTIMLEAHKAV"
FT   gene            complement(299924..301291)
FT                   /gene="dniR"
FT                   /locus_tag="STM0260"
FT   CDS_pept        complement(299924..301291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dniR"
FT                   /locus_tag="STM0260"
FT                   /product="transcriptional regulator for nitrite reductase
FT                   (cytochrome c552)"
FT                   /EC_number="3.2.1.-"
FT                   /note="similar to E. coli transcriptional regulator for
FT                   nitrite reductase (cytochrome c552) (AAC73316.1); Blastp
FT                   hit to AAC73316.1 (452 aa), 91% identity in aa 1 - 452"
FT                   /db_xref="EnsemblGenomes-Gn:STM0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19217"
FT                   /db_xref="GOA:Q7CR60"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR60"
FT                   /protein_id="AAL19217.1"
FT                   /translation="MKAKAILLASVLLVGCQTSQNTGNVQQHAQSLSAAGQGEAGKFTS
FT                   QARWMDDGTSIAPDQDLWAFIGDELKMGIPENSRIREQKQKYLRNKSYLHDVTLRAEPY
FT                   MYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNY
FT                   DARRDVVASTTAALDMMQRLNKMFDGDWLLTVAAYNSGEGRVMRAIKANKARGKPTDFW
FT                   SLSLPRETKLYVPKMLALSEILKNSKRYGVRLPTTDESRALARVRLNSPVEMAQVADMA
FT                   GMSISKLKTFNAGVKGSTLGVSGPQYVMVPKKHAEQLRESLASGEIDAVQSQLIADNTP
FT                   LNSRSYKVRSGDTLSGIASRLGVSTKDLQQWNNLRGSRLKIGQSLTVGAGSSAQRLANN
FT                   SDSITYRVRKGDSLSSIARRHGVNIKDVMRWNHDTDNLQPGDQLTLFVKDNSTPDS"
FT   gene            complement(301363..302128)
FT                   /gene="gloB"
FT                   /locus_tag="STM0261"
FT   CDS_pept        complement(301363..302118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="STM0261"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="similar to E. coli probable hydroxyacylglutathione
FT                   hydrolase (AAC73317.1); Blastp hit to AAC73317.1 (251 aa),
FT                   78% identity in aa 1 - 251"
FT                   /db_xref="EnsemblGenomes-Gn:STM0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19218"
FT                   /db_xref="GOA:Q8ZRM2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="PDB:2QED"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRM2"
FT                   /protein_id="AAL19218.1"
FT                   /translation="MNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWM
FT                   PEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKFTL
FT                   FATPGHTLGHVCYFSRPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICC
FT                   AHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDI
FT                   DLINEINKETILQQPEARFAWLRSKKDTF"
FT   regulatory      complement(302123..302128)
FT                   /gene="gloB"
FT                   /locus_tag="STM0261"
FT                   /note="putative RBS for gloB; RegulonDB:STMS1H000624"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            302140..302875
FT                   /gene="yafS"
FT                   /locus_tag="STM0262"
FT   regulatory      302140..302145
FT                   /gene="yafS"
FT                   /locus_tag="STM0262"
FT                   /note="putative RBS for yafS; RegulonDB:STMS1H000625"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        302153..302875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="STM0262"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73318.1); Blastp hit to AAC73318.1 (246 aa), 86%
FT                   identity in aa 7 - 244"
FT                   /db_xref="EnsemblGenomes-Gn:STM0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19219"
FT                   /db_xref="GOA:Q8ZRM1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM1"
FT                   /protein_id="AAL19219.1"
FT                   /translation="MKPARLSQTVVAPGCWGELPWGNYYREALEQQLNPWFAKMYGFHL
FT                   LKIGNLSAEINSEACAVSHQVNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCT
FT                   DPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHYSRFHVLPWKKQGGRLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSK
FT                   TPIRQTVGATRQYRKPDG"
FT   gene            complement(302872..303356)
FT                   /gene="rnhA"
FT                   /locus_tag="STM0263"
FT   CDS_pept        complement(302872..303339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="STM0263"
FT                   /product="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="degrades RNA of DNA-RNA hybrids; ribonuclease HI.
FT                   (SW:RNH_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19220"
FT                   /db_xref="GOA:P0A2B9"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2B9"
FT                   /protein_id="AAL19220.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGHEKTFSEGYTLTTNN
FT                   RMELMAAIVALEALKEHCEVTLSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVDLW
FT                   KRLDAALGQHQIKWVWVKGHAGHPENERCDELARAAAMNPTQEDSGYQAEA"
FT   regulatory      complement(303351..303356)
FT                   /gene="rnhA"
FT                   /locus_tag="STM0263"
FT                   /note="putative RBS for rnhA; RegulonDB:STMS1H000626"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            303403..304134
FT                   /gene="dnaQ"
FT                   /locus_tag="STM0264"
FT   CDS_pept        303403..304134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="STM0264"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="3-5 exonucleolytic proofreading function; DNA
FT                   polymerase III, epsilon chain. (SW:DP3E_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19221"
FT                   /db_xref="GOA:P0A1G9"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1G9"
FT                   /protein_id="AAL19221.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNASFDI
FT                   GFMDYEFGLLKRDIPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFASEEEL
FT                   AAHESRLDLVQKKGGSCLWRA"
FT   gene            304278..304351
FT                   /gene="aspV"
FT                   /locus_tag="STM0265"
FT   tRNA            304278..304351
FT                   /gene="aspV"
FT                   /locus_tag="STM0265"
FT                   /product="tRNA-Sec"
FT   gene            complement(304666..305721)
FT                   /locus_tag="STM0266"
FT   CDS_pept        complement(304666..305721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0266"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19222"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IT5"
FT                   /protein_id="AAL19222.1"
FT                   /translation="MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVS
FT                   TPEAVNWPEIERDARRLLTRSKDIRVLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSD
FT                   ALHPQLLTGEGASAESIEDASLARSNALAALLDHEGVMADIRGITLSNSAALRLQVRDV
FT                   ERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVWARETLGDLAP
FT                   DFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGIS
FT                   LPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIP
FT                   VELLEKWDALE"
FT   gene            complement(305732..306732)
FT                   /locus_tag="STM0267"
FT   CDS_pept        complement(305732..306727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0267"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19223"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM0"
FT                   /protein_id="AAL19223.1"
FT                   /translation="MTGALNQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFR
FT                   LGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPT
FT                   LVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLS
FT                   DHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQS
FT                   SVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCW
FT                   EIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH"
FT   gene            complement(306724..308613)
FT                   /locus_tag="STM0268"
FT   CDS_pept        complement(306724..308607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0268"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19224"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL9"
FT                   /protein_id="AAL19224.1"
FT                   /translation="MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPY
FT                   VERMIEAFSFLSARTQLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDL
FT                   AKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHRYLP
FT                   PNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVATLAGE
FT                   PGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTGL
FT                   SAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSV
FT                   TEQHLVVDRTRPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRRE
FT                   PRRSSENARRYGTRTPYTGSEVFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRN
FT                   GRDDLTVDAAIPVAGVGLIRPPRPPQPPLAEREMAWRLIRQLSFNYLPLADLDHRTGGQ
FT                   ALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGF
FT                   SGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV"
FT   regulatory      complement(306727..306732)
FT                   /locus_tag="STM0267"
FT                   /note="putative RBS for STM0267; RegulonDB:STMS1H000628"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(308608..308613)
FT                   /locus_tag="STM0268"
FT                   /note="putative RBS for STM0268; RegulonDB:STMS1H000629"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(308623..309125)
FT                   /locus_tag="STM0269"
FT   CDS_pept        complement(308623..309117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0269"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19225"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IT2"
FT                   /protein_id="AAL19225.1"
FT                   /translation="MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIR
FT                   RDLSFLLNTISHEGDIDARRYPQAAASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIR
FT                   FEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQILTQPYPTEFLVRSALDMELSRITF
FT                   F"
FT   gene            complement(309114..309944)
FT                   /locus_tag="STM0270"
FT   CDS_pept        complement(309114..309938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0270"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19226"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL8"
FT                   /protein_id="AAL19226.1"
FT                   /translation="MKKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLF
FT                   QLLCVAGDWSRALHQLQLCARMEANYTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQ
FT                   PVWVESLLAALACHDDTGEVDKHRNTALEAITDTGGQWNGGAFDWASDSDSRLGPVLEL
FT                   VTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWLFTRYSGSESASD
FT                   ALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA"
FT   regulatory      complement(309120..309125)
FT                   /locus_tag="STM0269"
FT                   /note="putative RBS for STM0269; RegulonDB:STMS1H000630"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(309925..310832)
FT                   /locus_tag="STM0271"
FT   CDS_pept        complement(309925..310827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0271"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19227"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IT0"
FT                   /protein_id="AAL19227.1"
FT                   /translation="MKQDMWELRKIQSQGITDNAQYPAGTYIVFTAAAPYIPLFEQHGK
FT                   DDIALSLVRHEEAWWIVNHSDELCCAVNEQVMEPHHRMRLNDGDTIEWGLSSWCLARTN
FT                   DESRPDVSFPQLVQSSESVAEYLDLDWFKQQQLNPQNPFDIIPVRETASSYTGHEADST
FT                   LHQLYQEYQQALRPSGQEKPLRAKPFPRNEDAVTQDLTSLYDKKGDTDTLQDMVAGAPG
FT                   IDAILDTLDTTGEGEMHWLAMESMPDILQLLSPELGGKTAHSEILPDLTRREHRIIGID
FT                   SHYRITPTQKNGNTAHEKN"
FT   regulatory      complement(309939..309944)
FT                   /locus_tag="STM0270"
FT                   /note="putative RBS for STM0270; RegulonDB:STMS1H000631"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(310827..310832)
FT                   /locus_tag="STM0271"
FT                   /note="putative RBS for STM0271; RegulonDB:STMS1H000632"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            311190..313834
FT                   /locus_tag="STM0272"
FT   regulatory      311190..311195
FT                   /locus_tag="STM0272"
FT                   /note="putative RBS for STM0272; RegulonDB:STMS1H000633"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        311195..313834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0272"
FT                   /product="putative ATPase with chaperone activity"
FT                   /note="homolog of Yersinia clpB; similar to E. coli
FT                   ATP-binding component of serine protease (AAC73969.1);
FT                   Blastp hit to AAC73969.1 (758 aa), 42% identity in aa 150 -
FT                   449, 40% identity in aa 421 - 685, 32% identity in aa 30 -
FT                   74"
FT                   /db_xref="EnsemblGenomes-Gn:STM0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19228"
FT                   /db_xref="GOA:Q93IS9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IS9"
FT                   /protein_id="AAL19228.1"
FT                   /translation="METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQ
FT                   LTQQPDNDILHVLRHYQIPLSDVEKALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLA
FT                   SVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPEAQE
FT                   RPYDGSGLASAIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREHEIRT
FT                   MTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLAG
FT                   ASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGT
FT                   LRTIGATTWSEYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLIL
FT                   DEAVRAAVQLSHRYIPARQLPDKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEME
FT                   RSLLQKQEKMGIQSDERRDALMARIFSLNNELTASESRWQRELELVHTLQELRLAESDA
FT                   DDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIPAGRMVKDEASQVLELP
FT                   ARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALALAEAI
FT                   YGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEK
FT                   AHHDVHELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATG
FT                   LKEALMPELRKHFPAAFLGRVTVIPYLPLDETSRGVIARLHLDRLVARMSEQHGVTLTY
FT                   SEELVAHIVACCPMHETGARLLIGYIEQHILPRLSRYWLQAMTEKAAIRQIDIGVNGDE
FT                   QIVFEIVC"
FT   gene            313927..314476
FT                   /locus_tag="STM0273"
FT   regulatory      313927..313932
FT                   /locus_tag="STM0273"
FT                   /note="putative RBS for STM0273; RegulonDB:STMS1H000634"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        313934..314476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0273"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19229"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IS8"
FT                   /protein_id="AAL19229.1"
FT                   /translation="MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLAD
FT                   LAGKPREELPPVTDRKFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENM
FT                   DDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAP
FT                   KSAATQQDVSADNESAE"
FT   gene            314493..316008
FT                   /locus_tag="STM0274"
FT   regulatory      314493..314498
FT                   /locus_tag="STM0274"
FT                   /note="putative RBS for STM0274; RegulonDB:STMS1H000635"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        314500..316008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0274"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19230"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL7"
FT                   /protein_id="AAL19230.1"
FT                   /translation="MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAA
FT                   VQTLAQQALANTITVSDDAYKSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEH
FT                   LVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGC
FT                   IIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVT
FT                   QNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVW
FT                   SNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAIS
FT                   DRREAELAKNGFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFAC
FT                   SRFAHFLKCIVRDKIGSFKEREDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVV
FT                   VEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLPSVKQGNA"
FT   gene            316071..316181
FT                   /locus_tag="STM0274A"
FT   CDS_pept        316071..316181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0274A"
FT                   /product="invasol SirA"
FT                   /db_xref="EnsemblGenomes-Gn:STM0274A"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19231"
FT                   /db_xref="UniProtKB/TrEMBL:H9L425"
FT                   /protein_id="AAL19231.1"
FT                   /translation="MKKRISSRPRSRKGGVRNDDTYPNASNNAEAFYIIE"
FT   gene            316308..316640
FT                   /locus_tag="STM0275"
FT   CDS_pept        316308..316640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0275"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19232"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL6"
FT                   /protein_id="AAL19232.1"
FT                   /translation="MSLKSDVPAAWQLSPRYMSRLWLSSIGVTQGKPENLMDLKPETKK
FT                   VNGENWSVWETERGSDKETDRYWVSCIYGHEQIWLTQPIPASSTRCKTRNFEGSPEDQS
FT                   VSFICN"
FT   gene            316888..317379
FT                   /locus_tag="STM0276"
FT   regulatory      316888..316893
FT                   /locus_tag="STM0276"
FT                   /note="putative RBS for STM0276; RegulonDB:STMS1H000636"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        316894..317379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0276"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19233"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR58"
FT                   /protein_id="AAL19233.1"
FT                   /translation="MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSG
FT                   LGSGKVSVTNLDFDHYIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDL
FT                   IVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI"
FT   gene            317678..318169
FT                   /locus_tag="STM0277"
FT   regulatory      317678..317683
FT                   /locus_tag="STM0277"
FT                   /note="putative RBS for STM0277; RegulonDB:STMS1H000637"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        317684..318169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0277"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19234"
FT                   /db_xref="InterPro:IPR025562"
FT                   /db_xref="PDB:4HFF"
FT                   /db_xref="PDB:4J30"
FT                   /db_xref="PDB:4J32"
FT                   /db_xref="PDB:4JUR"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IS4"
FT                   /protein_id="AAL19234.1"
FT                   /translation="MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACP
FT                   IRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQS
FT                   DFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWILP"
FT   gene            318150..318537
FT                   /locus_tag="STM0278"
FT   regulatory      318150..318155
FT                   /locus_tag="STM0278"
FT                   /note="putative RBS for STM0278; RegulonDB:STMS1H000638"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        318154..318537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0278"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19235"
FT                   /db_xref="InterPro:IPR032032"
FT                   /db_xref="InterPro:IPR038314"
FT                   /db_xref="PDB:4HFF"
FT                   /db_xref="PDB:4J30"
FT                   /db_xref="PDB:4J32"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL5"
FT                   /protein_id="AAL19235.1"
FT                   /translation="MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWAL
FT                   SHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFN
FT                   TMKCIDFIHDRELNELIKRRVEK"
FT   gene            318674..319165
FT                   /locus_tag="STM0279"
FT   regulatory      318674..318679
FT                   /locus_tag="STM0279"
FT                   /note="putative RBS for STM0279; RegulonDB:STMS1H000639"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        318680..319165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0279"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19236"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IS3"
FT                   /protein_id="AAL19236.1"
FT                   /translation="MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSG
FT                   LGSGKVSVTNLSFEHYIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDL
FT                   IIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI"
FT   gene            319225..319768
FT                   /locus_tag="STM0280"
FT   regulatory      319225..319230
FT                   /locus_tag="STM0280"
FT                   /note="putative RBS for STM0280; RegulonDB:STMS1H000640"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        319232..319768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0280"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19237"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL4"
FT                   /protein_id="AAL19237.1"
FT                   /translation="MNEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVK
FT                   ASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRP
FT                   GEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFISGKGKVQLE
FT                   AELEQSAIVITERDK"
FT   gene            319768..321115
FT                   /locus_tag="STM0281"
FT   regulatory      319768..319773
FT                   /locus_tag="STM0281"
FT                   /note="putative RBS for STM0281; RegulonDB:STMS1H000641"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        319772..321115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0281"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19238"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IS1"
FT                   /protein_id="AAL19238.1"
FT                   /translation="MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGF
FT                   SHYNIDGEALNIGKLILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPV
FT                   RAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAW
FT                   IGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLT
FT                   GSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRPQ
FT                   TRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSD
FT                   LADFSTLVLAIKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQI
FT                   PFQAGYIYYDIRREGALWEHIARYGGMAMHTAGEFPGLETELWGVRDK"
FT   gene            321106..322416
FT                   /locus_tag="STM0282"
FT   regulatory      321106..321111
FT                   /locus_tag="STM0282"
FT                   /note="putative RBS for STM0282; RegulonDB:STMS1H000642"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        321112..322416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0282"
FT                   /product="putative outer membrane protein, OmpA family"
FT                   /note="similar to E. coli putative outer membrane protein
FT                   (AAC76576.1); Blastp hit to AAC76576.1 (219 aa), 44%
FT                   identity in aa 145 - 214"
FT                   /db_xref="EnsemblGenomes-Gn:STM0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19239"
FT                   /db_xref="GOA:Q93IS0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IS0"
FT                   /protein_id="AAL19239.1"
FT                   /translation="MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVE
FT                   DGPDSKLRLAEISAAANPLLAAARPLLCALAAMPAKLDAALVEPYRNLLVREMHLYQTL
FT                   CDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGVWAGKSLLVTFHGESEGGIKLFQI
FT                   IGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRRDPVM
FT                   PALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDAI
FT                   GIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAI
FT                   RPVINKAAREIARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPA
FT                   GRVHIVGKGDTVPVADNGSKAGRAKNRRVEILVVE"
FT   gene            322414..323194
FT                   /locus_tag="STM0283"
FT   regulatory      322414..322419
FT                   /locus_tag="STM0283"
FT                   /note="putative RBS for STM0283; RegulonDB:STMS1H000643"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        322421..323194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0283"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19240"
FT                   /db_xref="GOA:Q93IR9"
FT                   /db_xref="InterPro:IPR041238"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR9"
FT                   /protein_id="AAL19240.1"
FT                   /translation="MMKKSTYDVSHHSAVCGVTGDYYRISATYHITRSVRVFLIILCCL
FT                   LSGGAFAGSPINAGFISPDNVNLSTQDFLKFYATDNVQKKDNALMYMLGVEDATEGKAW
FT                   CGYGQVDSITINHTVLTWFEQHAVKKPDVRASILIEEALVKNFPCQRTDSSIKIASRSS
FT                   PILSLTPDALNLSGNDFFKFWVSGNQRDKLRAGVYLLGVEDATENKLWCGYALFKTLTL
FT                   NELVYVSLKNKTNEELNSRAAELIINKLIEYPCNI"
FT   gene            323391..323828
FT                   /locus_tag="STM0284"
FT   regulatory      323391..323396
FT                   /locus_tag="STM0284"
FT                   /note="putative RBS for STM0284; RegulonDB:STMS1H000644"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        323397..323828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0284"
FT                   /product="putative shiga-like toxin A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:STM0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19241"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL3"
FT                   /protein_id="AAL19241.1"
FT                   /translation="MVCLLVGVPAISYAHDYGCATVGASMESSLFDAIKNDLNIDVATI
FT                   IKDKTKVEILDISPVSKVYAESLARMDYEKDKAKNKVAILDKKSYFDSYYENQVKSIVA
FT                   KYTYINKDKEKDIFIASSFMNADECSVRFNGYITLSREF"
FT   gene            323857..327731
FT                   /locus_tag="STM0285"
FT   regulatory      323857..323862
FT                   /locus_tag="STM0285"
FT                   /note="putative RBS for STM0285; RegulonDB:STMS1H000645"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        323862..327731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0285"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19242"
FT                   /db_xref="GOA:Q8ZRL2"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL2"
FT                   /protein_id="AAL19242.1"
FT                   /translation="MQKFLSLLFSRRALAVVGVLVLALLVWFVGPLVSFDTLRPLASVG
FT                   SRVVTIALLLMLLVLWLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLI
FT                   GFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEEVPVAGEIKADLRTVNHIVTQAIR
FT                   QLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGLQFPLAEQMEQTS
FT                   RILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRKH
FT                   RPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDL
FT                   LPGFSEYFRTLTSHLRAQIWGFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDT
FT                   RLQEEYDLKSRQRLYTFPREFAALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAA
FT                   QAQADAVADQLSIWQRFVRAIKTARGESSASLPHALPDGNRSYFLHDLLTQFIFREAHL
FT                   VEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDYLNEISARATRLDGDVK
FT                   AYTGKPAMAPVPALLDSARELSAWPELDPDAPPLAWRYGLYSVPPVTDSVASLYNRLLD
FT                   QLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVIND
FT                   LGNSDSVAGFGGRAAVLTHIEALFDGSRVVHSPYEKDEALIRQARAFLDGHTSTERIYA
FT                   RALAAMESEAPQEFTLVRAVGADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPE
FT                   FVAAATANDGWVMGRESTPKKLTDSLRSQIPGQEQSVAREVRRLYLTEYARRWQDFLDS
FT                   IHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAVVEQTTLVPPPDPQARQKQLA
FT                   QRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQSGGGTMQIA
FT                   SLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTR
FT                   KINAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWS
FT                   KQLAPLADTASDPWRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQIS
FT                   VVDMDPAIMELVIDIDGQVLRYAHGPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLL
FT                   TGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRRVVLEITAGRDFNPVSRELLQNFSC
FT                   PARAL"
FT   gene            327726..328519
FT                   /locus_tag="STM0286"
FT   regulatory      327726..327731
FT                   /locus_tag="STM0286"
FT                   /note="putative RBS for STM0286; RegulonDB:STMS1H000646"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        327731..328519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0286"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19243"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR6"
FT                   /protein_id="AAL19243.1"
FT                   /translation="MRRPAVVSAPAMFGRLPDQRDYVRWRVGAEEGRIWQDWLNRQTWV
FT                   GSGRHIVLPGGQTTDEERDGWMHLSPRGEHDMPAPEHHPLPWSFVMSPGFLPMGGTTDW
FT                   LTGVLMASRDSVGRPWPLVIYQRCGREWLDESLQETQGWLYWLARLAAQHITPDTMRRG
FT                   RLTEQVDQLWAMWQPGPWWAQWLRGLRRTSQRSRELTGLPDEAPVVELPGVRYLPWPGW
FT                   PGKTLGQATPGQGWFWQQNSEGRYVDALRLVDEKNRGQML"
FT   gene            328510..328932
FT                   /locus_tag="STM0287"
FT   regulatory      328510..328515
FT                   /locus_tag="STM0287"
FT                   /note="putative RBS for STM0287; RegulonDB:STMS1H000647"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        328516..328932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0287"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19244"
FT                   /db_xref="InterPro:IPR018696"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR5"
FT                   /protein_id="AAL19244.1"
FT                   /translation="MKKYAVEVLFMSACAGMFLPVFAWGGTDVNIDNPLAECVDIHPVH
FT                   RQEMDNLTILKTTVTLKKSTGECGCFSTLINYTSLLAQDVEGYGRGSAYSLQEGNISLA
FT                   KMQGRYPFSFVLSVDNQSVRDQKLALMIRCTPPL"
FT   gene            328950..329477
FT                   /locus_tag="STM0288"
FT   regulatory      328950..328955
FT                   /locus_tag="STM0288"
FT                   /note="putative RBS for STM0288; RegulonDB:STMS1H000648"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        328956..329477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0288"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19245"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR4"
FT                   /protein_id="AAL19245.1"
FT                   /translation="MMAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPE
FT                   GNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESAD
FT                   EKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVKYVS
FT                   GQQTNGGTKQ"
FT   gene            329867..332063
FT                   /locus_tag="STM0289"
FT   regulatory      329867..329872
FT                   /locus_tag="STM0289"
FT                   /note="putative RBS for STM0289; RegulonDB:STMS1H000649"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        329874..332063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0289"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19246"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL1"
FT                   /protein_id="AAL19246.1"
FT                   /translation="MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAESA
FT                   VEQAAGSLFGALPEPSGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSG
FT                   SAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVN
FT                   IELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTVVDIL
FT                   DEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLV
FT                   LADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLL
FT                   ANTVANPRETGHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMT
FT                   GYTFTLENYPTAEVNQEYLLMQTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQR
FT                   TVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAG
FT                   KGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGLPGMASQSGIFSHSLY
FT                   GGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTIIKNETNSIGED
FT                   RNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLML
FT                   HTSDVMQLIGKGIDMNPDGGTAVTADDIAPLLTSE"
FT   gene            332080..332533
FT                   /locus_tag="STM0290"
FT   regulatory      332080..332085
FT                   /locus_tag="STM0290"
FT                   /note="putative RBS for STM0290; RegulonDB:STMS1H000650"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        332087..332533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0290"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19247"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR57"
FT                   /protein_id="AAL19247.1"
FT                   /translation="MDRPYRIQEGCFVLPETFTDRSVNIFILEGNERTSPSLNISRDTL
FT                   KPDEDLPAYIDRQIALMKKNLGQHRVLSRAPAQAGTGNDALMGEQIAATHKSGKTEVYQ
FT                   RQAGFIATPGKVLVFTLTSPRPFDDKADLLWNTWLAGFQPDKNE"
FT   gene            332541..336646
FT                   /locus_tag="STM0291"
FT   regulatory      332541..332546
FT                   /locus_tag="STM0291"
FT                   /note="putative RBS for STM0291; RegulonDB:STMS1H000651"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        332552..336646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0291"
FT                   /product="putative RHS-family protein"
FT                   /note="similar to E. coli rhsD protein in rhs element
FT                   (AAC73599.1); Blastp hit to AAC73599.1 (1426 aa), 27%
FT                   identity in aa 315 - 985, 46% identity in aa 1151 - 1261,
FT                   25% identity in aa 297 - 788, 24% identity in aa 346 - 870,
FT                   22-1073758628dentity in aa 465 - 904, 26% identity in aa
FT                   317 - 724, 32-1073758654dentity in aa 4 - 143, 24% identity
FT                   in aa 232 - 605, 21% identity in aa 562 - 970, 23% identity
FT                   in aa 318 - 755, 32% identity in aa 974 - 1076, 26%
FT                   identity in aa 935 - 1051, 22% identity in aa 358 - 540,
FT                   37% identity in aa 1 - 32, 31-1073758588dentity in aa 1041
FT                   - 1099, 26% identity in aa 1000 - 1083,
FT                   30-1073758532dentity in aa 943 - 1025, 27% identity in aa
FT                   1172 - 1193, 32% identity in aa 1211 - 1235, 63% identity
FT                   in aa 1393 - 1403, 28% identity in aa 1175 - 1210"
FT                   /db_xref="EnsemblGenomes-Gn:STM0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19248"
FT                   /db_xref="GOA:Q8ZRL0"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL0"
FT                   /protein_id="AAL19248.1"
FT                   /translation="MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLA
FT                   GLILGFMADQIASGVLQLGEAIGRSIHHTAGKILTGSENVSTNSRPAARAVLSTVKCDN
FT                   HIAEKRIAQGSENIYINSQPAARKDDHTECDAVIEDGSPNVFLGGGTQTVLEISSEIPD
FT                   WLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELVGMAVGEAISGLF
FT                   SNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLRDDD
FT                   EHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFD
FT                   SDGMAYLLFMETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQG
FT                   GTRGNLVEYRYDDNGQLTGVVNRAGTQVRQFAYENGLMTAHSNATGFTCRYRWQELDGA
FT                   PRVTEHDTSDGEHYRFDYDFAAGTTTVTGRQGETWQWWYDRETYITAHRTPGGGMYRFT
FT                   YNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQWNGEFDEITRTALDDDA
FT                   VWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAFDSRGQMTRYTD
FT                   CSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQDRYTWNALGLMS
FT                   SHRRITGSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVAALTNGNGAQYRFSHDAD
FT                   GRLVREVRPDGLSRTFILDDSGYLTAIQTTGTQGGVRRETQQRDALGRLLRTENEHGQR
FT                   TFSYNRLDQITAVTLTPTEAGQQQHRMQADTVRFEYDRSGWLTAEHAGNGSICYQRDAL
FT                   GNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYERDSLHRQIMRTQGQLATYSGY
FT                   DDDGLLSWQRSLASGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDGLRGSVVYSY
FT                   DRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGAVMSNRLPGCGRDRYGYNEWGELTT
FT                   RRDQQLEWNAQGQLTRVISGNTETHYGYDALGRRTRKATYGRHTGHTARSRTDFVWEGF
FT                   RLLQENVQQQGWRTYLYDAEQPYTPVASVTGRGESRQVWYYHTDVTGTPQEVTAADGTL
FT                   VWAGYIRGFGENAADISNSGAYFHQPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQD
FT                   PIGLRGGLNLYQYAPNPLKYIDPLGLTATVGRWMGPAEYQQMLDTGTVVQSSTGTTHVA
FT                   YPADIDAFGKQAKNGAMYVEFDVPEKSLVPTNEGWAKIVGPDSIEGRLAKRKGLPVPEM
FT                   PTAENITVRGEKINGEVEAKC"
FT   gene            337088..337836
FT                   /locus_tag="STM0292"
FT   regulatory      337088..337093
FT                   /locus_tag="STM0292"
FT                   /note="putative RBS for STM0292; RegulonDB:STMS1H000652"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        337096..337836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0292"
FT                   /product="putative RHS-family protein"
FT                   /note="similar to E. coli rhsE protein in rhs element
FT                   (AAC74538.1); Blastp hit to AAC74538.1 (682 aa), 44%
FT                   identity in aa 426 - 541, 28% identity in aa 273 - 300"
FT                   /db_xref="EnsemblGenomes-Gn:STM0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19249"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR029103"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK9"
FT                   /protein_id="AAL19249.1"
FT                   /translation="MQQQGWRTYLYDAEQPYTPVASVTGKGESRQVWYYHTDVTGTPQE
FT                   VTAADGTLVWAGYIKGFGENAADISNSGAYFHQPLRLPGQYFDDETGLHYNLFRYYAPE
FT                   CGRFVSQDPIGLAGGLNLYQYAPNPIRWIDPLGLAILEHQSNFDAARRTGFENAGMTNP
FT                   EDVTFSKVDPKTGTVVEFKGPNGAKVAYDAPHADMDVTAGHDKPHVGWQSAGKRGSGGA
FT                   NRGNITYDGPQHPHRSDSKGDDKC"
FT   gene            337825..338276
FT                   /locus_tag="STM0293"
FT   regulatory      337825..337830
FT                   /locus_tag="STM0293"
FT                   /note="putative RBS for STM0293; RegulonDB:STMS1H000653"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        337830..338276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0293"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19250"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IQ9"
FT                   /protein_id="AAL19250.1"
FT                   /translation="MLNSNMSELRIELENAIKNLGIHDYRVDKPEQIVSEIKEIYVNGN
FT                   PRTWWLSLKHRQYVFSYTDNSGYKNISQIVSKQLNESNVINKHIFLIADEDNEQIYVYN
FT                   VPLNSLPEIIENCRYFEYYVADHELSWLICENDHGDLIVCSTIK"
FT   gene            338835..339276
FT                   /locus_tag="STM0294"
FT   regulatory      338835..338840
FT                   /locus_tag="STM0294"
FT                   /note="putative RBS for STM0294; RegulonDB:STMS1H000654"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        338839..339276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0294"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19251"
FT                   /db_xref="InterPro:IPR029278"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IQ8"
FT                   /protein_id="AAL19251.1"
FT                   /translation="MLRFVKPGDIFCFKLDEDRYCFGRIITLMTVGHLSELFDIIKKPP
FT                   GITELEISNARRIIEPIIVDTYSLFDKKLENGSDWRIIGHQVNYNPKNLDGIYFALGIG
FT                   DSCKKKDCYGNDFLISESEWKTLPKLSPKGGFDIKKRLEIA"
FT   gene            340039..340353
FT                   /locus_tag="STM0295"
FT   regulatory      340039..340044
FT                   /locus_tag="STM0295"
FT                   /note="putative RBS for STM0295; RegulonDB:STMS1H000655"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        340045..340353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0295"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19252"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK8"
FT                   /protein_id="AAL19252.1"
FT                   /translation="MLTNANKINAVDVFTTGISMVNDKDTAILISDLMLRFGKELDESV
FT                   AVVQSRCDEDEFNVYRETVGFIMGEMLIKIMNPLYEKHPEIKPKGLKQNIWNRMNNV"
FT   gene            complement(340455..340703)
FT                   /locus_tag="STM0296"
FT   CDS_pept        complement(340455..340703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0296"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19253"
FT                   /db_xref="GOA:Q8ZRK7"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK7"
FT                   /protein_id="AAL19253.1"
FT                   /translation="MARLCGILTYSRVERLSVRLYGEWMPQAGFINGMPVKVRVMRDCI
FT                   VITPQHTHGLFGCIEGMGVTRINKRSAEQWLKTFPGR"
FT   gene            340748..340953
FT                   /locus_tag="STM0297"
FT   regulatory      340748..340753
FT                   /locus_tag="STM0297"
FT                   /note="putative RBS for STM0297; RegulonDB:STMS1H000656"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        340756..340953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0297"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19254"
FT                   /db_xref="GOA:Q8ZRK6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK6"
FT                   /protein_id="AAL19254.1"
FT                   /translation="MRKARITAHQIIAVIRSVESGRTVKDVYREAGISEATRDNWRSGY
FT                   GGRDTRGITKGSTVFTVCSS"
FT   gene            341175..341460
FT                   /locus_tag="STM0298"
FT   regulatory      341175..341180
FT                   /locus_tag="STM0298"
FT                   /note="putative RBS for STM0298; RegulonDB:STMS1H000657"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        341179..341460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0298"
FT                   /product="putative integrase core domain protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73370.1); Blastp hit to AAC73370.1 (384 aa), 28%
FT                   identity in aa 221 - 295"
FT                   /db_xref="EnsemblGenomes-Gn:STM0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19255"
FT                   /db_xref="GOA:Q8ZRK5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK5"
FT                   /protein_id="AAL19255.1"
FT                   /translation="MLRMDKGPEFISLALAEWAKKHAVKLAFIQPGKPKKNVFITRFNR
FT                   TYRTEILNSYLFRTLNEVWEITDKGLSEYNCERPHESRNNMIPKEYRQ"
FT   gene            342207..342722
FT                   /gene="safA"
FT                   /locus_tag="STM0299"
FT   regulatory      342207..342212
FT                   /gene="safA"
FT                   /locus_tag="STM0299"
FT                   /note="putative RBS for safA; RegulonDB:STMS1H000658"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        342210..342722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safA"
FT                   /locus_tag="STM0299"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19256"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR018569"
FT                   /db_xref="PDB:2CNY"
FT                   /db_xref="PDB:2CNZ"
FT                   /db_xref="PDB:2CO1"
FT                   /db_xref="PDB:2CO2"
FT                   /db_xref="PDB:2CO3"
FT                   /db_xref="PDB:2CO4"
FT                   /db_xref="PDB:2CO6"
FT                   /db_xref="PDB:2CO7"
FT                   /db_xref="PDB:3CRE"
FT                   /db_xref="PDB:3CRF"
FT                   /db_xref="PDB:5Y9H"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK4"
FT                   /protein_id="AAL19256.1"
FT                   /translation="MVIQMKSIKKLIIASALSMMAASCYAGSFLPNSEQQKSVDIVFSS
FT                   PQDLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAG
FT                   KNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITL
FT                   DVVGYQP"
FT   gene            342830..343543
FT                   /gene="safB"
FT                   /locus_tag="STM0300"
FT   CDS_pept        342830..343543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safB"
FT                   /locus_tag="STM0300"
FT                   /product="putative fimbriae assembly chaparone"
FT                   /note="similar to E. coli putative chaperone (AAC76177.1);
FT                   Blastp hit to AAC76177.1 (231 aa), 35% identity in aa 26 -
FT                   223"
FT                   /db_xref="EnsemblGenomes-Gn:STM0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19257"
FT                   /db_xref="GOA:Q8ZRK3"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="PDB:2CO6"
FT                   /db_xref="PDB:2CO7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK3"
FT                   /protein_id="AAL19257.1"
FT                   /translation="MAVALFATNSMVSVYAVNQQLNSATKLFSVKLGATRVIYHAGTAG
FT                   ATLSVSNPQNYPILVQSSVKAADKSSPAPFLVMPPLFRLEANQQSQLRIVRTGGDMPTD
FT                   RETLQWVCIKAVPPENEPSDTQAKGATLDLNLSINACDKLIFRPDAVKGTPEDVAGNLR
FT                   WVETGNKLKVENPTPFYMNLASVTVGGKPITGLEYVPPFADKTLNMPGSAHGDIEWRVI
FT                   TDFGGESHPFHYVLK"
FT   gene            343560..346077
FT                   /gene="safC"
FT                   /locus_tag="STM0301"
FT   regulatory      343560..343565
FT                   /gene="safC"
FT                   /locus_tag="STM0301"
FT                   /note="putative RBS for safC; RegulonDB:STMS1H000659"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        343567..346077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safC"
FT                   /locus_tag="STM0301"
FT                   /product="putative fimbriae usher"
FT                   /note="similar to E. coli putative outer membrane protein,
FT                   export function (AAC73634.1); Blastp hit to AAC73634.1 (867
FT                   aa), 34% identity in aa 35 - 862"
FT                   /db_xref="EnsemblGenomes-Gn:STM0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19258"
FT                   /db_xref="GOA:Q8ZRK2"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK2"
FT                   /protein_id="AAL19258.1"
FT                   /translation="MKFKQPALLLFIAGVVHCANAHTYTFDASMLGDAAKGVDMSLFNQ
FT                   GVQQPGTYRVDVMVNGKRVDTRDVVFKLEKDGQGTPVLAPCLTVSQLSRYGVKTEDYPQ
FT                   LWKAAKPPDECADLTAIPQAKAVLDINNQQLQLSIPQLALRPEFKGIAPEDLWDDGIPA
FT                   FLMNYSARTTQTDYKMDMVGRDNSSWVQLQPGINIGAWRVRNATSWQRSSQLSGKWQAA
FT                   YTYAERGLYSLKSRLTLGQKTSQGEIFDSVPFTGVMLASDDNMVPYSERQFAPVVRGIA
FT                   RTQARVEVKQNGYTIYNTTVAPGPFALRDLSVTDSSGDLHVTVWEADGSTQMFVVPYQT
FT                   PAIALHQGYLKYSLLAGRYRSSDSATDKAQIAQATLMYGLPWNLTAYGGIQSATHYQAA
FT                   LLGLGGSLGRWGSLSVDGSDTHSQRQGEAVQQGASWRLRYSNQLTATGTNFFLTRWQYA
FT                   SQGYNTLSDVLDSYRHNGNRLWSWRENLQPSSRTTLMLSQSWGRHLGNLSLTGSRTDWR
FT                   NRPGHDDSYGLSWGTSIGGGSLSLNWNQNRTLWRNGAHRKENITSLWFSMPLSRWTGNN
FT                   VSASWQMTSPSHGGQTQQVGVNGEAFSQQLDWEVRQSYRADAPPGGGNNSALHLAWNGD
FT                   YGLLGGDYSYSRAMRQMGVNIAGGIVIHHHGVTLGQPLQGSVALVEAPGASGVPVGGWP
FT                   GVKTDFRGDTTVGNLNVYQENTVSLDPSRLPDDAEVTQTDVRVVPTEGAVVEAKFHTRI
FT                   GARALMTLKREDGSAIPFGAQVTVNGQDGSAALVDTDSQVYLTGLADKGELTVKWGAQQ
FT                   CRVNYRLPAHKGIAGLYQMSGLCR"
FT   gene            346092..346569
FT                   /gene="safD"
FT                   /locus_tag="STM0302"
FT   regulatory      346092..346097
FT                   /gene="safD"
FT                   /locus_tag="STM0302"
FT                   /note="putative RBS for safD; RegulonDB:STMS1H000660"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        346099..346569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safD"
FT                   /locus_tag="STM0302"
FT                   /product="putative fimbriae subunit"
FT                   /db_xref="EnsemblGenomes-Gn:STM0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19259"
FT                   /db_xref="InterPro:IPR008394"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="PDB:5Y9H"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR56"
FT                   /protein_id="AAL19259.1"
FT                   /translation="MWMKIQRVKTVIYSVSLLVAASSLVPIANAAEKLQTTLRVGTYFR
FT                   AGHVPDGMVLAQGWVTYHGSHSGFRVWSDEQKAGNTPTVLLLSGQQDPRHHIQVRLEGE
FT                   GWQPDTVSGRGAILRTAADNASFSVVVDGNQEVPADTWTLDFKACALAQEDT"
FT   gene            346968..347796
FT                   /gene="ybeJ"
FT                   /locus_tag="STM0303"
FT   regulatory      346968..346973
FT                   /gene="ybeJ"
FT                   /locus_tag="STM0303"
FT                   /note="putative RBS for ybeJ; RegulonDB:STMS1H000661"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        346975..347796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeJ"
FT                   /locus_tag="STM0303"
FT                   /product="putative xylanase/chitin deacetylase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC74108.1); Blastp hit to AAC74108.1 (672 aa), 36%
FT                   identity in aa 52 - 189, 21% identity in aa 213 - 280"
FT                   /db_xref="EnsemblGenomes-Gn:STM0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19260"
FT                   /db_xref="GOA:Q8ZRK1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK1"
FT                   /protein_id="AAL19260.1"
FT                   /translation="MSYARHLPVLMYHHVSDKPGQITLSPRTFRAQMKWLAESGWKTVT
FT                   AAEVEAFYHGARLPRKSVMLTFDGGWLDNWLQVFPVLQEFNLHAHLFLVTSLISDGPVR
FT                   IPAGEPVYSHDECQMLVKQGRADEVMLRWSEVREMHLSGLVEFHSHTHTHRRWDQKPVS
FT                   RNPSDLLRVDILLSRKRMREMLGYCSQHLCWPEGWYCSDYIHVAEELGFTYLYTTERRM
FT                   NNPVIGSQRIGRINAKERKNVGWLKRRLFYHTTPGFSSLLARHKGARRIAD"
FT   gene            348606..349558
FT                   /gene="sinR"
FT                   /locus_tag="STM0304"
FT   regulatory      348606..348611
FT                   /gene="sinR"
FT                   /locus_tag="STM0304"
FT                   /note="putative RBS for sinR; RegulonDB:STMS1H000662"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        348611..349558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sinR"
FT                   /locus_tag="STM0304"
FT                   /product="transcriptional regulator"
FT                   /note="SINR protein. (SW:SINR_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19261"
FT                   /db_xref="GOA:P37459"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37459"
FT                   /protein_id="AAL19261.1"
FT                   /translation="MMELINNRGMRDWMIFIKVAEVGNLSRAARELDISISAVSKSLSR
FT                   LENSIEVTLLRRDSHHLELTGAGQTAYASMKRITSSFQSLLDELRNPDKIIRGSIKFSA
FT                   PAIVCEFLANKWIWEFTASYPDTKIYLDSRERSDFFSKSLEFDELVFKSGIIESEDLVY
FT                   RKISPLKLVLCASPKYIRKYGRISHPGDLENHIIVGLHNHGLSGPLTLFRQDESYTISG
FT                   AVNVHLSSNNLLSVLNLVLEGKGINLMTPAWLATKYLKNNELEIILPEWRVPDLPIYLV
FT                   WRHRQYYSPLFQRFLSFIEDKWNNRPQIDFLNDD"
FT   gene            349672..349890
FT                   /locus_tag="STM0305"
FT   regulatory      349672..349677
FT                   /locus_tag="STM0305"
FT                   /note="putative RBS for STM0305; RegulonDB:STMS1H000663"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        349675..349890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0305"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19262"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK0"
FT                   /protein_id="AAL19262.1"
FT                   /translation="MMPTDGNDNTRKQDGAVFGQPEVKPIPETLQCTEKWRQVAPVQRF
FT                   SEGAGVFITDILHCAFGNPQDQLFYR"
FT   gene            complement(349894..350619)
FT                   /locus_tag="STM0306"
FT   CDS_pept        complement(349894..350613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0306"
FT                   /product="homolog of sapA"
FT                   /db_xref="EnsemblGenomes-Gn:STM0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19263"
FT                   /db_xref="GOA:Q8ZRJ9"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRJ9"
FT                   /protein_id="AAL19263.1"
FT                   /translation="MKNFFAVCIIPLVVAWSATASAKEGIYITGKAGTSVVNVYGINST
FT                   FSQDEIVNGHATLPDRTKGVFGGGVAIGYDFYDPFQLPVRLELDTTFRGETDAKGGQDI
FT                   IAFGDPVHINVKNQVRMTTYMVNGYYDFHNSTAFTPYISAGVGLAHVKLSNNTIPVGFG
FT                   INETLSASKNNFAWGAGIGAKYAVTDNIMIDASYKYINAGKVSISKNHYAGDEHTAYDA
FT                   DTKAASNDFMLGITYAF"
FT   regulatory      complement(350614..350619)
FT                   /locus_tag="STM0306"
FT                   /note="putative RBS for STM0306; RegulonDB:STMS1H000664"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(350944..351358)
FT                   /locus_tag="STM0307"
FT   CDS_pept        complement(350944..351351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0307"
FT                   /product="homology to Shigella VirG protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19264"
FT                   /db_xref="GOA:Q7CR55"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR55"
FT                   /protein_id="AAL19264.1"
FT                   /translation="MKNFVRTTLLAATLAGVSFGAFATAVPNPPLPAQDPIVQHLKLTN
FT                   DQITRIKKLHQQLETDVSQISMKGIKDGALIEVIKSGKWDDAAVKQQLAAFSNIEQQAR
FT                   YYRVKYYFDLSKVLTPEQRQQVQQDLAQALE"
FT   regulatory      complement(351353..351358)
FT                   /locus_tag="STM0307"
FT                   /note="putative RBS for STM0307; RegulonDB:STMS1H000665"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(351722..352503)
FT                   /gene="yafV"
FT                   /locus_tag="STM0308"
FT   CDS_pept        complement(351722..352489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="STM0308"
FT                   /product="putative amidohydrolase"
FT                   /note="similar to E. coli putative EC 3.5. amidase-type
FT                   enzyme (AAC73323.1); Blastp hit to AAC73323.1 (256 aa), 82%
FT                   identity in aa 3 - 255"
FT                   /db_xref="EnsemblGenomes-Gn:STM0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19265"
FT                   /db_xref="GOA:Q8ZRJ8"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ8"
FT                   /protein_id="AAL19265.1"
FT                   /translation="MSGLKITLLQQPLVWMDGPANLRHFDRQLELVSGRDVIVLPEMFT
FT                   TGFAMEAANNSLSQDSVITWMQAKARQTDALIAGSAALQTERGAVNRFLLVEPEGKVHL
FT                   YDKRHLFRMADEHQHYAAGDKRIIVQWRGWRILPLICYDLRFPIWSRNRNDYDLALYVA
FT                   NWPAPRSLHWQTLLTARAIENQAYVAGCNRVGTDGNGLHYRGDSRIINPQGDIIATAEP
FT                   HQATRIDADLSLVALQDYREKFPAWRDADPFTL"
FT   regulatory      complement(352498..352503)
FT                   /gene="yafV"
FT                   /locus_tag="STM0308"
FT                   /note="putative RBS for yafV; RegulonDB:STMS1H000666"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(352598..355058)
FT                   /gene="yafH"
FT                   /locus_tag="STM0309"
FT   CDS_pept        complement(352598..355042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafH"
FT                   /locus_tag="STM0309"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="similar to E. coli putative acyl-CoA dehydrogenase
FT                   (AAC73325.1); Blastp hit to AAC73325.1 (826 aa), 95%
FT                   identity in aa 13 - 826"
FT                   /db_xref="EnsemblGenomes-Gn:STM0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19266"
FT                   /db_xref="GOA:Q8ZRJ7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRJ7"
FT                   /protein_id="AAL19266.1"
FT                   /translation="MMILSIIATVVLLGALFYHRVSLFLSSLILLAWTAALGVAGLWSI
FT                   WLLVPLAIILVPFNLTPMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQ
FT                   GKPDWKKLHNYPQPQLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTEEQK
FT                   NHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGVVCMGEWQGQQVLGMRLTWNKRYIT
FT                   LAPIATVLGLAFKLSDPDRLLGGEEELGITCALIPTSTPGVEIGRRHFPLNVPFQNGPT
FT                   RGNDIFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYAHI
FT                   RRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQQSIIDAMDITGGKGIMLGESNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMAAAQNNDVNAFDKLLFKHIGHVGSNTVRSFWLGLTRGLTSHTPTGDATKRYY
FT                   QHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDVLSQLYLASAVLKRYDDEGRHE
FT                   ADLPLVHWGVQDALYRAEQAMDDLLQNFPNRVVAGLLTAMIFPTGRHYLAPSDKLDHAV
FT                   AKILQVPNATRSRIGRGQYLTPAEHNPVGLLEEALRDVIAADPIHQRICKELGKNLPFT
FT                   RLDELARNALAKGLIDKDEAAILAKAEESRLRSINVDDFEPEALATKPVKLPEKVRKVE
FT                   AA"
FT   regulatory      complement(355053..355058)
FT                   /gene="yafH"
FT                   /locus_tag="STM0309"
FT                   /note="putative RBS for yafH; RegulonDB:STMS1H000667"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            355270..355860
FT                   /gene="ghmA"
FT                   /locus_tag="STM0310"
FT   regulatory      355270..355275
FT                   /gene="ghmA"
FT                   /locus_tag="STM0310"
FT                   /note="putative RBS for ghmA; RegulonDB:STMS1H000668"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        355282..355860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ghmA"
FT                   /locus_tag="STM0310"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="similar to E. coli phosphoheptose isomerase
FT                   (AAC73326.1); Blastp hit to AAC73326.1 (192 aa), 97%
FT                   identity in aa 1 - 192"
FT                   /db_xref="EnsemblGenomes-Gn:STM0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19267"
FT                   /db_xref="GOA:P63223"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63223"
FT                   /protein_id="AAL19267.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYDYIFSRY
FT                   VEAVGREGDVLLGISTSGNSGNVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   gene            356063..356840
FT                   /gene="yafJ"
FT                   /locus_tag="STM0311"
FT   regulatory      356063..356068
FT                   /gene="yafJ"
FT                   /locus_tag="STM0311"
FT                   /note="putative RBS for yafJ; RegulonDB:STMS1H000669"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        356073..356840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="STM0311"
FT                   /product="putative glutamine amidotransferase"
FT                   /note="similar to E. coli putative amidotransferase
FT                   (AAC73327.1); Blastp hit to AAC73327.1 (255 aa), 93%
FT                   identity in aa 1 - 255"
FT                   /db_xref="EnsemblGenomes-Gn:STM0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19268"
FT                   /db_xref="GOA:Q8ZRJ6"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ6"
FT                   /protein_id="AAL19268.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSYHSPIAKLVQNYPIKSCSVIAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLNGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMTAVFKYIATLA
FT                   TVLREKGVFNMLLSDGRYVMAFCSTHLHWITRRAPFGVATLVDQDMEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWALFCLGERII"
FT   gene            complement(356811..357565)
FT                   /gene="yafK"
FT                   /locus_tag="STM0312"
FT   CDS_pept        complement(356811..357551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="STM0312"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73328.1); Blastp hit to AAC73328.1 (246 aa), 90%
FT                   identity in aa 1 - 246"
FT                   /db_xref="EnsemblGenomes-Gn:STM0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19269"
FT                   /db_xref="GOA:Q7CR54"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR54"
FT                   /protein_id="AAL19269.1"
FT                   /translation="MRKIAFFLAMLLMPCVSFAGLLSSSSPVTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLK
FT                   PDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALV
FT                   FGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYV
FT                   VSKPLSHEVVQPQLASNYTLSEAK"
FT   regulatory      complement(357560..357565)
FT                   /gene="yafK"
FT                   /locus_tag="STM0312"
FT                   /note="putative RBS for yafK; RegulonDB:STMS1H000670"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            357788..358856
FT                   /gene="dinP"
FT                   /locus_tag="STM0313"
FT   regulatory      357788..357793
FT                   /gene="dinP"
FT                   /locus_tag="STM0313"
FT                   /note="putative RBS for dinP; RegulonDB:STMS1H000671"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        357801..358856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="STM0313"
FT                   /product="DNA polymerase IV"
FT                   /note="devoid of proofreading; damage-inducible protein P;
FT                   similar to E. coli damage-inducible protein P; putative
FT                   tRNA synthetase (AAC73335.1); Blastp hit to AAC73335.1 (351
FT                   aa), 91% identity in aa 1 - 351"
FT                   /db_xref="EnsemblGenomes-Gn:STM0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19270"
FT                   /db_xref="GOA:P63989"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63989"
FT                   /protein_id="AAL19270.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDE
FT                   AWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYV
FT                   ITPADVPDFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLLKRFGKFGRVL
FT                   WERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDL
FT                   LIARQGVKLKFNDFQQTTQEHVWPQLNKEDLITTARKTWDERRGERGVRLVGLHVTLLD
FT                   PQLERQLVLGL"
FT   gene            359075..360207
FT                   /pseudo
FT                   /locus_tag="STM0314"
FT                   /note="pseudogene; frameshift relative to E. coli probable
FT                   peptide chain release factor (GB:AAC73340.1)"
FT   gene            360188..360818
FT                   /gene="prfH"
FT                   /locus_tag="STM0315"
FT   regulatory      360188..360193
FT                   /gene="prfH"
FT                   /locus_tag="STM0315"
FT                   /note="putative RBS for prfH; RegulonDB:STMS1H000673"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        360204..360818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="STM0315"
FT                   /product="putative peptide chain release factor"
FT                   /note="similar to E. coli probable peptide chain release
FT                   factor (AAC73340.1); Blastp hit to AAC73340.1 (166 aa), 82%
FT                   identity in aa 2 - 163"
FT                   /db_xref="EnsemblGenomes-Gn:STM0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19271"
FT                   /db_xref="GOA:Q7CR53"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR53"
FT                   /protein_id="AAL19271.1"
FT                   /translation="MILLQLSSAQGPDECCLAVKKALDCLTKEAAREKVSLTRLETEPG
FT                   RLPDTLRSALVSLDGEKAMAFSERWCGTLLWICTSPYRPHHGRKNWYVGIGRFSADEHI
FT                   QSDEIRFETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAW
FT                   RLEQQRQNECAALKSERRLFHHQIERGNPLRIFKGMAFTPQ"
FT   gene            complement(360974..362444)
FT                   /gene="pepD"
FT                   /locus_tag="STM0316"
FT   CDS_pept        complement(360974..362431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="STM0316"
FT                   /product="aminoacyl-histidine dipeptidase (peptidase D)"
FT                   /note="similar to E. coli aminoacyl-histidine dipeptidase
FT                   (peptidase D) (AAC73341.1); Blastp hit to AAC73341.1 (485
FT                   aa), 92% identity in aa 1 - 485"
FT                   /db_xref="EnsemblGenomes-Gn:STM0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19272"
FT                   /db_xref="GOA:Q8ZRJ5"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ5"
FT                   /protein_id="AAL19272.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIVSWAKEKGL
FT                   YVDRDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNSDTVHDFTTDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADDNVVHGPLEVLLTMTEEAGMDGAFGLQSGWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLPLTREAVPAGFACFKLTLKGLKGGHSGGEIHL
FT                   GLGNANKLLARFLAGHAEELDLRLIDFNGGTLRNAIPREAFATLAVAADNVGALKTLVN
FT                   AYQDILKNELAEKEKNLTLQLNEVASDKAALTAPSRDTFVRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMSDANVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGSYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPDMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKAIPAK"
FT   regulatory      complement(362439..362444)
FT                   /gene="pepD"
FT                   /locus_tag="STM0316"
FT                   /note="putative RBS for pepD; RegulonDB:STMS1H000674"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            362662..363138
FT                   /gene="gpt"
FT                   /locus_tag="STM0317"
FT   regulatory      362662..362667
FT                   /gene="gpt"
FT                   /locus_tag="STM0317"
FT                   /note="putative RBS for gpt; RegulonDB:STMS1H000675"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        362680..363138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="STM0317"
FT                   /product="guanine-hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="xanthine-guanine phosphoribosyltransferase.
FT                   (SW:XGPT_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19273"
FT                   /db_xref="GOA:P0A277"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A277"
FT                   /protein_id="AAL19273.1"
FT                   /translation="MSEKYVVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPISGR"
FT   gene            363212..364471
FT                   /gene="yafA"
FT                   /locus_tag="STM0318"
FT   regulatory      363212..363217
FT                   /gene="yafA"
FT                   /locus_tag="STM0318"
FT                   /note="putative RBS for yafA; RegulonDB:STMS1H000676"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        363227..364471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafA"
FT                   /locus_tag="STM0318"
FT                   /product="putative hydrolase of the alpha/beta superfamily"
FT                   /note="hypothetical protein in gpt-crl intergenic region.
FT                   (SW:YAFA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19274"
FT                   /db_xref="GOA:P37722"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37722"
FT                   /protein_id="AAL19274.1"
FT                   /translation="MTQANLSETLFKPRFKHTETSTLVRRFNRGSQPPMQSALDGKNVP
FT                   HWYRMINRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWAKQ
FT                   AMDWQQKACQEQDAMRSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQR
FT                   LPGSLREMEFAVPGGSPVTAFLHMPKGDGPFPTVLMCGGLDAMQTDYYTLYERYFAPRG
FT                   IAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFNPVYRNFD
FT                   RALQEITDWINHRLC"
FT   gene            364517..364930
FT                   /gene="crl"
FT                   /locus_tag="STM0319"
FT   regulatory      364517..364522
FT                   /gene="crl"
FT                   /locus_tag="STM0319"
FT                   /note="putative RBS for crl; RegulonDB:STMS1H000677"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        364529..364930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="STM0319"
FT                   /product="transcriptional regulator of cryptic csgA gene
FT                   for curli surface fibers"
FT                   /note="similar to E. coli transcriptional regulator of
FT                   cryptic csgA gene for curli surface fibers (AAC73344.1);
FT                   Blastp hit to AAC73344.1 (133 aa), 83% identity in aa 1 -
FT                   133"
FT                   /db_xref="EnsemblGenomes-Gn:STM0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19275"
FT                   /db_xref="GOA:Q7CR52"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="PDB:2MZ8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR52"
FT                   /protein_id="AAL19275.1"
FT                   /translation="MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVK
FT                   PAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFH
FT                   EKLRDLLISMELALEPSDDFNDEPVKLSA"
FT   gene            complement(364981..366179)
FT                   /gene="phoE"
FT                   /locus_tag="STM0320"
FT   CDS_pept        complement(364981..366033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="STM0320"
FT                   /product="outer membrane pore protein e (e,ic,nmpab)"
FT                   /note="outer membrane pore protein E precursor.
FT                   (SW:PHOE_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19276"
FT                   /db_xref="GOA:P30705"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30705"
FT                   /protein_id="AAL19276.1"
FT                   /translation="MNKSTLAIVVSIIASASVHAAEVYNKNGNKLDVYGKVKAMHYMSD
FT                   YDSKDGDQSYVRFGFKGETQINDQLTGYGRWEAEFASNKAESDSSQQKTRLAFAGLKLK
FT                   DIGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGIVD
FT                   GLDLTLQYQGKNEDRDVKKQNGDGFGTSVSYDFGGSDFAVSGAYTLSDRTREQNLQRRG
FT                   TGDKAEAWATGVKYDANDIYIATFYSETRNMTPVSGGFANKTQNFEAVIQYQFDFGLRP
FT                   SLGYVLSKGKDIEGVGSEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNTLGINDDD
FT                   IVAIGLTYQF"
FT   regulatory      complement(366039..366044)
FT                   /gene="phoE"
FT                   /locus_tag="STM0320"
FT                   /note="putative RBS for phoE; RegulonDB:STMS1H000678"
FT                   /regulatory_class="ribosome_binding_site"
FT   protein_bind    complement(366111..366129)
FT                   /gene="phoE"
FT                   /locus_tag="STM0320"
FT                   /bound_moiety="PhoB"
FT                   /note="putative binding site for PhoB, RegulonDB:
FT                   STMS1H000341"
FT   protein_bind    complement(366129..366147)
FT                   /gene="phoE"
FT                   /locus_tag="STM0320"
FT                   /bound_moiety="PhoB"
FT                   /note="putative binding site for PhoB, RegulonDB:
FT                   STMS1H000340"
FT   regulatory      complement(366155..366163)
FT                   /gene="phoE"
FT                   /locus_tag="STM0320"
FT                   /note="putative -10_signal for phoE;
FT                   RegulonDB:STMLTH004580"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(366171..366179)
FT                   /gene="phoE"
FT                   /locus_tag="STM0320"
FT                   /note="putative -35_signal for phoE;
FT                   RegulonDB:STMLTH004580"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    complement(366251..366269)
FT                   /bound_moiety="PhoB"
FT                   /note="putative binding site for PhoB, RegulonDB:
FT                   STMS1H000339"
FT   gene            366309..367419
FT                   /gene="proB"
FT                   /locus_tag="STM0321"
FT   regulatory      366309..366314
FT                   /gene="proB"
FT                   /locus_tag="STM0321"
FT                   /note="putative RBS for proB; RegulonDB:STMS1H000679"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        366316..367419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="STM0321"
FT                   /product="gamma-glutamate kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="similar to E. coli gamma-glutamate kinase
FT                   (AAC73346.1); Blastp hit to AAC73346.1 (367 aa), 96%
FT                   identity in aa 1 - 367"
FT                   /db_xref="EnsemblGenomes-Gn:STM0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19277"
FT                   /db_xref="GOA:P65792"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65792"
FT                   /protein_id="AAL19277.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVD
FT                   EGATAAMLERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAG
FT                   HHSQQIDAILGYEYGPVAVHRDDMITR"
FT   gene            367418..368681
FT                   /gene="proA"
FT                   /locus_tag="STM0322"
FT   regulatory      367418..367423
FT                   /gene="proA"
FT                   /locus_tag="STM0322"
FT                   /note="putative RBS for proA; RegulonDB:STMS1H000680"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        367431..368681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="STM0322"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="gamma-glutamyl phosphate reductase (GPR).
FT                   (SW:PROA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19278"
FT                   /db_xref="GOA:P40861"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40861"
FT                   /protein_id="AAL19278.1"
FT                   /translation="MLEQMGIAAKAASYKLALLSSGEKNRVLEKIADELEAQMESILSA
FT                   NVQDVEQARANGLSEAMLDRLALTPARLKAIADDVRQVCNLADPVGQVIDGGLLDSGLR
FT                   LERRRVPLGVVGVIYEARPNVTVDVASLCLKTGNAVILRGGKETYRTNAATVRVIQKAL
FT                   KACGLPEAAVQAIDNPDRSLVNEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIFVDSSADIAPALKIIVNAKTQRPSTCNTVETLLVHQDIAERFLPALSKQMAESG
FT                   VTLHGDETVMQVLHGPAKLVPLKPEELDNEFLSLDLNVVVVENMDGAIAHIREHGTQHS
FT                   DAILTCDMHNAARFVNEVDSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLE
FT                   ALTTYKWIGFGDGTIRA"
FT   gene            368807..368879
FT                   /gene="thrW"
FT                   /locus_tag="STM0323"
FT   tRNA            368807..368879
FT                   /gene="thrW"
FT                   /locus_tag="STM0323"
FT                   /product="tRNA-Thr"
FT   gene            369153..369380
FT                   /locus_tag="STM0324"
FT   regulatory      369153..369158
FT                   /locus_tag="STM0324"
FT                   /note="putative RBS for STM0324; RegulonDB:STMS1H000682"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        369159..369380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0324"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ4"
FT                   /protein_id="AAL19279.1"
FT                   /translation="MFRTETATGTVTTLPIVITLTIIKHCCPHYFPADKVLSVDTFHLQ
FT                   RMEEAFRTGIVVTTTSGAHTSPQIMAFQ"
FT   gene            complement(369198..369998)
FT                   /locus_tag="STM0325"
FT   CDS_pept        complement(369198..369998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0325"
FT                   /product="putative IS3 transposase"
FT                   /note="similar to E. coli IS3 putative transposase
FT                   (AAC75150.1); Blastp hit to AAC75150.1 (288 aa), 83%
FT                   identity in aa 30 - 267"
FT                   /db_xref="EnsemblGenomes-Gn:STM0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19280"
FT                   /db_xref="GOA:Q8ZRJ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ3"
FT                   /protein_id="AAL19280.1"
FT                   /translation="MLASTPPTSTGVFNRALSSLAIACICKRYVWHQRRHQINRRQRFH
FT                   LVCDNVFREAFSDAKQRYGAPRLTDELRAQGYQFNVKTVAASLRRQGLRAKASRRFRPV
FT                   SYRKHGLPVSENLLKQDFYASGPNQKWVGDITYLRTGEGWLYLAVVIDLWSRSVIGWSM
FT                   SSRMTAQLACDALQMALWRRKCPENVIVHTDRGGQYCSTDYQSLLKRHNLRGSMSARGC
FT                   CYDNACAESFFHTLKVECIHGEDFVSREIMRTAVFNYSECDYNR"
FT   gene            369925..370630
FT                   /pseudo
FT                   /locus_tag="STM0326"
FT                   /note="pseudogene; frameshift; putative HSP70 class
FT                   molecular chaperone"
FT   gene            370726..371063
FT                   /locus_tag="STM0327"
FT   regulatory      370726..370731
FT                   /locus_tag="STM0327"
FT                   /note="putative RBS for STM0327; RegulonDB:STMS1H000684"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        370740..371063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0327"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC74880.1); Blastp hit to AAC74880.1 (119 aa), 66%
FT                   identity in aa 13 - 119"
FT                   /db_xref="EnsemblGenomes-Gn:STM0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19281"
FT                   /db_xref="InterPro:IPR015079"
FT                   /db_xref="InterPro:IPR037210"
FT                   /db_xref="PDB:2ES9"
FT                   /db_xref="PDB:2JN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ2"
FT                   /protein_id="AAL19281.1"
FT                   /translation="MVNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYL
FT                   HDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQEQLK
FT                   ELV"
FT   gene            371397..372642
FT                   /locus_tag="STM0328"
FT   regulatory      371397..371402
FT                   /locus_tag="STM0328"
FT                   /note="putative RBS for STM0328; RegulonDB:STMS1H000685"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        371404..372642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0328"
FT                   /product="putative permease"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC74668.1); Blastp hit to AAC74668.1 (417 aa), 34%
FT                   identity in aa 33 - 407"
FT                   /db_xref="EnsemblGenomes-Gn:STM0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19282"
FT                   /db_xref="GOA:Q8ZRJ1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ1"
FT                   /protein_id="AAL19282.1"
FT                   /translation="MCMKNNIEETIGKYLPILMILPLAGLAELASLYSIQALLPKLSEV
FT                   YNIPLNQVGMILSAEVGFLALAMLFSGTLSDRFGRKPIIFYSLLAGGILTLLCATASSW
FT                   PMLVVYRALLGIAVSGITAAVTVYISEEVSPALAGIVTGYFIFGNSLGSMSGRVFATLM
FT                   MEHVSIDTIFFIFGGVLIAMALAVKLFLPTSRQFVPTPSLQLGAVLKGGLEHFKNIRVS
FT                   LCFVIGFILFGSFTSIFNFLAFYLHRPPYELSYTWIGLIPVSFSLTFFLAPYAARVALN
FT                   IGSMNALSMLIICMMVGAFLTLIAPSLWVFISGIVLLSVAFFSAHSTVLAWVSSRSPNA
FT                   KGQATSFYLLCYYSGGAVMGYLNGYLFSWQGWNAIAASCLMMLGIGLFICRFIFAKYEK
FT                   QPQIKKQSVQESF"
FT   gene            372766..374195
FT                   /locus_tag="STM0329"
FT   regulatory      372766..372771
FT                   /locus_tag="STM0329"
FT                   /note="putative RBS for STM0329; RegulonDB:STMS1H000686"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        372774..374195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0329"
FT                   /product="putative 3-isopropylmalate isomerase"
FT                   /note="similar to E. coli 3-isopropylmalate isomerase
FT                   dehydratase subunit (AAC73183.1); Blastp hit to AAC73183.1
FT                   (466 aa), 52% identity in aa 2 - 465; subunit with LeuD"
FT                   /db_xref="EnsemblGenomes-Gn:STM0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19283"
FT                   /db_xref="GOA:Q8ZRJ0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRJ0"
FT                   /protein_id="AAL19283.1"
FT                   /translation="MSAKTLYEKLVESHTIRELDNEGHVLLYIDRSILNEYTSPQAFSG
FT                   LRERGRTVRHPDTFLLNIDHVNPTRSQRDDLMTDPGGQLQVDYFRENAADFGITLFDVL
FT                   DPRQGIEHVVAHEQGLVMPGMVIAAGDSHTTTYGAFGALGFGIGTSEIEHLLATQTLVY
FT                   RKLKTMRVSVQGELPFACSAKDIVLELLERIGADGATGYAIEFVGEAISALSVEGRMTL
FT                   CNMAVEAGARGAIIAPDKKVFDYIYGKPQMPVGELWQQALLEWSQLSSDADAVFDKTVA
FT                   INCHDLEPKVTWGISPDQTGSITGRVPFPEQETNPLKRLALEKALHYMGLTAGMLLKDI
FT                   RISHAFIGSCTNGRIEDLRAVAKVLEGRKIASHVRGIIVPGSTMVRRQAEEEGLAKIFI
FT                   AAGFEWRQSGCSMCLAMNEDVLSPGDRCASGTNRNFPGRQGAGARTHLMSPAMVAAAAV
FT                   AGHLVDVRSLLQAGE"
FT   gene            374190..374823
FT                   /locus_tag="STM0330"
FT   regulatory      374190..374195
FT                   /locus_tag="STM0330"
FT                   /note="putative RBS for STM0330; RegulonDB:STMS1H000687"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        374197..374823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0330"
FT                   /product="putative 3-isopropylmalate isomerase
FT                   (dehydratase), subunit with LeuC"
FT                   /note="similar to E. coli isopropylmalate isomerase subunit
FT                   (AAC73182.1); Blastp hit to AAC73182.1 (201 aa), 39%
FT                   identity in aa 3 - 193"
FT                   /db_xref="EnsemblGenomes-Gn:STM0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19284"
FT                   /db_xref="GOA:Q8ZRI9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRI9"
FT                   /protein_id="AAL19284.1"
FT                   /translation="MDTFKQISGRIAPMLEPNIDTDVIMPKQFLKGIDRQGLDKGVFFD
FT                   RRFMAGGQPNPDFILNMPGWQSATFLLVGPNFGCGSSREHAVWGLKQLGVRGLIGSTFA
FT                   GIFDDNCQRNGILTVSLDEPALARLAQLAASADTNSITVSLDRCEITTAEETISFVISE
FT                   LKRAMLAAGEDAIAWTLQYLPEIENFEVAHYSRRPWLKRPASPRG"
FT   gene            374831..375716
FT                   /locus_tag="STM0331"
FT   regulatory      374831..374836
FT                   /locus_tag="STM0331"
FT                   /note="putative RBS for STM0331; RegulonDB:STMS1H000688"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        374838..375716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0331"
FT                   /product="putative fumarylacetoacetate (FAA) hydrolase"
FT                   /note="similar to E. coli putative isomerase (AAC74264.1);
FT                   Blastp hit to AAC74264.1 (219 aa), 34% identity in aa 11 -
FT                   217"
FT                   /db_xref="EnsemblGenomes-Gn:STM0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19285"
FT                   /db_xref="GOA:Q8ZRI8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI8"
FT                   /protein_id="AAL19285.1"
FT                   /translation="MKLVQYLVNGGKRYGIMQETGIIDLSQRLGDKYPTLKSLLCANAL
FT                   TDAALWCDEPADYYYQEVTFLPVIDDPQKIICVGMNYADKRIEFNETNPAPTLFVRFAD
FT                   SQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVSAEDALDYVAGYSCYMDGSVRDWQ
FT                   HSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNESTANMIHPIASLI
FT                   AYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRYL
FT                   TSSVSWHDGRK"
FT   gene            375712..376630
FT                   /locus_tag="STM0332"
FT   regulatory      375712..375717
FT                   /locus_tag="STM0332"
FT                   /note="putative RBS for STM0332; RegulonDB:STMS1H000689"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        375716..376630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0332"
FT                   /product="putative hydrolase or acyltransferase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73780.1); Blastp hit to AAC73780.1 (254 aa), 33%
FT                   identity in aa 15 - 129"
FT                   /db_xref="EnsemblGenomes-Gn:STM0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19286"
FT                   /db_xref="GOA:Q8ZRI7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4NVR"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI7"
FT                   /protein_id="AAL19286.1"
FT                   /translation="MSTLIECGASPFIPGFALKDVRLENGLTVRVAIGGSGSPLVLLHG
FT                   HPQNHTTWRKVAPTLAQNHTVILPDLRGYGDSDKPTSDPAHRTYSKRTMAQDIVMLMDA
FT                   LGFSRFAFVGHDRGGRVGHRLALDYPDRVTCCTFIDIAPTATMYALTDKSFATRYFWWF
FT                   FLIQPFPLPETMIAHDPAFFLRKHISGQLKIEGATSQEAFNEYLRCYQNPEMIHAICED
FT                   YRAAATIDLDDDAADTSARIRCPLQLLWGGLGTVGQLYNVVGTWKEKALNVQGEALPCG
FT                   HSPQEECPEYFIQKLQSFLHSVL"
FT   gene            376656..377629
FT                   /locus_tag="STM0333"
FT   regulatory      376656..376661
FT                   /locus_tag="STM0333"
FT                   /note="putative RBS for STM0333; RegulonDB:STMS1H000690"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        376664..377629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0333"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="similar to E. coli putative transcriptional
FT                   regulator LYSR-type (AAC74869.1); Blastp hit to AAC74869.1
FT                   (314 aa), 44% identity in aa 2 - 307"
FT                   /db_xref="EnsemblGenomes-Gn:STM0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19287"
FT                   /db_xref="GOA:Q8ZRI6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI6"
FT                   /protein_id="AAL19287.1"
FT                   /translation="MKTTPVGKKHRQPLEGWPSVEDLFVFVTVARNGGFARAALELGLS
FT                   PSYISKRIAILEKCLNARLFFRNNRVMRLTPEGENALGGAMQVVSEMDGFVSRLDNQRG
FT                   VLAGNITINCSFGFGHKYVAEALSSFMIAYPDITVKLTLTDREVDLVEEGIDIEIRVGD
FT                   DINELYIARQLATNRRILCASPEYLERHGKPESVSALVQHDCLMIQEKNSAFGNWILTD
FT                   GKQQTHCRLNGFHSSNSGSVVLIWALKGHGITLRSEWDVAQYIERGELVRVLPQWYQEA
FT                   NIWAVYTRRSSSSDRIKICIDFLTEHLAQCLPGGKAPGVL"
FT   gene            complement(377574..377854)
FT                   /locus_tag="STM0334"
FT   CDS_pept        complement(377574..377846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0334"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI5"
FT                   /protein_id="AAL19288.1"
FT                   /translation="MTLKPGEKSGNNGGIYVEVGPRGGIKDNFATIAETKPRHQRNALK
FT                   ATGCWQKEHLTVNVSQSIWRHDSWRRLITVRPVLYRLASIVQDAP"
FT   regulatory      complement(377849..377854)
FT                   /locus_tag="STM0334"
FT                   /note="putative RBS for STM0334; RegulonDB:STMS1H000691"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            378531..378935
FT                   /locus_tag="STM0335"
FT   regulatory      378531..378536
FT                   /locus_tag="STM0335"
FT                   /note="putative RBS for STM0335; RegulonDB:STMS1H000692"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        378537..378935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0335"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19289"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI4"
FT                   /protein_id="AAL19289.1"
FT                   /translation="MKLIIILLLALFPLCSSASNHYALVFENNTILLVLNLKCSPCDLN
FT                   CANIQYQIFNKETESVISGVAKPVTTGIENNFRGYMMRNNNTFYTLIESDNENVWDMSV
FT                   EEKGTQQNKDAVQKVKYQLNAIFDNGTC"
FT   gene            complement(378982..379748)
FT                   /gene="stbE"
FT                   /locus_tag="STM0336"
FT   CDS_pept        complement(378982..379740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbE"
FT                   /locus_tag="STM0336"
FT                   /product="putative fimbriae; chaparone"
FT                   /note="similar to E. coli periplasmic chaperone, required
FT                   for type 1 fimbriae (AAC77272.1); Blastp hit to AAC77272.1
FT                   (241 aa), 30% identity in aa 32 - 241"
FT                   /db_xref="EnsemblGenomes-Gn:STM0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19290"
FT                   /db_xref="GOA:Q8ZRI3"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI3"
FT                   /protein_id="AAL19290.1"
FT                   /translation="MRNYRQWLVFSKVILTLLGLTGWYGPAQAAVNIDRTRIIFASDEV
FT                   AQSLTLSNDNTTPMLLQVWTDAGNIDASPDNSKTPLVALPPVFKMQPGELRTLRLLLSS
FT                   RQQLATDRESLFWLNIYQIPPVTQDIKNHPRKLVLPLRLRLKILIRPTGLKAPTEAEEK
FT                   KLRFIAKENTIRIVNPTSWYMSLTLTTDDKKSIGDIMVAPKTARDVPLTRSPTPGASIN
FT                   YAVISDSGNWRQYTAILEKYISENDFTPEF"
FT   gene            complement(379706..381038)
FT                   /gene="stbD"
FT                   /locus_tag="STM0337"
FT   CDS_pept        complement(379706..381031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbD"
FT                   /locus_tag="STM0337"
FT                   /product="putative fimbriae; usher"
FT                   /db_xref="EnsemblGenomes-Gn:STM0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19291"
FT                   /db_xref="GOA:Q8ZRI2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI2"
FT                   /protein_id="AAL19291.1"
FT                   /translation="MLFSFRTLLFITSLFVSAGTWSSCIKVTDKSALSDAAIKAGYTAQ
FT                   NWIGATDTNTGNIGLPTVISVSNSETFQPSGTLLASGIGNFLTAATGTPYSSKQVLYRC
FT                   DTADAGKLYEMYSTNGDSAFAGAFFTPEVEGAYYDVERNVAVRMTNLSTGEYYSRFWKE
FT                   RQLTADSWFQDDKYIYIPASAFSNVLYEMFKIDSRKYFAYQNPMDRDTWTQPRGYIAFK
FT                   GPGLITERIKAGLDHASDYYGWPSYWPGAWSTYNSVTYVRGALCKITDYPAIVKIPPVA
FT                   VGILAAGGNSQAPFHVSLECESGAVSSALPSTSAANVAMGFVVNQPTAVAAARRLGLTT
FT                   SAGGLSWLLDTHYGEPGVASGVGIRIYNDAGTPINLLPDRIKTGTGNARGWYGYKDLTT
FT                   RVSSGSVETYSGDFTASLEAIGGQTVTAGSVNAQLQAVVSFQ"
FT   regulatory      complement(379743..379748)
FT                   /gene="stbE"
FT                   /locus_tag="STM0336"
FT                   /note="putative RBS for stbE; RegulonDB:STMS1H000693"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(381033..381038)
FT                   /gene="stbD"
FT                   /locus_tag="STM0337"
FT                   /note="putative RBS for stbD; RegulonDB:STMS1H000694"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(381036..383603)
FT                   /gene="stbC"
FT                   /locus_tag="STM0338"
FT   CDS_pept        complement(381036..383597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbC"
FT                   /locus_tag="STM0338"
FT                   /product="putative fimbriae; usher"
FT                   /note="similar to E. coli outer membrane protein; export
FT                   and assembly of type 1 fimbriae, interrupted (AAC77273.1);
FT                   Blastp hit to AAC77273.1 (878 aa), 30% identity in aa 30 -
FT                   870"
FT                   /db_xref="EnsemblGenomes-Gn:STM0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19292"
FT                   /db_xref="GOA:Q8ZRI1"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI1"
FT                   /protein_id="AAL19292.1"
FT                   /translation="MSPTINLNRKSLALLIAIVCSGSAQGEEYYFDPALLQGATYGQNI
FT                   ARFNERQTPSGDYLADVYVNGTLVTSSTNIRFNAVKEGQQTEPCLPLSVMKAAQIKSLP
FT                   ATDAATECRPLREWVPHAGWQFDSATLRLLLTIPMTELTHKPRGYISPSEWDSGALALF
FT                   LRHNTNWTHTENTDSHYRYQYLWSGLNMGVNLGLWQVRHQSNLRYANSNQSGSAWRYNS
FT                   VRTWVQRPVASVNSILSLGDSYTDSSLFGSLSFNGAKLVTDERMRPQGKRGYAPEVRGV
FT                   AASSAHVVVKQLGKVIYETNVPPGPFYIDDLYNTRYQGDLEVEVIEASGKTSRFTVPYS
FT                   SVPDSVRPGNWHYSLAFGRVRQYYDIENRFFEGTFQHGVNNTITLNLGSRIAQRYQAWL
FT                   AGGVWATGMGAFGLNATWSNARAEHNDRQQGWRAELSYSKTFTTGTNLVLAAYRYSTNG
FT                   FRDLQDVLGVRREAKTGIDYYSDTLHQRNRLSATVSQPLGRLGTLNLSASTADYYNNQS
FT                   RITQLQMGYSNQWRNISYGVNIARQRTTWDYDRFYHGVNEPLDVSSRQKYTETTMSFNV
FT                   SIPLDWGENRTSVAMNYNQSSQSRSSTVSMTGSSGENSDLSWSVYGGYERYRNSNSDSS
FT                   APTTFGGNLQQNTRFGALRANYDQGDNYRQEGLGASGTLVLHPGGLTAGPYTSDTFALI
FT                   HADGAQGAIVQNGQGAVVDRFGYAILPSLSPYRVNNVTLDTRKMRSDAELTGGSQQIVP
FT                   YAGAIARVNFATISGKAVLISVKMPDGGIPPMGADVFNGEGTNIGMVGQSGQIYARIAH
FT                   PSGSLLVRWGTGANQRCRVAYQLDLHTKEPFLYLNKICEKE"
FT   gene            complement(383581..384357)
FT                   /gene="stbB"
FT                   /locus_tag="STM0339"
FT   CDS_pept        complement(383581..384342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="STM0339"
FT                   /product="putative fimbriae; chaparone"
FT                   /note="similar to E. coli probable pilin chaperone similar
FT                   to PapD (AAC73251.1); Blastp hit to AAC73251.1 (246 aa),
FT                   40% identity in aa 1 - 240"
FT                   /db_xref="EnsemblGenomes-Gn:STM0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19293"
FT                   /db_xref="GOA:Q8ZRI0"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI0"
FT                   /protein_id="AAL19293.1"
FT                   /translation="MKMDTRHSALYYLIVFLFLALPATASWASVTILGSRIIYPSTASS
FT                   VDVQLKNNDAIPYIVQTWFDDGDMNTSPENSSAMPLIATPPVFRIQPKAGQVVRVIYNN
FT                   TKKLPQDRESVFWFNVLQVPPTNIGSDSGQNKMLVMLRSRIKLFYRPDGLGKPDNLAKK
FT                   LQIKTVNKGSGKSGIVIVNPQPWFASLSNLNVKVNGASYNLDADMIAPFSSQTWWLPGK
FT                   RSLKSFSGTVTVTLVNDLGARISESYDVPHH"
FT   regulatory      complement(383598..383603)
FT                   /gene="stbB"
FT                   /locus_tag="STM0339"
FT                   /note="putative RBS for stbC; RegulonDB:STMS1H000695"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(384352..384357)
FT                   /gene="stbB"
FT                   /locus_tag="STM0339"
FT                   /note="putative RBS for stbB; RegulonDB:STMS1H000696"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(384404..384948)
FT                   /gene="stbA"
FT                   /locus_tag="STM0340"
FT   CDS_pept        complement(384404..384940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbA"
FT                   /locus_tag="STM0340"
FT                   /product="putative fimbriae; major subunit"
FT                   /note="similar to E. coli major type 1 subunit fimbrin
FT                   (pilin) (AAC77270.1); Blastp hit to AAC77270.1 (182 aa),
FT                   28% identity in aa 1 - 182"
FT                   /db_xref="EnsemblGenomes-Gn:STM0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19294"
FT                   /db_xref="GOA:Q8ZRH9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH9"
FT                   /protein_id="AAL19294.1"
FT                   /translation="MSMKKYLAMITGSLLVSSSAMAVSDNTITFQGEVSDETCSVVING
FT                   NQAKPVVLLPTVSTKDLSEQGKTAGPITFDIGLSGCTGSQDKTTKISTVFVGNQVTSNG
FT                   NLGNTGSAKNVEVQLLDTSGEPINLTGGFTGDGDLQLEPNASEASATYTARYYSTGKAE
FT                   AGTVAATLQYAVSYK"
FT   regulatory      complement(384943..384948)
FT                   /gene="stbA"
FT                   /locus_tag="STM0340"
FT                   /note="putative RBS for stbA; RegulonDB:STMS1H000697"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            385574..386338
FT                   /locus_tag="STM0341"
FT   CDS_pept        385574..386338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0341"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19295"
FT                   /db_xref="GOA:Q8ZRH8"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH8"
FT                   /protein_id="AAL19295.1"
FT                   /translation="MMDAVTFRIVMNETIFLLDKRVVFDSTKMTLSHGNEIIRISEAET
FT                   HLLLAFWHGLYKKEDIIHFVWENRGGCVSESSYYKLINQMRNDFSSIGLQSSDIVTRPR
FT                   VGVSLSVAIEPIKKITSLKVSDENVKGTTTRENIFYKNKRHSVFVVLTGAILLALLYGV
FT                   FTIYKAPVRNSPDSFFTYLGEYNDYAIYKTKEDKVTLSEVVFAFNSLKIKIYRQNGRHL
FT                   YYIREPNMNIFLQCLNPVEMAVPKCITVKERY"
FT   gene            386306..386610
FT                   /locus_tag="STM0342"
FT   regulatory      386306..386311
FT                   /locus_tag="STM0342"
FT                   /note="putative RBS for STM0342; RegulonDB:STMS1H000698"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        386311..386610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0342"
FT                   /product="putative periplasmic protein"
FT                   /note="unknown (gi|6707277)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19296"
FT                   /db_xref="GOA:Q8ZRH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH7"
FT                   /protein_id="AAL19296.1"
FT                   /translation="MYYSKRTLLIIFVIFIAIVAIGSIIALEWVNRDSYRTNNLICTTK
FT                   SEAYIAPRKLYMDGGLVLDLKSGRITLHYDVTTDTKEKRLFFVISASANCAERV"
FT   gene            387105..388684
FT                   /locus_tag="STM0343"
FT   regulatory      387105..387110
FT                   /locus_tag="STM0343"
FT                   /note="putative RBS for STM0343; RegulonDB:STMS1H000699"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        387110..388684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0343"
FT                   /product="putative diguanylate cyclase/phosphodiesterase
FT                   domain 1"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC75237.1); Blastp hit to AAC75237.1 (518 aa), 31%
FT                   identity in aa 10 - 512"
FT                   /db_xref="EnsemblGenomes-Gn:STM0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19297"
FT                   /db_xref="GOA:Q8ZRH6"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH6"
FT                   /protein_id="AAL19297.1"
FT                   /translation="MKVRKLFLMLFIAVPLIVMILVGLLAGIFQLKRDIAVSANTLLRF
FT                   SADISAASWQVAGKAARLAESSCTDTLKELSRTRAFTPYVRDIGFLENGDITCSFVTGT
FT                   ERYHFSRLAGLSLPASYPERWLRSIGSMAEGPDRLVVVYVKKVAADKAAFVIVDSQYVQ
FT                   ELMEILAAERASAFSLTFGAGEAITSAAKLRGKAFLTQRFTSTDHTIQLMVRTPFSTLS
FT                   AYWLQNLFIFIPLSLCLSVGMMLFYRRWYLKRLSLAREIARGITHNEFTVHYQPVFNVK
FT                   HGSCGGVEALMRWPQPDGRFITPDIFITAAENEGMIIPLSRHLFELIAHDVINWTVPDD
FT                   FYISVNISPAHLMDDGFIQDIEALRTRLGTITLMLELTERSLIVEPSQVAEKLSTLREK
FT                   GVLIAIDDFGTGYCSLSYLQQLPVDSLKIDRTFIDTIDTSSDDVPVLDTIITLSQRLGL
FT                   NVVAEGVSTQHQLRYILSHGVGFVQGFLYARPMGTNDFMSWLGKSAQRQNGLLKGESGS
FT                   ASDLVAE"
FT   gene            388778..389527
FT                   /locus_tag="STM0344"
FT   regulatory      388778..388783
FT                   /locus_tag="STM0344"
FT                   /note="putative RBS for STM0344; RegulonDB:STMS1H000700"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        388784..389527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0344"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:STM0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19298"
FT                   /db_xref="GOA:Q8ZRH5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH5"
FT                   /protein_id="AAL19298.1"
FT                   /translation="MSQNNYLIDKRVILDCERMTLSCAGESITISESERSLLIAFYEGL
FT                   FKKDDLINYVWGRKGVVVSDASYYKLINQLRGSFDKIGLKGASVVTRPRVGVLLSVSIE
FT                   PLSDEAQNTPLPAVAETEVSTVEVRHDDTIITPTPGAVNKKDWLYFCLAALLMFFMMYK
FT                   VKGENIDYFTLQGSYDGYTFYSVGHDKTHLTDIVEAYSEMSNEIHKQNGKIIYYIRVPN
FT                   TNIFVQCLNQLDIAEPKCISIKERY"
FT   gene            389494..389988
FT                   /locus_tag="STM0345"
FT   regulatory      389494..389499
FT                   /locus_tag="STM0345"
FT                   /note="putative RBS for STM0345; RegulonDB:STMS1H000701"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        389500..389988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0345"
FT                   /product="putative inner membrane protein"
FT                   /note="unknown (gi|6707277)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19299"
FT                   /db_xref="GOA:Q8ZRH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH4"
FT                   /protein_id="AAL19299.1"
FT                   /translation="MHFHKRTLLSVATLGMLAVSVVLMVVWVRNSNHSSINTNEFLCTT
FT                   RTVTTIQPKDIHADGSLVLDFKMKRITFQYEIKTKDNGVKILYRDVYMKNLHRTAPGVY
FT                   TFEVSQVKVFATDTAGELLSHLRVLHPEAANEIRISKVGEKTFFYSLNRQLYNVCTAQ"
FT   gene            390383..390913
FT                   /locus_tag="STM0346"
FT   regulatory      390383..390388
FT                   /locus_tag="STM0346"
FT                   /note="putative RBS for STM0346; RegulonDB:STMS1H000702"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        390389..390913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0346"
FT                   /product="putative outer membrane protein; homolog of ail
FT                   and ompX"
FT                   /note="unknown (gi|6707276)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19300"
FT                   /db_xref="GOA:Q8ZRH3"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH3"
FT                   /protein_id="AAL19300.1"
FT                   /translation="MKRRSSFLVFLGLLLASPLALANDQHTVSFGYAQTHLSSLKNSDS
FT                   KDLRGFNFKYRYEFNETWGMLGSFTATRNEMENYTWKEGKLHKNGSDSVDYGSLMFGPT
FT                   YRFNDYVSLYGNAGIATMKFNKHSKEDSFAYGAGVIFNPVKSISIDASWEASRFFAVDT
FT                   NTFGVSVGYRF"
FT   gene            391057..391698
FT                   /locus_tag="STM0347"
FT   CDS_pept        391057..391698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0347"
FT                   /product="putative response regulator"
FT                   /note="unknown (gi|6707275)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19301"
FT                   /db_xref="GOA:H9L417"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:H9L417"
FT                   /protein_id="AAL19301.1"
FT                   /translation="MINSLSEQLPLKTIGIVLTDDYYTYLGIASLFEDGKCFMFPLNGE
FT                   YNSCQISASEDIIIIIDGRVLIQGVWKGFKALMQHYPHARRIWLTRRDIGKLYPHGCDR
FT                   DPDIDPDLAKPVFIEHFIKYACANDVAVGEIAPLTKKEEELLWHFLYKKSMSQIASSYG
FT                   MSRKTLYIHRLRICRKYGFKRFFHLLFIYQRSRHIFASKICRVDKNADQA"
FT   gene            391703..391933
FT                   /locus_tag="STM0348"
FT   regulatory      391703..391708
FT                   /locus_tag="STM0348"
FT                   /note="putative RBS for STM0348; RegulonDB:STMS1H000703"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        391709..391933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0348"
FT                   /product="putative inner membrane protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19302"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH2"
FT                   /protein_id="AAL19302.1"
FT                   /translation="MKKLTMRECESINPTMLLAIKILISALDEKTKIRLREHIEKTEQE
FT                   IASSIHDSIMTETFLQQMKDIRYILNIVP"
FT   gene            391984..392350
FT                   /locus_tag="STM0349"
FT   regulatory      391984..391989
FT                   /locus_tag="STM0349"
FT                   /note="putative RBS for STM0349; RegulonDB:STMS1H000704"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        391991..392350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0349"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC77104.1); Blastp hit to AAC77104.1 (128 aa), 35%
FT                   identity in aa 15 - 127"
FT                   /db_xref="EnsemblGenomes-Gn:STM0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19303"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH1"
FT                   /protein_id="AAL19303.1"
FT                   /translation="MKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGKECSYLGDI
FT                   TGSQGNFFTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSSWHGSGSSK
FT                   QTNVTLSGNVYRCPR"
FT   gene            complement(392420..393948)
FT                   /locus_tag="STM0350"
FT   CDS_pept        complement(392420..393931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0350"
FT                   /product="homology to outer membrane efflux protein"
FT                   /note="similar to E. coli putative resistance protein
FT                   (AAC73673.1); Blastp hit to AAC73673.1 (457 aa), 37%
FT                   identity in aa 7 - 457"
FT                   /db_xref="EnsemblGenomes-Gn:STM0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19304"
FT                   /db_xref="GOA:Q8ZRH0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH0"
FT                   /protein_id="AAL19304.1"
FT                   /translation="MRTALIRMISKHNDGNGIMKITFTGYRQTATLATLAFVTTLAGCT
FT                   MAPKHERPASPTAMVYPYATSTVSGAPDAADIGWRDFFHDPLLQELIAIALRNNRDLRK
FT                   AGLNVEAARALYRIQRAEMLPTLGIATAMDASRTPADLSVMDESEINRRYEAAGATTAW
FT                   ELDLWGRVRSLSDQALAAYMALDETYIAARMSLVSEVASAWLTLRADRELLRLTEDTLA
FT                   AQKSSYTLTTQLARTGNATQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPL
FT                   TPELSRRLNEAVTLTEGAIPTTLPGGLPSDLLVRRPDIRAAEYRLRGANARIGAARAAF
FT                   FPTISLTGSAGTASASLSGLFEPGSGSWRFLPQITLPLFHGGALRADLDRAHVQKQIEI
FT                   ARYENVIQQAFRDVADGLAGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEGVDDYLTL
FT                   LDTHRMLYGAQQRLVRTRLMQQLNIINLYKALGGGWREYSEKKQG"
FT   gene            complement(393894..397067)
FT                   /locus_tag="STM0351"
FT   CDS_pept        complement(393894..397061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0351"
FT                   /product="putative cation efflux system protein"
FT                   /note="similar to E. coli integral transmembrane protein;
FT                   acridine resistance (AAC76298.1); Blastp hit to AAC76298.1
FT                   (1034 aa), 42% identity in aa 3 - 1030"
FT                   /db_xref="EnsemblGenomes-Gn:STM0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19305"
FT                   /db_xref="GOA:Q8ZRG9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG9"
FT                   /protein_id="AAL19305.1"
FT                   /translation="MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPTV
FT                   QVSASYPGANPQVIADTVAAPLEQVINGVDGMLYMNTQMAIDGRMVISIAFEQGTDPDM
FT                   AQIQVQNRVSRALPRLPEEVQRIGVVTEKTSPDMLMVVHLVSPQKRYDSLYLSNFAIRQ
FT                   VRDELARLPGVGDVLVWGAGEYAMRVWLDPAKIANRGLTASDIVTALREQNVQVAAGSV
FT                   GQQPEASAAFQMTVNTLGRLTSEEQFGEIVVKIGADGEVTRLRDVARVTLGADAYTLRS
FT                   LLNGEAAPALQIIQSPGANAIDVSNAIRGKMDELQQNFPQDIEYRIAYDPTVFVRASLQ
FT                   SVAITLLEALVLVVLVVVMFLQTWRASIIPLVAVPVSLVGTFALMHLFGFSLNTLSLFG
FT                   LVLSIGIVVDDAIVVVENVERHISQGKSPGEAAKKAMDEVTGPILSITSVLTAVFIPSA
FT                   FLAGLQGEFYRQFALTIAISTILSAINSLTLSPALAAILLRPHHDTAKADWLTRLMGTV
FT                   TGGFFHRFNRFFDSASNRYVSAVRRAVRGSVIVMVLYAGFVGLTWLGFHQVPNGFVPAQ
FT                   DKYYLVGIAQLPSGASLDRTEAVVKQMSAIALAEPGVESVVVFPGLSVNGPVNVPNSAL
FT                   MFAMLKPFDEREDPSLSANAIAGKLMHKFSHIPDGFIGIFPPPPVPGLGATGGFKLQIE
FT                   DRAELGFEAMTKVQSEIMSKAMQTPELANMLASFQTNAPQLQVDIDRVKAKSMGVSLTD
FT                   IFETLQINLGSLYVNDFNRFGRAWRVMAQADAPFRMQQEDIGLLKVRNAKGEMIPLSAF
FT                   VTIMRQSGPDRIIHYNGFPSVDISGGPAPGFSSGQATDAIEKIVRETLPEGMVFEWTDL
FT                   VYQEKQAGNSALAIFALAVLLAFLILAAQYNSWSLPFAVLLIAPMSLLSAIVGVWVSGG
FT                   DNNIFTQIGFVVLVGLAAKNAILIVEFARAKEHDGADPLTAVLEASRLRLRPILMTSFA
FT                   FIAGVVPLVLATGAGAEMRHAMGIAVFAGMLGVTLFGLLLTPVFYVVVRRMALKRENRV
FT                   DSHDQQA"
FT   regulatory      complement(393943..393948)
FT                   /locus_tag="STM0350"
FT                   /note="putative RBS for STM0350; RegulonDB:STMS1H000705"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(397058..398290)
FT                   /locus_tag="STM0352"
FT   CDS_pept        complement(397058..398284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0352"
FT                   /product="putative cation efflux pump"
FT                   /note="similar to E. coli acridine efflux pump
FT                   (AAC73565.1); Blastp hit to AAC73565.1 (397 aa), 31%
FT                   identity in aa 38 - 383"
FT                   /db_xref="EnsemblGenomes-Gn:STM0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19306"
FT                   /db_xref="GOA:Q8ZRG8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG8"
FT                   /protein_id="AAL19306.1"
FT                   /translation="MRRTFKIMLIAGVIAAIGGVIYMAGEALWDKDNAVGPPASAPPPP
FT                   SVPVAKALSRTLAPTAEFTGFLAAPETVELRSRVGGTLDAISVPEGRLVSRGQLLFQID
FT                   PRPFEVALDTAVAQLRQAEVLARQAQADFDRIQRLVASGAVSRKNADDVTATRNARQAQ
FT                   MQSAKAAVAAARLELSWTRITAPIAGRVDRILVTRGNLVSGGVAGNATLLTTIVSHNPM
FT                   YVYFDIDEATWLKALRHTRSDKNPPVVNMGLTTDNGLPYQGVLDFMGNQMNRSTGTIRA
FT                   RAVIPDPDGMLSPGLFARISLPIGEPRETVLIDDLAVSADQGKNYVLIVGKENQVEYRP
FT                   VELGQMVDGFRVVTQGVLPGEKIILKGLVRPGMTVAPRLVPMRQNVTDKQTATLTKADG
FT                   DSAPKAVRQ"
FT   regulatory      complement(397062..397067)
FT                   /locus_tag="STM0352"
FT                   /note="putative RBS for STM0351; RegulonDB:STMS1H000706"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(398285..398290)
FT                   /locus_tag="STM0352"
FT                   /note="putative RBS for STM0352; RegulonDB:STMS1H000707"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            398554..400849
FT                   /locus_tag="STM0353"
FT   regulatory      398554..398559
FT                   /locus_tag="STM0353"
FT                   /note="putative RBS for STM0353; RegulonDB:STMS1H000708"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        398561..400849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0353"
FT                   /product="putative cation transport ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="similar to E. coli putative ATPase (AAC73586.1);
FT                   Blastp hit to AAC73586.1 (834 aa), 42% identity in aa 99 -
FT                   831, 45% identity in aa 4 - 63"
FT                   /db_xref="EnsemblGenomes-Gn:STM0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19307"
FT                   /db_xref="GOA:Q8ZRG7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG7"
FT                   /protein_id="AAL19307.1"
FT                   /translation="MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLA
FT                   TERATVRGTASAEAVIAAIEKTGYKARPIETAGQGEDDSEEKKEAERVRLKRDLILASV
FT                   LALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFPALA
FT                   RLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEAR
FT                   AKGRTSEAIKRLVGLQARVAHVLREGRIVDIPVDEVVLGDCVEVRPGERIPVDGEVTEG
FT                   RSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRATAVGGQTMLAQIIRLVEQAQ
FT                   GSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCA
FT                   MGLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVA
FT                   SGFERREVLAKVAAVESRSEHPIARAIVVSAEEEGIALPGMSGFESVTGMGVYATVDGT
FT                   RVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQLAAIIAVADPIKPSTPA
FT                   AINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVA
FT                   FVGDGINDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIH
FT                   QNLFWAFAYNTALIPVAAGALFPVWGILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPM
FT                   ATPSDTSTT"
FT   gene            400853..401325
FT                   /locus_tag="STM0354"
FT   regulatory      400853..400858
FT                   /locus_tag="STM0354"
FT                   /note="putative RBS for STM0354; RegulonDB:STMS1H000710"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        400861..401325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0354"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to E. coli putative transcriptional
FT                   regulator (AAC73589.1); Blastp hit to AAC73589.1 (135 aa),
FT                   42% identity in aa 1 - 126"
FT                   /db_xref="EnsemblGenomes-Gn:STM0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19308"
FT                   /db_xref="GOA:Q8ZRG6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG6"
FT                   /protein_id="AAL19308.1"
FT                   /translation="MNIGKAAKASKVSAKMIRYYEQIGLIPAASRTDSGYRAYTQADVN
FT                   QLHFIRRARDLGFSVAEISDLLNLWNNQSRQSADVKRLAQTHIDELDRRIQNMQHMAQT
FT                   LKALIHCCAGDALPDCPILHTLGQPDDSEPEARTGAVLRRPRRHGLAKRL"
FT   gene            401396..401597
FT                   /locus_tag="STM0355"
FT   regulatory      401396..401401
FT                   /locus_tag="STM0355"
FT                   /note="putative RBS for STM0355; RegulonDB:STMS1H000711"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        401403..401597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0355"
FT                   /product="putative copper chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:STM0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19309"
FT                   /db_xref="GOA:Q8ZRG5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG5"
FT                   /protein_id="AAL19309.1"
FT                   /translation="MQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSL
FT                   SAEQIAAALQKAGFPPRER"
FT   gene            401883..403143
FT                   /locus_tag="STM0356"
FT   regulatory      401883..401888
FT                   /locus_tag="STM0356"
FT                   /note="putative RBS for STM0356; RegulonDB:STMS1H000712"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        401890..403143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0356"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC77235.1); Blastp hit to AAC77235.1 (425 aa), 28%
FT                   identity in aa 33 - 412"
FT                   /db_xref="EnsemblGenomes-Gn:STM0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19310"
FT                   /db_xref="GOA:Q8ZRG4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG4"
FT                   /protein_id="AAL19310.1"
FT                   /translation="MYTPLNWTTTQRHVAFACFTSWMLDAFDFFILVFVLSDLAEWFHA
FT                   SVSDVSIAIMLTLAVRPIGALLFGRMAEKYGRRPILMLNILFFTVFELLSAWSPTFMAF
FT                   LIFRVMYGVAMGGIWGVASSLAMETIPDRSRGLMSGIFQAGYPCGYLFASVIFGLFYSM
FT                   VGWRGMFLIGALPVVLLPYIWFKVPESPVWLAARARKENTALLPVLRKQWKLCLYLVLV
FT                   MAFFNFFSHGTQDLYPTFLKMQHGFDPHLISIIAIFYNIAAMLGGIFYGTLSERIGRKK
FT                   AIMIAAFLALPVLPLWAFSSGSFTIGLGAFLMQFMVQGAWGVVPTWLNELVPANARAVL
FT                   PGFVYQLGNLLASVNATLQARIAETHGGNYGLAMAIVAGAVAILICVFVAFGRETRGVV
FT                   ISGTDSDALPESAISHRT"
FT   gene            403326..405290
FT                   /gene="mod"
FT                   /locus_tag="STM0357"
FT   regulatory      403326..403331
FT                   /gene="mod"
FT                   /locus_tag="STM0357"
FT                   /note="putative RBS for mod; RegulonDB:STMS1H000713"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        403332..405290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mod"
FT                   /locus_tag="STM0357"
FT                   /product="DNA methylase; restriction system"
FT                   /note="type iii restriction-modification system stylti
FT                   enzyme mod (stylti methyltransferase) (SW:T3MO_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19311"
FT                   /db_xref="GOA:P40814"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041405"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40814"
FT                   /protein_id="AAL19311.1"
FT                   /translation="MLKDNQKHNESVAPNSAFLSELQRALPEFFTADRYNEQGELIAKG
FT                   GFDLARFERALKARNIDELTSGYQIDFIGKDYAKKQAGEKSVTVIVPDVEHNTLAENKN
FT                   SHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSDGFVYPDHFEYSDRALQDMFG
FT                   LNDTELARLKSIQGKSTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMD
FT                   EIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAKTGQGALRLEPLSKEYIQKSY
FT                   KEPTEQFPEGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHERLWAYPEASYQKLVADNL
FT                   VYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFDTPKPTAL
FT                   LKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEEDGGQRTFILCTIDQALSNNTIAKK
FT                   AGYNTIDEISRERITRVAAKIRANNPATNSDLGFKHYRFATPTQQTLDDLDSFDIATGH
FT                   FINTSGQLAAFTESGFTDMINPFSARGLGVPGGASGEETLLTTWLVADGYKMDIDVQTV
FT                   DFSGYCARYVDNTRLYLIDERWGTEQTRDLLNHIGTHQLPVQTIVIYGYSFDLESIREL
FT                   EIGLKQLDQKVNLVKRY"
FT   gene            405293..408272
FT                   /gene="res"
FT                   /locus_tag="STM0358"
FT   regulatory      405293..405298
FT                   /gene="res"
FT                   /locus_tag="STM0358"
FT                   /note="putative RBS for res; RegulonDB:STMS1H000714"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        405300..408272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="res"
FT                   /locus_tag="STM0358"
FT                   /product="DNA restriction (DNA helicase)"
FT                   /note="type iii restriction-modification system stylti
FT                   enzyme res (SW:T3RE_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19312"
FT                   /db_xref="GOA:P40815"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40815"
FT                   /protein_id="AAL19312.1"
FT                   /translation="MMNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERY
FT                   DDKANIDVKMETGTGKTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYAR
FT                   QHFSQFYENTRMELCTINAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQML
FT                   NSASMTRDDYDQTLLGGLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIV
FT                   RFGATFPDIVEGKGKNKCVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQAN
FT                   NRYIVDSVTAKKLILRRGSKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGM
FT                   ALVPGTFGASYQELIIQDAIDKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYR
FT                   DDEGWLKVTFERLLKKKLTQLIDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYF
FT                   GEDRGSGDEAIQAEVDDILKNKEKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVI
FT                   AKLRSSGSESSKIQEVGRGLRLPVDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEI
FT                   NRDSKVQLNEQKLDEAMITLIVTERQKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTL
FT                   NGETKSGFAWLLEFYPELTQARVRADRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRR
FT                   YMLQFERSGASLEQIAAEVLRDPALYIRQKPSQVQQRLVSNEDNGRFEVAQREGELAAS
FT                   EFMAGMKYGHFLKQLALRTSLPVNVLHPVLMAMLRDVLHGDSRYLSEISLDNMTRALQT
FT                   RINAHFAQRHDYLPLDFQASTSVFDSTARQFREEISAEIVGKNVDENAIDDPRSLYQIP
FT                   PLRYDSVDPELPLLKYDYPQQVSVFGKLPKRAIQIPKYTGGSTTPDFVYRIERQDADSV
FT                   YLLVETKAENMRVGDQVILDAQRKFFDMLRRQNINVEFAEATSAPAVFSTINGLIEGKA
FT                   N"
FT   gene            408544..408650
FT                   /locus_tag="STM0359"
FT   regulatory      408544..408549
FT                   /locus_tag="STM0359"
FT                   /note="putative RBS for STM0359; RegulonDB:STMS1H000715"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        408549..408650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0359"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR50"
FT                   /protein_id="AAL19313.1"
FT                   /translation="MLNRYYRFAVEKDDPSEAPESGDKPDSQPQKKS"
FT   gene            408761..410170
FT                   /locus_tag="STM0360"
FT   regulatory      408761..408766
FT                   /locus_tag="STM0360"
FT                   /note="putative RBS for STM0360; RegulonDB:STMS1H000716"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        408767..410170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0360"
FT                   /product="cytochrome BD2 subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.2.1.41"
FT                   /note="similar to E. coli probable third cytochrome
FT                   oxidase, subunit I (AAC74063.1); Blastp hit to AAC74063.1
FT                   (514 aa), 38% identity in aa 2 - 316, 38% identity in aa
FT                   381 - 512"
FT                   /db_xref="EnsemblGenomes-Gn:STM0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19314"
FT                   /db_xref="GOA:Q8ZRG3"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG3"
FT                   /protein_id="AAL19314.1"
FT                   /translation="MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTR
FT                   NPVWRSLYQFWLKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTA
FT                   FFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEIHNG
FT                   QVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRMFSMA
FT                   LWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAER
FT                   TRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGL
FT                   ASLWLRYRRRLYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVS
FT                   AHSTLQMSISLLAFFVVYSLVFGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVG
FT                   ESLEQEKRE"
FT   gene            410159..411177
FT                   /locus_tag="STM0361"
FT   regulatory      410159..410164
FT                   /locus_tag="STM0361"
FT                   /note="putative RBS for STM0361; RegulonDB:STMS1H000717"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        410167..411177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0361"
FT                   /product="cytochrome BD2 subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.2.1.41"
FT                   /note="similar to E. coli cytochrome d terminal oxidase
FT                   polypeptide subunit II (AAC73828.1); Blastp hit to
FT                   AAC73828.1 (379 aa), 34% identity in aa 7 - 221, 22%
FT                   identity in aa 121 - 366"
FT                   /db_xref="EnsemblGenomes-Gn:STM0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19315"
FT                   /db_xref="GOA:Q8ZRG2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG2"
FT                   /protein_id="AAL19315.1"
FT                   /translation="MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRDV
FT                   MVNSVAPVWDGNETWLVLGGAGLFGAFPLAYAVITDALTIPLVVMLLGLIFRGVAFEFR
FT                   FKATESHRAFWDKSFIVGSILATFAQGVVVGAVVSGFQVEGRTFSGSQLDWLTPFNLFC
FT                   GVGLVVTYALLGATWLIMKSEDPLHSRMCALSRPLLIVLLLVMGGVSVWTPLTHDDIAE
FT                   RWFTLPNLYYFLPVPVLVLAFSVWLWRSVKKPESHARPFILTLGLIFLGFSGLGISIWP
FT                   NIIPPDISLYAAAAPPQSQSFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEGYH"
FT   gene            411190..411418
FT                   /locus_tag="STM0362"
FT   regulatory      411190..411195
FT                   /locus_tag="STM0362"
FT                   /note="putative RBS for STM0362; RegulonDB:STMS1H000718"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        411194..411418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0362"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG1"
FT                   /protein_id="AAL19316.1"
FT                   /translation="MVAASRMDGRDMVRQRASAGGRRNVIQTAHDLRRISLLTDTPGRA
FT                   FVAGESAFLSTDRRLSITFARLISPLNSG"
FT   gene            411510..412518
FT                   /locus_tag="STM0363"
FT   regulatory      411510..411515
FT                   /locus_tag="STM0363"
FT                   /note="putative RBS for STM0363; RegulonDB:STMS1H000719"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        411514..412518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0363"
FT                   /product="putative transcription regulator, AraC family"
FT                   /note="putative XylS/AraC transcriptional activator
FT                   (gi|3094022)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19317"
FT                   /db_xref="GOA:Q8ZRG0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG0"
FT                   /protein_id="AAL19317.1"
FT                   /translation="MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQS
FT                   SPVLHGDIEEIALPGGICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTF
FT                   LLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWENSATS
FT                   ARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGLPVTG
FT                   EYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLAR
FT                   ARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA"
FT   gene            412664..414772
FT                   /gene="foxA"
FT                   /locus_tag="STM0364"
FT   CDS_pept        412664..414772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="foxA"
FT                   /locus_tag="STM0364"
FT                   /product="ferrioxamine receptor"
FT                   /note="ferrioxamine B receptor precursor. (SW:FOXA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19318"
FT                   /db_xref="GOA:P0CL48"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CL48"
FT                   /protein_id="AAL19318.1"
FT                   /translation="MPLEMFMFATTRMALLIGGAIGGATFPLFAQETTKNDTVIVTSPV
FT                   QSGATKLATPDIETPQSVSIITRQQFEEQGATSVRQAVSYTPGVYSNQIGASNRFDYIV
FT                   LRGFSDGSLDNVYLDGLKMMGDTNSHSSLVVDPWFLEDIEVVRGPASVLYGRSSPGGIV
FT                   ALTSRKPAFDAGGEVKLFAGNNNQRGAAFDVTGPLDDNERVAARLSGMTRYADSQFTPL
FT                   KEERYALMPSLTWRITDRTRLDLMAYPHRDPEGGSHSGLPYQGTVVPYNGGKISNTFFE
FT                   GEDDYDKYDRRENMVGYNIEHLFDNGWSVRQKLRYLHTKVTLNQVYAAGWLNETALNRG
FT                   YSGSGEKMSAIALDNQLDGSVDTGAINHRLLVGIDYQDRSNHTTGYYGAFPPIDAFNPV
FT                   YGAQPDYITLYSREKHKLRQTGYYLQDQMSWDRWRFTLGGRYDRVSVSNIDKLHDSRSD
FT                   LDKNNVSTRAALLYLFDNGVAPYLSYSTAFTPTSFADENGNVLEPMKGKQWEAGVKYEP
FT                   PGGNSQFSAAVYRINQTNIATKEEPTDPYRSIGEIESKGVELEAISHLSDSVRLQAAYT
FT                   YTDIRYKKSSPQEQGKRAVYAPRNQASAWLSYDVKSGLLEGLTLGSGIRYVNGVTSDRL
FT                   NTHTLPSYTLVDMVVGYDLSSIGLNGLSAQLNVNNLTDKRYVAACNSLSYCYFGAERSI
FT                   VGSVSWAF"
FT   gene            complement(414813..415461)
FT                   /gene="yahN"
FT                   /locus_tag="STM0365"
FT   CDS_pept        complement(414813..415445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="STM0365"
FT                   /product="putative transport protein"
FT                   /note="similar to E. coli putative cytochrome subunit of
FT                   dehydrogenase (AAC73431.1); Blastp hit to AAC73431.1 (223
FT                   aa), 86% identity in aa 14 - 223"
FT                   /db_xref="EnsemblGenomes-Gn:STM0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19319"
FT                   /db_xref="GOA:Q8ZRF9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF9"
FT                   /protein_id="AAL19319.1"
FT                   /translation="MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITGL
FT                   GVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMSTLQ
FT                   TPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSSVIW
FT                   RIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGVTHR"
FT   regulatory      complement(415456..415461)
FT                   /gene="yahN"
FT                   /locus_tag="STM0365"
FT                   /note="putative RBS for yahN; RegulonDB:STMS1H000720"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            415665..415952
FT                   /gene="yahO"
FT                   /locus_tag="STM0366"
FT   regulatory      415665..415670
FT                   /gene="yahO"
FT                   /locus_tag="STM0366"
FT                   /note="putative RBS for yahO; RegulonDB:STMS1H000721"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        415677..415952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="STM0366"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73432.1); Blastp hit to AAC73432.1 (91 aa), 72%
FT                   identity in aa 1 - 91"
FT                   /db_xref="EnsemblGenomes-Gn:STM0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19320"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="PDB:2MA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR49"
FT                   /protein_id="AAL19320.1"
FT                   /translation="MKTGYKVMLGALAFVVTNVYAAEIMKKTDFDKVASEYTKIGTIST
FT                   TGEMSPLDAREDLIKKADEKGADVVVLTSGQTENKIHGTADIYKKK"
FT   gene            complement(416088..417730)
FT                   /gene="prpR"
FT                   /locus_tag="STM0367"
FT   CDS_pept        complement(416088..417713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="STM0367"
FT                   /product="regulator for prp operon (EBP family)"
FT                   /note="propionate catabolism operon regulatory protein.
FT                   (SW:PRPR_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19321"
FT                   /db_xref="GOA:P74839"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P74839"
FT                   /protein_id="AAL19321.1"
FT                   /translation="MTTAHSAPRDNSDKPVIWTVSVTRLFELFRDISLEFDHLATITPI
FT                   QLGFEKAVTYIRKKLATERCDAIIAAGSNGAYLKSRLSIPVILIKPSGFDVLQALAKAG
FT                   KLTSSIGIVTYQETIPALLAFQKTFHLRLEQRSYVTEEDARGQINELKANGIEAVVGAG
FT                   LITDLAEEAGMTAIFIYSAATVRQAFHDALDMTRLTRRQRVDYPSGKGLQTRYELGDIR
FT                   GQSPQMEQLRQTITLYARSRAAVLIQGETGTGKELAAQAIHQTFFHRQPHRQNKPSPPF
FT                   VAVNCGAITESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQT
FT                   RLLRVLEEKAVTRVGGHQPIPVDVRVISATHCDLDREIMQGRFRPDLFYRLSILRLTLP
FT                   PLRERQADILPLAESFLKQSLAAMEIPFTESIRHGLTQCQPLLLAWRWPGNIRELRNMM
FT                   ERLALFLSVDPAPTLDRQFMRQLLPELMVNTAELTPSTVDANALQDVLARFKGDKTAAA
FT                   RYLGISRTTLWRRLKAGAKDQSDN"
FT   regulatory      complement(417725..417730)
FT                   /gene="prpR"
FT                   /locus_tag="STM0367"
FT                   /note="putative RBS for prpR; RegulonDB:STMS1H000722"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            417967..418865
FT                   /gene="prpB"
FT                   /locus_tag="STM0368"
FT   regulatory      417967..417972
FT                   /gene="prpB"
FT                   /locus_tag="STM0368"
FT                   /note="putative RBS for prpB; RegulonDB:STMS1H000723"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        417978..418865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="STM0368"
FT                   /product="putative carboxyphosphonoenolpyruvate mutase"
FT                   /EC_number="2.7.8.23"
FT                   /note="putative carboxyvinyl-carboxyphosphonate
FT                   phosphorylmutase. (SW:CPPM_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19322"
FT                   /db_xref="GOA:Q56062"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="PDB:1O5Q"
FT                   /db_xref="PDB:1UJQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56062"
FT                   /protein_id="AAL19322.1"
FT                   /translation="MSLHSPGQAFRAALAKENPLQIVGAINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLLVDADIGFGSSAFNVARTVKSI
FT                   AKAGAAALHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPNFVIMARTDALA
FT                   VEGLEAALDRAQAYVDAGADMLFPEAITELSMYRRFADVAQVPILANITEFGATPLFTT
FT                   DELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNELYESINYYQ
FT                   FEEKLDALYRNKKS"
FT   gene            418979..420157
FT                   /gene="prpC"
FT                   /locus_tag="STM0369"
FT   regulatory      418979..418984
FT                   /gene="prpC"
FT                   /locus_tag="STM0369"
FT                   /note="putative RBS for prpC; RegulonDB:STMS1H000724"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        418988..420157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="STM0369"
FT                   /product="putative citrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /note="methylcitrate synthase. (SW:CISZ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19323"
FT                   /db_xref="GOA:Q56063"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="PDB:3O8J"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56063"
FT                   /protein_id="AAL19323.1"
FT                   /translation="MTDTTILQNNTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDVYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSEEGGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPEDRPFVSIDDRC"
FT   gene            420182..421648
FT                   /gene="prpD"
FT                   /locus_tag="STM0370"
FT   regulatory      420182..420187
FT                   /gene="prpD"
FT                   /locus_tag="STM0370"
FT                   /note="putative RBS for prpD; RegulonDB:STMS1H000725"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        420197..421648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="STM0370"
FT                   /product="putative protein in propionate catabolism"
FT                   /note="PRPD protein. (SW:PRPD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19324"
FT                   /db_xref="GOA:P74840"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P74840"
FT                   /protein_id="AAL19324.1"
FT                   /translation="MSTQELNIRPDFDREIVDIVDYVMNYEITSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGARVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVAAGKAPLTMKQVLSGMIKAHEIQGCIALENA
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAKTWGFYDVSFKGETFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACLRIIDKKGPLNN
FT                   PADRDHCIQYMVAVPLLFGRLTAADYEDEVAQDKRIDALREKIVCYEDPAFTADYHDPE
FT                   KRAIGNAITVEFTDGSRFGEVVVEYPIGHARRRADGIPKLIEKFKINLARQFPTRQQQR
FT                   ILDVSLDRARLEQMPVNEYLDLYVI"
FT   gene            421677..423575
FT                   /gene="prpE"
FT                   /locus_tag="STM0371"
FT   regulatory      421677..421682
FT                   /gene="prpE"
FT                   /locus_tag="STM0371"
FT                   /note="putative RBS for prpE; RegulonDB:STMS1H000726"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        421689..423575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="STM0371"
FT                   /product="putative acetyl-CoA synthetase, propionate
FT                   catabolism operon"
FT                   /note="PRPE protein. (SW:PRPE_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19325"
FT                   /db_xref="GOA:P55912"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55912"
FT                   /protein_id="AAL19325.1"
FT                   /translation="MSFSEFYQRSINEPEAFWAEQARRIDWRQPFTQTLDHSRPPFARW
FT                   FCGGTTNLCHNAVDRWRDKQPEALALIAVSSETDEERTFTFSQLHDEVNIVAAMLLSLG
FT                   VQRGDRVLVYMPMIAEAQITLLACARIGAIHSVVFGGFASHSVAARIDDARPALIVSAD
FT                   AGARGGKILPYKKLLDDAIAQAQHQPKHVLLVDRGLAKMAWVDGRDLDFATLRQQHLGA
FT                   SVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTYPDCGVWWKIVEKYQVNRMFSAPTAIRVL
FT                   KKFPTAQIRNHDLSSLEALYLAGEPLDEPTASWVTETLGVPVIDNYWQTESGWPIMALA
FT                   RALDDRPSRLGSPGVPMYGYNVQLLNEVTGEPCGINEKGMLVIEGPLPPGCIQTIWGDD
FT                   ARFVKTYWSLFNRQVYATFDWGIRDAEGYYFILGRTDDVINIAGHRLGTREIEESISSY
FT                   PNVAEVAVVGIKDALKGQVAVAFVIPKQSDTLADREAARDEENAIMALVDNQIGHFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLQQIRQAIEE"
FT   gene            complement(423679..424663)
FT                   /gene="hemB"
FT                   /locus_tag="STM0372"
FT   CDS_pept        complement(423679..424653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="STM0372"
FT                   /product="5-aminolevulinate dehydratase (porphobilinogen
FT                   synthase)"
FT                   /EC_number="4.2.1.24"
FT                   /note="similar to E. coli 5-aminolevulinate dehydratase =
FT                   porphobilinogen synthase (AAC73472.1); Blastp hit to
FT                   AAC73472.1 (335 aa), 93% identity in aa 12 - 335"
FT                   /db_xref="EnsemblGenomes-Gn:STM0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19326"
FT                   /db_xref="GOA:Q7CR48"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR48"
FT                   /protein_id="AAL19326.1"
FT                   /translation="MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYK
FT                   AIDAMPGVMRIPEKQLAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSR
FT                   ICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIA
FT                   PSAAMDGQVQAIRQALDAAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMN
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKF
FT                   AAMAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKNILR"
FT   regulatory      complement(424658..424663)
FT                   /gene="hemB"
FT                   /locus_tag="STM0372"
FT                   /note="putative RBS for hemB; RegulonDB:STMS1H000727"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            425151..428102
FT                   /gene="yaiU"
FT                   /locus_tag="STM0373"
FT   regulatory      425151..425156
FT                   /gene="yaiU"
FT                   /locus_tag="STM0373"
FT                   /note="putative RBS for yaiU; RegulonDB:STMS1H000728"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        425166..428102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiU"
FT                   /locus_tag="STM0373"
FT                   /product="flagellar protein"
FT                   /note="similar to 3rd module of ATP-binding components of
FT                   transporters; similar to E. coli putative flagellin
FT                   structural protein (AAC73477.1); Blastp hit to AAC73477.1
FT                   (467 aa), 91% identity in aa 1 - 467"
FT                   /db_xref="EnsemblGenomes-Gn:STM0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19327"
FT                   /db_xref="GOA:Q8ZRF8"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRF8"
FT                   /protein_id="AAL19327.1"
FT                   /translation="MHSWKKKLVVSQLALACTLAITSQANATTYDTWTYYDNPTTALDW
FT                   NNMDAAGTVDGNYVNYSGFVYYNNANGDFDQTFNGDTVNGTISTYYLNHDYNDATSNEL
FT                   NISNSVIHGSITSMLPIGYYDRFDTLDHDGYSEYYRFNNGTDTVDGNWYDGDVFTLNIA
FT                   NSTIDDDYEAFYFTDSYKDGDVTKYTNETFDVSEGVAVNLDVESNINISNNSRVAGIAL
FT                   SQGNTYNNTYTTESHNWDNNINVFDSTVTSGSDYILDSAYTTDTGTFGTGHFGNSDEPS
FT                   DYTGAGDVALSFTDDNGASDYAMKNNVYFSNSTLMGDVKFTSNWNANFDADGDDTNGDG
FT                   VPDTNHGWADDGLNVDELNLTLDNGSKWVGQATYTVDTTSRMYDVETNSLTPGATLEDN
FT                   AWNRIVGNEVFQSGVFNVTLNNGSEWDTVGDSTVDTLAVNNGSQVNVSNSDLTSDTIDL
FT                   TNGSSLNIGEGGYVDTDHLTIDSYSTVGLTESTGWSTYSNLYANTITVTNGGVLDVNVG
FT                   QFDTEVFSTDKLELTSGNTADHNGNVVSGVFNIHSSDYVLNADLVNDRTWDTTQANYGY
FT                   GTIAMNSDGHLTINGNGDINNGDELDNSSVDNVVAATGNYKVRIDNATGAGSVADYKGN
FT                   ELIYVNDVNTDATFSAANKADLGAYTYQAKQEGNTVVLEQMELTDYANMALSIPSANTN
FT                   IWNLEQDTVGTRLTNARHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKV
FT                   DGNNAKWIVGAAAGFAKGDLSDRTGQVDQDSQSAYIYSSARFANNIFVDGNLSYSHFNN
FT                   DLSANMSDGTYVDGNTSSDAWGFGLKLGYDLKLGDAGYVTPYGSVSGLFQSGDDYQLSN
FT                   DMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDADVNGDSIDNG
FT                   VEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
FT   gene            428177..428811
FT                   /gene="yaiV"
FT                   /locus_tag="STM0374"
FT   regulatory      428177..428182
FT                   /gene="yaiV"
FT                   /locus_tag="STM0374"
FT                   /note="putative RBS for yaiV; RegulonDB:STMS1H000729"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        428188..428811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="STM0374"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73478.1); Blastp hit to AAC73478.1 (222 aa), 71%
FT                   identity in aa 16 - 222"
FT                   /db_xref="EnsemblGenomes-Gn:STM0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19328"
FT                   /db_xref="GOA:Q8ZRF7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRF7"
FT                   /protein_id="AAL19328.1"
FT                   /translation="MLSLSKPLQEFYRLDKCLSKHGTRFEFVNDKEIICSPDESNTHTF
FT                   VILEGVVSLVRGDKVLIGIVQAPFIFGLADGVAKKEAQYKLIAESGCIGYRLSSSQTLA
FT                   IIEQNQLWREAFCWIVWKSQVLELRDKQLIGNNSYDQIRATLMTMIEWDEELRSRIGVM
FT                   NYIHQRTRVSRSVVAEVLAALRKGNYIEMNKGKLISINRLPSEY"
FT   gene            complement(428856..429986)
FT                   /gene="ampH"
FT                   /locus_tag="STM0375"
FT   CDS_pept        complement(428856..429986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="STM0375"
FT                   /product="penicillin-binding protein"
FT                   /note="similar to E. coli putative enzyme (AAC73479.1);
FT                   Blastp hit to AAC73479.1 (385 aa), 91% identity in aa 10 -
FT                   385"
FT                   /db_xref="EnsemblGenomes-Gn:STM0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19329"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF6"
FT                   /protein_id="AAL19329.1"
FT                   /translation="MLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFYGSGATGMALV
FT                   VIDGNQRVFRSFGDTRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQGTVKLNDPLS
FT                   KYAPPGARVPTYQGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWNWLSTAT
FT                   LKVAPGSQAAYSNLAFDLLADALATASGKPYTQLFEEKITRPLGMKDTTFTPSPDQCKR
FT                   LMVAEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHRSQQADRMQTLIYQR
FT                   IQLKKIIGMDVPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAMIPQYNIGAF
FT                   VVVTRSPLTRFTNMSDGINDLVTELSGNKPIAIPAS"
FT   gene            430348..431580
FT                   /gene="sbmA"
FT                   /locus_tag="STM0376"
FT   regulatory      430348..430353
FT                   /gene="sbmA"
FT                   /locus_tag="STM0376"
FT                   /note="putative RBS for sbmA; RegulonDB:STMS1H000730"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        430360..431580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="STM0376"
FT                   /product="putative ABC superfamily transporter"
FT                   /note="similar to E. coli sensitivity to microcin B17,
FT                   possibly envelop protein (AAC73480.1); Blastp hit to
FT                   AAC73480.1 (406 aa), 92% identity in aa 1 - 406"
FT                   /db_xref="EnsemblGenomes-Gn:STM0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19330"
FT                   /db_xref="GOA:Q8ZRF5"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF5"
FT                   /protein_id="AAL19330.1"
FT                   /translation="MFKSFFPKPGPFFMSAFVWALIAVIFWQAGGGDWVARLVGASDEV
FT                   PISAARFWSLDYLIFYAYYLICVGLFATFWFIYSPHRWQYWSILGTSLIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTLGQFYHEVGVFLGIALIAVVIGVLNNFFVSHYV
FT                   FRWRTAMNEHYMAHWQYLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPNLPIVGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDASRATPPTVRELFSAVRHNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGSFQYLINSWTTLVELMSIYKRLRSFERQLDGQPVQ
FT                   EVTHSFS"
FT   gene            431584..432689
FT                   /gene="yaiW"
FT                   /locus_tag="STM0377"
FT   regulatory      431584..431589
FT                   /gene="yaiW"
FT                   /locus_tag="STM0377"
FT                   /note="putative RBS for yaiW; RegulonDB:STMS1H000731"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        431595..432689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="STM0377"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73481.1); Blastp hit to AAC73481.1 (364 aa), 85%
FT                   identity in aa 1 - 362"
FT                   /db_xref="EnsemblGenomes-Gn:STM0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19331"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF4"
FT                   /protein_id="AAL19331.1"
FT                   /translation="MSAASRLYPLPFLAVAILAGCSSQSGQPVSKGEKPVDVASVVRQK
FT                   MPASVKDREAWAKDIATTFKSQGLAPTVENICSVLAVAQQESGYQADPVVPGLSKIAWQ
FT                   EIDRRAERLHIPLFLVHTALKINSPNGKSYSERLDTVKTEKQLSAIFDDFINMVPMGQT
FT                   LFGSYNPVHTGGPMQVSIAFAEQHAKGYPWKMTGTVRQEVFTRRGGLWFGTYHLLNYPA
FT                   NYSAPVFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYNSKEPGKTELAVRK
FT                   LAGQLGMSEREIRSQLEKGDSLAFEKTALYKKVYKLAEAKTGKTLAREMLPGIQLESPK
FT                   ITRKLTTAWFAKRVDERRARCMGR"
FT   gene            complement(432727..433047)
FT                   /gene="yaiY"
FT                   /locus_tag="STM0378"
FT   CDS_pept        complement(432727..433035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="STM0378"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73482.1); Blastp hit to AAC73482.1 (102 aa), 86%
FT                   identity in aa 1 - 102"
FT                   /db_xref="EnsemblGenomes-Gn:STM0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19332"
FT                   /db_xref="GOA:Q7CR47"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR47"
FT                   /protein_id="AAL19332.1"
FT                   /translation="MADFTLSKSLFSGKHRETSSTPGNIAYAIFVLFCFWAGAQLLNLL
FT                   VHAPGIYEHLMQVQDTGRPRVEIGLGVGTIFGLVPFLTGCLIFAVIAAFLRWRHRHQ"
FT   regulatory      complement(433042..433047)
FT                   /gene="yaiY"
FT                   /locus_tag="STM0378"
FT                   /note="putative RBS for yaiY; RegulonDB:STMS1H000732"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            433292..433518
FT                   /gene="yaiZ"
FT                   /locus_tag="STM0379"
FT   regulatory      433292..433297
FT                   /gene="yaiZ"
FT                   /locus_tag="STM0379"
FT                   /note="putative RBS for yaiZ; RegulonDB:STMS1H000733"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        433303..433518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="STM0379"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73483.1); Blastp hit to AAC73483.1 (114 aa), 84%
FT                   identity in aa 45 - 114"
FT                   /db_xref="EnsemblGenomes-Gn:STM0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19333"
FT                   /db_xref="GOA:Q8ZRF3"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF3"
FT                   /protein_id="AAL19333.1"
FT                   /translation="MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGL
FT                   VTWIISFWLAGFIIRRREEDEVKDAR"
FT   gene            complement(433544..434656)
FT                   /gene="ddlA"
FT                   /locus_tag="STM0380"
FT   CDS_pept        complement(433544..434638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="STM0380"
FT                   /product="D-alanine-D-alanine ligase A"
FT                   /EC_number="6.3.2.4"
FT                   /note="D-alanine--D-alanine ligase A. (SW:DDLA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19334"
FT                   /db_xref="GOA:P0A1F0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="PDB:3I12"
FT                   /db_xref="PDB:3Q1K"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1F0"
FT                   /protein_id="AAL19334.1"
FT                   /translation="MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDK
FT                   AGQWHVNDAENYLQNADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTR
FT                   TNRHAFSFAEVESRLGLPLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQ
FT                   GIKGREIECAVLGNDNPQASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPSEVNDK
FT                   IRAIAIQAYQTLGCAGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYT
FT                   DLISRLIELALERHTANNALKTTM"
FT   regulatory      complement(434651..434656)
FT                   /gene="ddlA"
FT                   /locus_tag="STM0380"
FT                   /note="putative RBS for ddlA; RegulonDB:STMS1H000734"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            434712..435429
FT                   /locus_tag="STM0381"
FT   regulatory      434712..434717
FT                   /locus_tag="STM0381"
FT                   /note="putative RBS for STM0381; RegulonDB:STMS1H000735"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        434716..435429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0381"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19335"
FT                   /db_xref="GOA:Q8ZRF2"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF2"
FT                   /protein_id="AAL19335.1"
FT                   /translation="MFMGCENGGRVRGKGFLIIVLLGGIGGLGYRYLPSYYNPFAPLQL
FT                   ADPPGWITTFKLQRLTPSQCRELLTAANQQGLISSQPVADSAGECPLSHVVRVRDFGQV
FT                   KLSSSFLASCPLALRSALFVEQQAKPLTETWMKRRLTRIEHLGSYACRNIYHRPDARRS
FT                   EHASAEALDVSGFQLSDGRKITVLRGWGRQETGPWLRAMLNASCHYYGNGLGPDYNAAH
FT                   ANHFHLGMRGYGVCR"
FT   gene            435598..436809
FT                   /locus_tag="STM0382"
FT   CDS_pept        435598..436809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0382"
FT                   /product="putative permease"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC74137.1); Blastp hit to AAC74137.1 (408 aa), 60%
FT                   identity in aa 11 - 405"
FT                   /db_xref="EnsemblGenomes-Gn:STM0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19336"
FT                   /db_xref="GOA:Q8ZRF1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF1"
FT                   /protein_id="AAL19336.1"
FT                   /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEALS
FT                   MWSGLTFSITFLISAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATHVWQLFL
FT                   LRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLMGGFVADHIGL
FT                   RAVFLITAMLLVVSFLVTLFLIKEGVRPVIKKSERLSGKAVFASLPYPALVISLFFTTM
FT                   VIQLCNGSISPILALFIKSMMPDSNNIAFLSGLIASVPGISALISAPRLGKLGDRIGTE
FT                   RILMATLICAVLLFFAMSWVTTPFQLGLLRFLLGFADGAMLPAVQTLLVKYSSDQITGR
FT                   IFGYNQSFMYLGNVVGPLMGATVSAMAGFRWVFIATAAIVLINIGQLTLALRRRRNAQK
FT                   AKGQ"
FT   gene            437092..437366
FT                   /gene="yaiB"
FT                   /locus_tag="STM0383"
FT   regulatory      437092..437097
FT                   /gene="yaiB"
FT                   /locus_tag="STM0383"
FT                   /note="putative RBS for yaiB; RegulonDB:STMS1H000736"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        437100..437366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="STM0383"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73485.1); Blastp hit to AAC73485.1 (86 aa), 85%
FT                   identity in aa 1 - 85"
FT                   /db_xref="EnsemblGenomes-Gn:STM0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19337"
FT                   /db_xref="GOA:Q7CR46"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR46"
FT                   /protein_id="AAL19337.1"
FT                   /translation="MVMKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQN
FT                   EQEMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH"
FT   gene            437706..438038
FT                   /gene="psiF"
FT                   /locus_tag="STM0384"
FT   regulatory      437706..437711
FT                   /gene="psiF"
FT                   /locus_tag="STM0384"
FT                   /note="putative RBS for psiF; RegulonDB:STMS1H000737"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        437718..438038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="STM0384"
FT                   /product="induced by phosphate starvation"
FT                   /note="similar to E. coli induced by phosphate starvation
FT                   (AAC73487.1); Blastp hit to AAC73487.1 (112 aa), 90%
FT                   identity in aa 7 - 112"
FT                   /db_xref="EnsemblGenomes-Gn:STM0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19338"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR45"
FT                   /protein_id="AAL19338.1"
FT                   /translation="MKITLLVTLLFGLVFLTAVGATEKPLTPQQQRMTTCNQQATAQAL
FT                   KGDARKTYLSDCLKNSQSAPGEKSLTPQQQKMRECNVQATEQSLKGDDRSKFMSACLKK
FT                   AA"
FT   gene            438111..439242
FT                   /gene="yaiC"
FT                   /locus_tag="STM0385"
FT   regulatory      438111..438116
FT                   /gene="yaiC"
FT                   /locus_tag="STM0385"
FT                   /note="putative RBS for yaiC; RegulonDB:STMS1H000738"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        438130..439242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiC"
FT                   /locus_tag="STM0385"
FT                   /product="putative diguanylate cyclase/phosphodiesterase
FT                   domain 1"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73488.1); Blastp hit to AAC73488.1 (371 aa), 75%
FT                   identity in aa 1 - 371"
FT                   /db_xref="EnsemblGenomes-Gn:STM0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19339"
FT                   /db_xref="GOA:H9L4B6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:H9L4B6"
FT                   /protein_id="AAL19339.1"
FT                   /translation="MFPKIMNDENFYRKAVEQAVAPPDPPDDRQRSGLRFARRIRLPRA
FT                   VGLGGMFLPVAAVLVTQPVFGGWWLLLVGWSFVWPHLAWQWAAKALDPLRQEIYNLKVD
FT                   AILSGMWIALMGVNMLPAAALFMMMSMNLMGAGGRRLFTVGMGLLLASCLVTLQLAGLP
FT                   VAMRSSSLEVTLSLPVIMLYPLLFAWVSYQTAIKLAEHKRRLQAMSSRDGMTGVYNRRH
FT                   WEILLRNEFDHSRRHHREATLLIIDIDHFKSINDTWGHDVGDEAIIALTRQLQITLRGS
FT                   DIIGRFGGDEFAVIMCGTPADSAITAMSRVHERLNTLRLPGAPQVMLRISVGVAPLTPQ
FT                   IGHYREWLKSADMALYKAKNAGRNRTEVAA"
FT   gene            complement(439257..440080)
FT                   /gene="proC"
FT                   /locus_tag="STM0386"
FT   CDS_pept        complement(439257..440066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="STM0386"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="similar to E. coli pyrroline-5-carboxylate reductase
FT                   (AAC73489.1); Blastp hit to AAC73489.1 (269 aa), 95%
FT                   identity in aa 1 - 269"
FT                   /db_xref="EnsemblGenomes-Gn:STM0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19340"
FT                   /db_xref="GOA:Q8ZRF0"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF0"
FT                   /protein_id="AAL19340.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDQYGINAAQSAQEVAQVADIVFGAVKPGIMVKVLSEISSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPSLVNAGMTSVTPNALVTPEDTADVLNIFRCFGGAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHP
FT                   GELKDMVCSPGGTTIEAVRVLEERGFRAAVIEAMTKCMEKSEALSKS"
FT   regulatory      complement(440075..440080)
FT                   /gene="proC"
FT                   /locus_tag="STM0386"
FT                   /note="putative RBS for proC; RegulonDB:STMS1H000739"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            440194..440661
FT                   /gene="yaiI"
FT                   /locus_tag="STM0387"
FT   regulatory      440194..440199
FT                   /gene="yaiI"
FT                   /locus_tag="STM0387"
FT                   /note="putative RBS for yaiI; RegulonDB:STMS1H000740"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        440206..440661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="STM0387"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73490.1); Blastp hit to AAC73490.1 (192 aa), 89%
FT                   identity in aa 41 - 191"
FT                   /db_xref="EnsemblGenomes-Gn:STM0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19341"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67334"
FT                   /protein_id="AAL19341.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQLPLILVANQALRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEVLEKGAAALNPRGERYSDATIRE
FT                   RLTMRDFMDTLRASGVQTGGPNTLSPRDRQHFAAELDKWWLESQRKK"
FT   protein_bind    440591..440622
FT                   /gene="yaiI"
FT                   /locus_tag="STM0387"
FT                   /bound_moiety="TyrR"
FT                   /note="putative binding site for TyrR, RegulonDB:
FT                   STMS1H000380"
FT   protein_bind    440665..440687
FT                   /bound_moiety="TyrR"
FT                   /note="putative binding site for TyrR, RegulonDB:
FT                   STMS1H000382"
FT   gene            440687..441391
FT                   /gene="aroL"
FT                   /locus_tag="STM0388"
FT   regulatory      440687..440695
FT                   /gene="aroL"
FT                   /locus_tag="STM0388"
FT                   /note="putative -35_signal for aroL;
FT                   RegulonDB:STMLTH004624"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      440714..440722
FT                   /gene="aroL"
FT                   /locus_tag="STM0388"
FT                   /note="putative -10_signal for aroL;
FT                   RegulonDB:STMLTH004624"
FT                   /regulatory_class="minus_10_signal"
FT   protein_bind    440739..440761
FT                   /gene="aroL"
FT                   /locus_tag="STM0388"
FT                   /bound_moiety="TyrR"
FT                   /note="putative binding site for TyrR, RegulonDB:
FT                   STMS1H000381"
FT   protein_bind    440765..440793
FT                   /gene="aroL"
FT                   /locus_tag="STM0388"
FT                   /bound_moiety="TrpR"
FT                   /note="putative binding site for TrpR, RegulonDB:
FT                   STMS1H000377"
FT   regulatory      440829..440834
FT                   /gene="aroL"
FT                   /locus_tag="STM0388"
FT                   /note="putative RBS for aroL; RegulonDB:STMS1H000741"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        440846..441391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="STM0388"
FT                   /product="shikimate kinase II"
FT                   /EC_number="2.7.1.71"
FT                   /note="similar to E. coli shikimate kinase II (AAC73491.1);
FT                   Blastp hit to AAC73491.1 (174 aa), 74% identity in aa 1 -
FT                   168"
FT                   /db_xref="EnsemblGenomes-Gn:STM0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19342"
FT                   /db_xref="GOA:P63603"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63603"
FT                   /protein_id="AAL19342.1"
FT                   /translation="MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMSV
FT                   ADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCAPV
FT                   STLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKAPAQVVSE
FT                   IIAALPPSTQRLQGDVYT"
FT   gene            441407..441609
FT                   /gene="yaiA"
FT                   /locus_tag="STM0389"
FT   regulatory      441407..441412
FT                   /gene="yaiA"
FT                   /locus_tag="STM0389"
FT                   /note="putative RBS for yaiA; RegulonDB:STMS1H000742"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        441418..441609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="STM0389"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73492.1); Blastp hit to AAC73492.1 (63 aa), 93%
FT                   identity in aa 1 - 62"
FT                   /db_xref="EnsemblGenomes-Gn:STM0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19343"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE9"
FT                   /protein_id="AAL19343.1"
FT                   /translation="MPTRPPYPREAYIVTIEKGTPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAEEAMDAKNRYEDPDKS"
FT   gene            441846..442537
FT                   /gene="aroM"
FT                   /locus_tag="STM0390"
FT   regulatory      441846..441851
FT                   /gene="aroM"
FT                   /locus_tag="STM0390"
FT                   /note="putative RBS for aroM; RegulonDB:STMS1H000743"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        441860..442537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="STM0390"
FT                   /product="protein of aro operon, regulated by aroR"
FT                   /note="similar to E. coli protein of aro operon, regulated
FT                   by aroR (AAC73493.1); Blastp hit to AAC73493.1 (225 aa),
FT                   77% identity in aa 1 - 225"
FT                   /db_xref="EnsemblGenomes-Gn:STM0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19344"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE8"
FT                   /protein_id="AAL19344.1"
FT                   /translation="MSASLAILTIGVVPMSEVLPLLTEYIDEQHITHHSLLGKMSREDV
FT                   MADYAVEPGDDPLLTLLNDNQIAHVSRQKVERDLQSVVEVLDNQGYDVIILMSTAAIKS
FT                   MAARNSILLEPLRIIPPLVASIVDGHQVGVIVPVAELLAAQEKKWQVLQMPPVYSLANP
FT                   VHGSEQQLIDAGQALLDQGADVIMLDCLGFHQRHRDILQQALDVPVLLSNVLIARLASE
FT                   LLV"
FT   gene            442595..442892
FT                   /gene="yaiE"
FT                   /locus_tag="STM0391"
FT   regulatory      442595..442600
FT                   /gene="yaiE"
FT                   /locus_tag="STM0391"
FT                   /note="putative RBS for yaiE; RegulonDB:STMS1H000744"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        442608..442892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="STM0391"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73494.1); Blastp hit to AAC73494.1 (94 aa), 86%
FT                   identity in aa 1 - 94"
FT                   /db_xref="EnsemblGenomes-Gn:STM0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19345"
FT                   /db_xref="GOA:Q8ZRE7"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRE7"
FT                   /protein_id="AAL19345.1"
FT                   /translation="MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEEM
FT                   TVVSGALKVLLPGTVEWKVYTAGEVFNVPGHSEFHLQVAEPASYLCRYL"
FT   gene            complement(442930..443853)
FT                   /gene="rdgC"
FT                   /locus_tag="STM0392"
FT   CDS_pept        complement(442930..443841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="STM0392"
FT                   /product="putative exonuclease involved in removal of
FT                   stalled replication fork"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73496.1); Blastp hit to AAC73496.1 (303 aa), 93%
FT                   identity in aa 1 - 303"
FT                   /db_xref="EnsemblGenomes-Gn:STM0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19346"
FT                   /db_xref="GOA:P65973"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65973"
FT                   /protein_id="AAL19346.1"
FT                   /translation="MLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLALENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQSLVEGLGGEAQR"
FT   regulatory      complement(443848..443853)
FT                   /gene="rdgC"
FT                   /locus_tag="STM0392"
FT                   /note="putative RBS for rdgC; RegulonDB:STMS1H000745"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            443955..444875
FT                   /gene="yajF"
FT                   /locus_tag="STM0393"
FT   regulatory      443955..443960
FT                   /gene="yajF"
FT                   /locus_tag="STM0393"
FT                   /note="putative RBS for yajF; RegulonDB:STMS1H000746"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        443967..444875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajF"
FT                   /locus_tag="STM0393"
FT                   /product="putative sugar kinase/putative transcriptional
FT                   regulator (NagC/XylR family)"
FT                   /note="similar to E. coli possible NAGC-like
FT                   transcriptional regulator (AAC73497.1); Blastp hit to
FT                   AAC73497.1 (348 aa), 88% identity in aa 47 - 346"
FT                   /db_xref="EnsemblGenomes-Gn:STM0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19347"
FT                   /db_xref="GOA:Q8ZRE5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE5"
FT                   /protein_id="AAL19347.1"
FT                   /translation="MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIAT
FT                   LVDMAEQATGQTGSVGIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRAHIGGNGTAGEWGHNPLPWM
FT                   DDDELRYREEIPCYCGKQGCIETFISGTGFATDYQRLSGNALKGDEIIRLVDAQDAVAE
FT                   LALSRYELRLAKALSHVVNILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGECETPV
FT                   RKARHGDSSGVRGAAWLWPLA"
FT   gene            complement(444897..446125)
FT                   /gene="araJ"
FT                   /locus_tag="STM0394"
FT   CDS_pept        complement(444897..446069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="STM0394"
FT                   /product="MFS family, arabinose polymer transporter"
FT                   /note="similar to E. coli involved in either transport or
FT                   processing of arabinose polymers (AAC73499.1); Blastp hit
FT                   to AAC73499.1 (394 aa), 85% identity in aa 1 - 388"
FT                   /db_xref="EnsemblGenomes-Gn:STM0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19348"
FT                   /db_xref="GOA:Q8ZRE4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE4"
FT                   /protein_id="AAL19348.1"
FT                   /translation="MKKVIFSLALGTFGLGMAEFGIMGVLTELARDVGITIPAAGHMIS
FT                   FYAFGVVLGAPVMALFSSRFSLKHILLFLVMLCVMGNAIFTFSSSYLMLAVGRLVSGFP
FT                   HGAFFGVGAIVLSKIIRPGKVTAAVAGMVSGMTVANLVGIPFGTYLSQEFSWRYTFLLI
FT                   AVFNIAVLTAIFFWVPDIRDKAQGSLREQFHFLRSPSPWLIFAATMFGNAGVFAWFSYI
FT                   KPFMMYISGFSETSMTFIMMLVGLGMVLGNLLSGKLSGRYTPLRIAVVTDLVIVLSLMA
FT                   LFFFSGYKTTSLTFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAIG
FT                   AWCGGLMLTLGFAYHYVALPAALLSFSAMSSLLVYGRLKHKQPSVTPVAG"
FT   protein_bind    complement(446055..446075)
FT                   /gene="araJ"
FT                   /locus_tag="STM0394"
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000039"
FT   regulatory      complement(446072..446077)
FT                   /gene="araJ"
FT                   /locus_tag="STM0394"
FT                   /note="putative RBS for araJ; RegulonDB:STMS1H000747"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(446101..446109)
FT                   /gene="araJ"
FT                   /locus_tag="STM0394"
FT                   /note="putative -10_signal for araJ;
FT                   RegulonDB:STMLTH004632"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(446117..446125)
FT                   /gene="araJ"
FT                   /locus_tag="STM0394"
FT                   /note="putative -35_signal for araJ;
FT                   RegulonDB:STMLTH004632"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    complement(446204..446215)
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000066"
FT   protein_bind    complement(446222..446233)
FT                   /bound_moiety="AraC"
FT                   /note="putative binding site for AraC, RegulonDB:
FT                   STMS1H000005"
FT   gene            complement(446242..449396)
FT                   /gene="sbcC"
FT                   /locus_tag="STM0395"
FT   CDS_pept        complement(446242..449382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="STM0395"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /note="similar to E. coli ATP-dependent dsDNA exonuclease
FT                   (AAC73500.1); Blastp hit to AAC73500.1 (1048 aa), 70%
FT                   identity in aa 1 - 1048"
FT                   /db_xref="EnsemblGenomes-Gn:STM0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19349"
FT                   /db_xref="GOA:Q8ZRE3"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE3"
FT                   /protein_id="AAL19349.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLNTVSQSQNDLMTRDTAECLAEVEFEVKGEAWRAFWSQNRARNQ
FT                   PDGNLQAPRVELARCSDGKIFADKVKDKLEMIATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKAKERAELLEELTGTEIYGQISAQVFEKHKSARLELEKLQAQASGVALLADEQLQQLE
FT                   ASLQALTDEEKRLLADQQGQQQHLHWLTRKNELHTELHARQQALYAAQEAREKAQPQLA
FT                   ALTLAQPARQLRPHWERIQEQTRAVERVRQHSDEVNARLQSAYRLRQRIRACAHRQFTQ
FT                   LNATGQRLKTWLAEHDGIRVWRSELAGWRALLTQQSHDRAQLSQWQQQLLSDTRQRDAL
FT                   PPLTLDLTPQALAEARALHTRQRPLRHRLAALQGQILPKQKRQAQLQAAIARHHQEQAQ
FT                   YTQRLADKRLSYKTKAQELADVRTICEQEARIKDLESQRAHLQSGQPCPLCGSTTHPAI
FT                   AAYQALELSANQTRRDALEKEVKTLAEEGAALRGQLDALTQQLQRDESEAQSLLQEEQA
FT                   LTEEWQTLCATLGVQLQPQEDLAGWLTAAEEHEQQLDQLSQRHALQTQIAAHTEQVARF
FT                   TAQIAQRQASLTADLAQYTLSLPAPEDEASWLNERADEAKIWQQRQTEFADLQMQIDRL
FT                   APLLETLPQTDTADSDDDVPLDNWRQAHDECVSLQSQLQTLQEQTTQEQQRAAEAIAHF
FT                   DAALKNSPFDSQATFLAALLDEETVTRLEKQQQTLESQLQQAKALSAQSAQALADHQQQ
FT                   PPAGLDPTCTAEQLAQRLTQLAQQLRENTTRQGEIRQQIKQDADNRQRQRALMTEMKQA
FT                   SQQVEDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLTRLHGRYLLQRKASDAL
FT                   ELEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLDS
FT                   ETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLDKAFAVE"
FT   gene            complement(449379..450592)
FT                   /gene="sbcD"
FT                   /locus_tag="STM0396"
FT   CDS_pept        complement(449379..450581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="STM0396"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /note="similar to E. coli ATP-dependent dsDNA exonuclease
FT                   (AAC73501.1); Blastp hit to AAC73501.1 (400 aa), 84%
FT                   identity in aa 1 - 400"
FT                   /db_xref="EnsemblGenomes-Gn:STM0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19350"
FT                   /db_xref="GOA:Q8ZRE2"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE2"
FT                   /protein_id="AAL19350.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSRAAEHQAFLDWLLETAQAHQVDAIIV
FT                   AGDIFDTGSPPSYARELYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDILAFLNTTV
FT                   IASAGYAPRLLHRRDGSPGAVLCPIPFLRPRDIITSQAGLSGSEKQQQLLHAIADYYQQ
FT                   QYQEACQLRGERKLPVIATGHLTTVGASKSDAVRDIYIGTLDAFPAQHFPPADYIALGH
FT                   IHRAQCVGGTEHIRYCGSPIALSFDECGKSKCVHLVTFEQGKWQSTESLAVPVTQPLAV
FT                   LKGDLASITEQLEQWRGVEQSPPVWLDIEITTDDYLHDIQRRIQTLTESLPVEVLLVRR
FT                   SREQRERSLANERRETLSELSVEEVFARRLALEALDPPQRERLNQLFSSTLYALNEEHE
FT                   A"
FT   regulatory      complement(449391..449396)
FT                   /gene="sbcD"
FT                   /locus_tag="STM0396"
FT                   /note="putative RBS for sbcC; RegulonDB:STMS1H000748"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(450587..450592)
FT                   /gene="sbcD"
FT                   /locus_tag="STM0396"
FT                   /note="putative RBS for sbcD; RegulonDB:STMS1H000749"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            450723..451485
FT                   /gene="phoB"
FT                   /locus_tag="STM0397"
FT   regulatory      450723..450731
FT                   /gene="phoB"
FT                   /locus_tag="STM0397"
FT                   /note="putative -35_signal for phoB;
FT                   RegulonDB:STMLTH004636"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    450725..450743
FT                   /gene="phoB"
FT                   /locus_tag="STM0397"
FT                   /bound_moiety="PhoB"
FT                   /note="putative binding site for PhoB, RegulonDB:
FT                   STMS1H000342"
FT   regulatory      450750..450758
FT                   /gene="phoB"
FT                   /locus_tag="STM0397"
FT                   /note="putative -10_signal for phoB;
FT                   RegulonDB:STMLTH004636"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      450785..450790
FT                   /gene="phoB"
FT                   /locus_tag="STM0397"
FT                   /note="putative RBS for phoB; RegulonDB:STMS1H000750"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        450796..451485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="STM0397"
FT                   /product="response regulator in two-component regulatory
FT                   system with PhoR (or CreC)"
FT                   /note="regulates pho regulon (OmpR family); similar to E.
FT                   coli positive response regulator for pho regulon, sensor is
FT                   PhoR (or CreC) (AAC73502.1); Blastp hit to AAC73502.1 (229
FT                   aa), 95% identity in aa 1 - 229"
FT                   /db_xref="EnsemblGenomes-Gn:STM0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19351"
FT                   /db_xref="GOA:Q7CR43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR43"
FT                   /protein_id="AAL19351.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEP
FT                   WPDLILLDWMLPGGSGLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPGSHRVMTGDSPLDMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEHSGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   gene            451540..452850
FT                   /gene="phoR"
FT                   /locus_tag="STM0398"
FT   regulatory      451540..451545
FT                   /gene="phoR"
FT                   /locus_tag="STM0398"
FT                   /note="putative RBS for phoR; RegulonDB:STMS1H000751"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        451555..452850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="STM0398"
FT                   /product="sensory kinase in two-component regulatory system
FT                   with PhoB, regulates pho regulon"
FT                   /EC_number="2.7.3.-"
FT                   /note="similar to E. coli positive and negative sensor
FT                   protein for pho regulon (AAC73503.1); Blastp hit to
FT                   AAC73503.1 (431 aa), 90% identity in aa 1 - 431"
FT                   /db_xref="EnsemblGenomes-Gn:STM0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19352"
FT                   /db_xref="GOA:Q8ZRE1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE1"
FT                   /protein_id="AAL19352.1"
FT                   /translation="MLERLSWKRLVLELVLCCIPALILSAFFGYLPWFLLAAVTGLLVW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPDDNGQNILNLLRYPEFTQYLKTRDFTR
FT                   PLHLVLNTGRHLEIRVMPYTDKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMQEQALEGATREKALHTMREQTYRMEGLVKQLLTLSKIEAAPALLLNEKVDVP
FT                   MMLRVVEREAQTLSQQKHTFTFEVDDSLSVLGNEEQLRSAISNLVYNAVNHTPAGTHIT
FT                   VSWRRVAHGAEFCIQDNGPGIAAEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHALN
FT                   HHESRLEIDSSPGKGTRFSFVLPERLIAKNSD"
FT   gene            453243..454578
FT                   /gene="brnQ"
FT                   /locus_tag="STM0399"
FT   regulatory      453243..453248
FT                   /gene="brnQ"
FT                   /locus_tag="STM0399"
FT                   /note="putative RBS for brnQ; RegulonDB:STMS1H000752"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        453259..454578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="STM0399"
FT                   /product="LIVCS family, branched chain amino acid
FT                   transporter system II (LIV-II)"
FT                   /note="branched-chain amino acid transport system II
FT                   carrier protein(liv-II). (SW:BRNQ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19353"
FT                   /db_xref="GOA:P0A1W8"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1W8"
FT                   /protein_id="AAL19353.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   IGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGLLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSAMPLLIYSVVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGPISNALDAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFGGAGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYIPLSYRTLVFILGGFSMVVSNLGLSHLIQIS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPAMFISLLFGILDGIKASAFGDMLPAW
FT                   SQRLPLAEQGLAWLMPTVVMVILAIIWDRAAGRQVTSSAH"
FT   gene            454644..456023
FT                   /gene="proY"
FT                   /locus_tag="STM0400"
FT   regulatory      454644..454649
FT                   /gene="proY"
FT                   /locus_tag="STM0400"
FT                   /note="putative RBS for proY; RegulonDB:STMS1H000753"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        454653..456023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="STM0400"
FT                   /product="putative APC family, proline transporter"
FT                   /note="proline-specific permease PROY. (SW:PROY_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19354"
FT                   /db_xref="GOA:P37460"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37460"
FT                   /protein_id="AAL19354.1"
FT                   /translation="MESNNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGVAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVWFPAVPHWIWVLSVVLIICAINLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGIGIIVWGIGNGGQPTGIHNLWSNGGFFSNGWLGMIMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKVFAKTSRRGIPWVTVLVMTI
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVP
FT                   GGVVTTIAGLIFLVFIIALIGYHPDTRISLYVGFAWIVLLLIGWIFKRRRDRQLAQA"
FT   gene            456172..458002
FT                   /gene="malZ"
FT                   /locus_tag="STM0401"
FT   regulatory      456172..456177
FT                   /gene="malZ"
FT                   /locus_tag="STM0401"
FT                   /note="putative RBS for malZ; RegulonDB:STMS1H000754"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        456185..458002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="STM0401"
FT                   /product="maltodextrin glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="similar to E. coli maltodextrin glucosidase
FT                   (AAC73506.1); Blastp hit to AAC73506.1 (605 aa), 83%
FT                   identity in aa 2 - 605"
FT                   /db_xref="EnsemblGenomes-Gn:STM0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19355"
FT                   /db_xref="GOA:Q8ZRE0"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE0"
FT                   /protein_id="AAL19355.1"
FT                   /translation="MLNAWHLPVAPFVKQHNDKLTITLWLSGENPPSRVTLRSEFDNEE
FT                   ISLAMRKQRRQPQPGVTAWRATLNIALGQPRRRYSFKLLWHDRQLWFTPQGFSRFPPAR
FT                   LEQFAVDVPDSGPQWVADQIFYQIFPDRFARSQSREAGQDRVYYHHAAGQEIVLRDWDD
FT                   PLTPQAGGSTFYGGCLNGICEKLPYLKKLGVTALYLNPVFTAPSVHKYDTEDYRHVDPQ
FT                   FGGDRALLRLRRKTQVQGMRLVLDGVFNHSGDSHVWFDRHNRSTGGACHHPDSPWRDWY
FT                   SFSPQGVALDWLGYPSLPKLDYQSETLVDEIYRGEDSIVRHWLKAPWNMDGWRLDVVHM
FT                   LGEAGGARHNLQHVAGITRAAKEAQPEAYIVGEHFGDARQWLQADAEDAAMNYRGFTFP
FT                   LWGFLANTDIAYEPQHIDARTCIAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGK
FT                   DAARLPLAVVWLFTWPGVPCIYYGDEVGVDGANDPMCRKPFPWDERKQDGNLLALYQRM
FT                   AKLRQSSLALRRGGCQALYAEGDVVVFVRVYQQQRALVAINRGEACEVALEALPLLNVA
FT                   GWQCKTGSGDIREGRLSLPAISATVWMNR"
FT   gene            complement(458074..458684)
FT                   /locus_tag="STM0402"
FT   CDS_pept        complement(458074..458676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0402"
FT                   /product="putative thiol-alkyl hydroperoxide reductase"
FT                   /EC_number="3.2.1.20"
FT                   /note="similar to E. coli alkyl hydroperoxide reductase,
FT                   C22 subunit; detoxification of hydroperoxides (AAC73706.1);
FT                   Blastp hit to AAC73706.1 (187 aa), 36% identity in aa 1 -
FT                   186"
FT                   /db_xref="EnsemblGenomes-Gn:STM0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19356"
FT                   /db_xref="GOA:Q7CR42"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR42"
FT                   /protein_id="AAL19356.1"
FT                   /translation="MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMD
FT                   FTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAMVA
FT                   DVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDALQF
FT                   HEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL"
FT   regulatory      complement(458679..458684)
FT                   /locus_tag="STM0402"
FT                   /note="putative RBS for STM0402; RegulonDB:STMS1H000755"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(458886..459478)
FT                   /gene="yajB"
FT                   /locus_tag="STM0403"
FT   CDS_pept        complement(458886..459467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajB"
FT                   /locus_tag="STM0403"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli putative glycoprotein
FT                   (AAC73507.1); Blastp hit to AAC73507.1 (193 aa), 87%
FT                   identity in aa 1 - 193"
FT                   /db_xref="EnsemblGenomes-Gn:STM0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19357"
FT                   /db_xref="GOA:Q7CR41"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR41"
FT                   /protein_id="AAL19357.1"
FT                   /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPATHYPPDVVEGIYMH
FT                   RRIDVMTDNLPEVREAREWFRHETRRVAPITLDVMWDHFLSRHWTQISPDFPLQAFVGY
FT                   AHAQVATILPDSPPRFVNLNDYLWSEKWLERYRDMDFIQNVLNGMANRRPRLDALRDSW
FT                   YDLDAHYDALEERFWHFYPRMMAQAARKAL"
FT   regulatory      complement(459473..459478)
FT                   /gene="yajB"
FT                   /locus_tag="STM0403"
FT                   /note="putative RBS for yajB; RegulonDB:STMS1H000756"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            459561..460625
FT                   /gene="queA"
FT                   /locus_tag="STM0404"
FT   CDS_pept        459561..460625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="STM0404"
FT                   /product="S-adenosylmethionine-tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="similar to E. coli synthesis of queuine in tRNA;
FT                   probably S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase (AAC73508.1); Blastp hit to
FT                   AAC73508.1 (356 aa), 94% identity in aa 1 - 353"
FT                   /db_xref="EnsemblGenomes-Gn:STM0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19358"
FT                   /db_xref="GOA:Q8ZRD9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRD9"
FT                   /protein_id="AAL19358.1"
FT                   /translation="MRVTDFSFELPESLIAHYPQPERSRCRLLSLEGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   TELLLGDDESIHATMTARHGALFEVEFNDPRPVLDILNAIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSDLIEPFFGDTQ
FT                   IFIYPGYQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYGDA
FT                   MFITYNPQAISERP"
FT   gene            460811..461949
FT                   /gene="tgt"
FT                   /locus_tag="STM0405"
FT   regulatory      460811..460816
FT                   /gene="tgt"
FT                   /locus_tag="STM0405"
FT                   /note="putative RBS for tgt; RegulonDB:STMS1H000757"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        460822..461949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="STM0405"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="similar to E. coli tRNA-guanine transglycosylase
FT                   (AAC73509.1); Blastp hit to AAC73509.1 (375 aa), 97%
FT                   identity in aa 1 - 375"
FT                   /db_xref="EnsemblGenomes-Gn:STM0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19359"
FT                   /db_xref="GOA:Q8ZRD8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRD8"
FT                   /protein_id="AAL19359.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRDRFDSLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKHKSDTSPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTEFYQRQGRPVPPLNVD"
FT   gene            461960..462304
FT                   /gene="yajC"
FT                   /locus_tag="STM0406"
FT   regulatory      461960..461965
FT                   /gene="yajC"
FT                   /locus_tag="STM0406"
FT                   /note="putative RBS for yajC; RegulonDB:STMS1H000758"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        461972..462304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="STM0406"
FT                   /product="preprotein translocase IISP family, membrane
FT                   subunit"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73510.1); Blastp hit to AAC73510.1 (110 aa), 99%
FT                   identity in aa 1 - 110"
FT                   /db_xref="EnsemblGenomes-Gn:STM0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19360"
FT                   /db_xref="GOA:Q7CR40"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR40"
FT                   /protein_id="AAL19360.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            462320..464179
FT                   /gene="secD"
FT                   /locus_tag="STM0407"
FT   regulatory      462320..462325
FT                   /gene="secD"
FT                   /locus_tag="STM0407"
FT                   /note="putative RBS for secD; RegulonDB:STMS1H000759"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        462332..464179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="STM0407"
FT                   /product="preprotein translocase, IISP family, part of the
FT                   channel"
FT                   /note="similar to E. coli protein secretion; membrane
FT                   protein, part of the channel (AAC73511.1); Blastp hit to
FT                   AAC73511.1 (615 aa), 94% identity in aa 1 - 615"
FT                   /db_xref="EnsemblGenomes-Gn:STM0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19361"
FT                   /db_xref="GOA:Q8ZRD7"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRD7"
FT                   /protein_id="AAL19361.1"
FT                   /translation="MLNRYPLWKYIMLVVVIIVGLLYALPNLYGEDPAVQITGVRGVAA
FT                   SEQTLIQVQKTLQEEKIPAKSVALEEGAILARFDTTDTQLRAREALMSVLGDKYVVALN
FT                   LAPATPRWLAAIHADPMKLGLDLRGGVHFLMEVDIDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDSKARDEAIAYLTPRHRDLVISSQSGNQLRAVMTDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAAAGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGISNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIKQGLEACL
FT                   AGLVVSILFMIFFYKKFGLIATSALVANLVLIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAINEGYAGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIIGTRAIVNLLYGGKRVTKLSI"
FT   gene            464178..465161
FT                   /gene="secF"
FT                   /locus_tag="STM0408"
FT   regulatory      464178..464183
FT                   /gene="secF"
FT                   /locus_tag="STM0408"
FT                   /note="putative RBS for secF; RegulonDB:STMS1H000760"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        464190..465161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="STM0408"
FT                   /product="preprotein translocase, IISP family, membrane
FT                   subunit"
FT                   /note="similar to E. coli protein secretion, membrane
FT                   protein (AAC73512.1); Blastp hit to AAC73512.1 (323 aa),
FT                   95% identity in aa 1 - 323"
FT                   /db_xref="EnsemblGenomes-Gn:STM0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19362"
FT                   /db_xref="GOA:Q7CR39"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR39"
FT                   /protein_id="AAL19362.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDFWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEMDVMREALQKAGYEEPQLQNFGSSHDIMVRMPPTEGE
FT                   TGGQVLGSKVVTIINEATNQNAAVKRIEFVGPSVGADLAQTGAMALLVALISILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLVVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   gene            465301..465674
FT                   /locus_tag="STM0409"
FT   regulatory      465301..465306
FT                   /locus_tag="STM0409"
FT                   /note="putative RBS for STM0409; RegulonDB:STMS1H000761"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        465309..465674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19363"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR38"
FT                   /protein_id="AAL19363.1"
FT                   /translation="MKNLINWFEIPVTDMARAIAFYEQVMQISLRRETMDGADLAVFPY
FT                   AEPGPGGALIKQDDVAPVAQGVVIYLHTADLLASIERVVLAGGKCVLEPMVPGDDIGTI
FT                   ALFIDSEGNRIGLHQPA"
FT   gene            465700..466392
FT                   /locus_tag="STM0410"
FT   CDS_pept        465700..466392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0410"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19364"
FT                   /db_xref="GOA:Q7CR37"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR37"
FT                   /protein_id="AAL19364.1"
FT                   /translation="MTRRADRLFQIVQILRGRRLTTAALLAQRLAVSERTIYRDIRDLS
FT                   LSGVPVEGEAGSGYRLMAGFDLPPLMLTHRESEALMVAIRLLKTWGGDSLSRELESAQE
FT                   KVLAILPEESRRKAEQTRIYAPDLGTSPHSRSAFDLIHQAVSAQQVLALHYRDEAGHLS
FT                   SRDIQPLGLFFWGEHWLLVAWCERREDYRCFRLDRCLQITPLNRRFRETIDRSLRDFLR
FT                   KVEHEKMP"
FT   gene            466546..466909
FT                   /gene="yajD"
FT                   /locus_tag="STM0411"
FT   regulatory      466546..466551
FT                   /gene="yajD"
FT                   /locus_tag="STM0411"
FT                   /note="putative RBS for yajD; RegulonDB:STMS1H000762"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        466562..466909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="STM0411"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical 12.6 Kda protein in secF-tsx intergenic
FT                   region. (SW:YAJD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19365"
FT                   /db_xref="GOA:P0A1S8"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1S8"
FT                   /protein_id="AAL19365.1"
FT                   /translation="MAIIPKNYARLESGYREKALKLFPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGSTVIAGEDAQKDVGEATYNPF
FT                   ADLKAMMNKKK"
FT   gene            complement(467157..467483)
FT                   /locus_tag="STM0412"
FT   CDS_pept        complement(467157..467483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0412"
FT                   /product="putative inner membrane protein"
FT                   /note="hypothetical protein 14.5K (gi|1073681)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19366"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR36"
FT                   /protein_id="AAL19366.1"
FT                   /translation="MRRRVAPTSHYFRRCHQPKNRPVAIPTSVGAARSCQIVMLNSVSV
FT                   ILPPLLQWQRFAAILNLSGVKLAPVMLPVNTEQCAGVFSFQRQGHRGSSPRNIAPHRVA
FT                   PAYR"
FT   gene            complement(467538..468539)
FT                   /gene="tsx"
FT                   /locus_tag="STM0413"
FT   CDS_pept        complement(467538..468401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="STM0413"
FT                   /product="nucleoside channel; receptor of phage T6 and
FT                   colicin K"
FT                   /note="nucleoside-specific channel-forming protein TSX
FT                   precursor. (SW:TSX_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19367"
FT                   /db_xref="GOA:P0A261"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A261"
FT                   /protein_id="AAL19367.1"
FT                   /translation="MKKTLLAVSAALALTSSFTANAAENDQPQYLSDWWHQSVNVVGSY
FT                   HTRFSPKLNNDVYLEYEAFAKKDWFDFYGYIDIPKTFDWGNGNDKGIWSDGSPLFMEIE
FT                   PRFSIDKLTGADLSFGPFKEWYFANNYIYDMGDNKASRQSTWYMGLGTDIDTGLPMGLS
FT                   LNVYAKYQWQNYGASNENEWDGYRFKVKYFVPITDLWGGKLSYIGFTNFDWGSDLGDDP
FT                   NRTSNSIASSHILALNYDHWHYSVVARYFHNGGQWQNGAKLNWGDGDFSAKSTGWGGYL
FT                   VVGYNF"
FT   regulatory      complement(468407..468412)
FT                   /gene="tsx"
FT                   /locus_tag="STM0413"
FT                   /note="putative RBS for tsx; RegulonDB:STMS1H000763"
FT                   /regulatory_class="ribosome_binding_site"
FT   protein_bind    complement(468487..468507)
FT                   /gene="tsx"
FT                   /locus_tag="STM0413"
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000100"
FT   protein_bind    complement(468501..468543)
FT                   /bound_moiety="CytR"
FT                   /note="putative binding site for CytR, RegulonDB:
FT                   STMS1H000129"
FT   regulatory      complement(468515..468523)
FT                   /gene="tsx"
FT                   /locus_tag="STM0413"
FT                   /note="putative -10_signal for tsx; RegulonDB:STMLTH004651"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(468531..468539)
FT                   /gene="tsx"
FT                   /locus_tag="STM0413"
FT                   /note="putative -35_signal for tsx; RegulonDB:STMLTH004651"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    complement(468541..468561)
FT                   /bound_moiety="CRP"
FT                   /note="putative binding site for CRP, RegulonDB:
FT                   STMS1H000103"
FT   protein_bind    complement(468553..468571)
FT                   /bound_moiety="DeoR"
FT                   /note="putative binding site for DeoR, RegulonDB:
FT                   STMS1H000131"
FT   protein_bind    complement(468659..468701)
FT                   /bound_moiety="CytR"
FT                   /note="putative binding site for CytR, RegulonDB:
FT                   STMS1H000128"
FT   gene            complement(468701..469255)
FT                   /gene="yajI"
FT                   /locus_tag="STM0414"
FT   CDS_pept        complement(468701..469240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="STM0414"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73515.1); Blastp hit to AAC73515.1 (199 aa), 73%
FT                   identity in aa 21 - 199"
FT                   /db_xref="EnsemblGenomes-Gn:STM0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19368"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRD6"
FT                   /protein_id="AAL19368.1"
FT                   /translation="MTRRYLRILLVGSLLSLTACAPQSEVRQMHQSISTLNKEMTQLNQ
FT                   ETVKITQQNKLNAESTRGVYLLPGANTPARLESQIGTLRMTLLEITPVADGAHATLHIQ
FT                   GESRDPLPAFSATVEYGQLQGTTENYQEVNAQSLLVNAPASLLAPSDVNISLPLKGITP
FT                   AQLGFIRIHDIQPVNQ"
FT   regulatory      complement(469250..469255)
FT                   /gene="yajI"
FT                   /locus_tag="STM0414"
FT                   /note="putative RBS for yajI; RegulonDB:STMS1H000764"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            469381..469841
FT                   /gene="ybaD"
FT                   /locus_tag="STM0415"
FT   regulatory      469381..469386
FT                   /gene="ybaD"
FT                   /locus_tag="STM0415"
FT                   /note="putative RBS for ybaD; RegulonDB:STMS1H000765"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        469392..469841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="STM0415"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73516.1); Blastp hit to AAC73516.1 (149 aa), 95%
FT                   identity in aa 1 - 149"
FT                   /db_xref="EnsemblGenomes-Gn:STM0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19369"
FT                   /db_xref="GOA:P0A2M1"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2M1"
FT                   /protein_id="AAL19369.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVIKSNDVREPFNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKDFGEEIARLQD"
FT   gene            469833..470948
FT                   /gene="ribD"
FT                   /locus_tag="STM0416"
FT   regulatory      469833..469838
FT                   /gene="ybaD"
FT                   /locus_tag="STM0415"
FT                   /note="putative RBS for ribD; RegulonDB:STMS1H000766"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        469845..470948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="STM0416"
FT                   /product="pyrimidine deaminase"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /note="bifunctional; similar to E. coli bifunctional
FT                   pyrimidine deaminase/reductase in pathway of riboflavin
FT                   synthesis (AAC73517.1); Blastp hit to AAC73517.1 (367 aa),
FT                   89% identity in aa 1 - 367"
FT                   /db_xref="EnsemblGenomes-Gn:STM0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19370"
FT                   /db_xref="GOA:Q8ZRD4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRD4"
FT                   /protein_id="AAL19370.1"
FT                   /translation="MQDEFYMARALKLAQRGRFTTHPNPNVGCVIVNNGDIVGEGYHHR
FT                   AGEPHAEVHALRMAGAKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIAVSHGLMMSEAEALNKGFLKRMRTGFPYLQLKLGASVDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWAELDASTQASYPQE
FT                   NLRQPVRIVIDSQNRVTPAHRIVQQPGETWIARTQEDSRAWPDAVRTISVPAHNGHLDL
FT                   VVLMMQLGRQQINSIWVEAGPGLAGALLQAGLVDELIVYVAPKLLGTQARGLCELPGLE
FT                   KLADAPQFTFSEIRHVGPDVCLHMVSA"
FT   gene            471023..471507
FT                   /gene="ribH"
FT                   /locus_tag="STM0417"
FT   regulatory      471023..471028
FT                   /gene="ribH"
FT                   /locus_tag="STM0417"
FT                   /note="putative RBS for ribH; RegulonDB:STMS1H000767"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        471037..471507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="STM0417"
FT                   /product="riboflavin synthase, beta chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="similar to E. coli riboflavin synthase, beta chain
FT                   (AAC73518.1); Blastp hit to AAC73518.1 (156 aa), 91%
FT                   identity in aa 1 - 156"
FT                   /db_xref="EnsemblGenomes-Gn:STM0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19371"
FT                   /db_xref="GOA:P66038"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="PDB:3MK3"
FT                   /db_xref="PDB:3NQ4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66038"
FT                   /protein_id="AAL19371.1"
FT                   /translation="MNIIKANVAAPDARVAITIARFNQFINDSLLDGAVDALTRIGQVK
FT                   DDNITVVWVPGAYELPLATEALAKSGKYDAVVALGTVIRGGTAHFEYVAGGASNGLASV
FT                   AQDSGVPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   gene            471516..471947
FT                   /gene="nusB"
FT                   /locus_tag="STM0418"
FT   regulatory      471516..471521
FT                   /gene="nusB"
FT                   /locus_tag="STM0418"
FT                   /note="putative RBS for nusB; RegulonDB:STMS1H000768"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        471528..471947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="STM0418"
FT                   /product="transcription termination; L factor"
FT                   /note="similar to E. coli transcription termination; L
FT                   factor (AAC73519.1); Blastp hit to AAC73519.1 (139 aa), 96%
FT                   identity in aa 1 - 139"
FT                   /db_xref="EnsemblGenomes-Gn:STM0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19372"
FT                   /db_xref="GOA:Q8ZRD3"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRD3"
FT                   /protein_id="AAL19372.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLSGVATNSAYLDGLMKPYLSRLLEELGQVEKAVLRIALFELSKRSDVPYKVAI
FT                   NEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   gene            472014..473003
FT                   /gene="thiL"
FT                   /locus_tag="STM0419"
FT   regulatory      472014..472019
FT                   /gene="thiL"
FT                   /locus_tag="STM0419"
FT                   /note="putative RBS for thiL; RegulonDB:STMS1H000769"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        472026..473003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="STM0419"
FT                   /product="thiamin-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="thiamine-monophosphate kinase. (SW:THIL_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19373"
FT                   /db_xref="GOA:P55881"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55881"
FT                   /protein_id="AAL19373.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEPWLEAFS
FT                   DSLFALLNYYDMQLIGGDTTRGPLSMTLGIHGYIPAGRALKRSGAKPGDWIYVTGTPGD
FT                   SAAGLAVLQNRLQVSEETDAHYLIQRHLRPTPRILHGQALRDIASAAIDLSDGLISDLG
FT                   HIVKASGCGARVDVDALPKSDAMMRHVDDGQALRWALSGGEDYELCFTVPELNRGALDV
FT                   AIGQLGVPFTCIGQMSADIEGLNFVRDGMPVTFDWKGYDHFATP"
FT   gene            472970..473496
FT                   /gene="pgpA"
FT                   /locus_tag="STM0420"
FT   regulatory      472970..472975
FT                   /gene="pgpA"
FT                   /locus_tag="STM0420"
FT                   /note="putative RBS for pgpA; RegulonDB:STMS1H000770"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        472981..473496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="STM0420"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /note="similar to E. coli phosphatidylglycerophosphatase
FT                   (AAC73521.1); Blastp hit to AAC73521.1 (172 aa), 95%
FT                   identity in aa 1 - 171"
FT                   /db_xref="EnsemblGenomes-Gn:STM0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19374"
FT                   /db_xref="GOA:Q7CR35"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR35"
FT                   /protein_id="AAL19374.1"
FT                   /translation="MTILPRHKDVAKSRLNLRNPWHLLATGFGSGLSPVVPGTMGSLAA
FT                   IPFWYLMTFLPWQLYSLVVMFGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMA
FT                   LPTTDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIG
FT                   HHWPLGII"
FT   gene            complement(473600..474587)
FT                   /gene="yajO"
FT                   /locus_tag="STM0421"
FT   CDS_pept        complement(473600..474574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="STM0421"
FT                   /product="putative oxidoreductase / K + channel protein"
FT                   /note="similar to E. coli putative NAD(P)H-dependent xylose
FT                   reductase (AAC73522.1); Blastp hit to AAC73522.1 (348 aa),
FT                   92% identity in aa 25 - 348"
FT                   /db_xref="EnsemblGenomes-Gn:STM0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19375"
FT                   /db_xref="GOA:Q8ZRD2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRD2"
FT                   /protein_id="AAL19375.1"
FT                   /translation="MQYNTLGNTDLRVSRLCLGCMTFGEPSRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFARRDEVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLARLGMEYVDILQIHRWDYTTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALALQKQHGWAPFVTMQDHYNLIYREEEREMLPLCWQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDDVGKNLYDESDKNDAQIAERLAGVSEALGATRAQVALGWLLSKRGVAA
FT                   PIIGASREEQLDELLNAVDLTLKPEQIAELETPYKQHPVVGFK"
FT   regulatory      complement(474582..474587)
FT                   /gene="yajO"
FT                   /locus_tag="STM0421"
FT                   /note="putative RBS for yajO; RegulonDB:STMS1H000771"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(474631..476493)
FT                   /gene="dxs"
FT                   /locus_tag="STM0422"
FT   CDS_pept        complement(474631..476493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="STM0422"
FT                   /product="1-deoxyxylulose-5-phosphate synthase;
FT                   flavoprotein"
FT                   /EC_number="2.2.-.-"
FT                   /note="similar to E. coli 1-deoxyxylulose-5-phosphate
FT                   synthase; flavoprotein (AAC73523.1); Blastp hit to
FT                   AAC73523.1 (620 aa), 96% identity in aa 1 - 620"
FT                   /db_xref="EnsemblGenomes-Gn:STM0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19376"
FT                   /db_xref="GOA:Q8ZRD1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRD1"
FT                   /protein_id="AAL19376.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRA
FT                   YDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECR
FT                   QMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGLVKRHGEKLAILNFGTLMPE
FT                   AAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKAWLA"
FT   gene            complement(476517..477431)
FT                   /gene="ispA"
FT                   /locus_tag="STM0423"
FT   CDS_pept        complement(476517..477416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="STM0423"
FT                   /product="geranyltranstransferase (farnesyldiphosphate
FT                   synthase)"
FT                   /EC_number="2.5.1.10"
FT                   /note="similar to E. coli geranyltranstransferase
FT                   (farnesyldiphosphate synthase) (AAC73524.1); Blastp hit to
FT                   AAC73524.1 (299 aa), 90% identity in aa 1 - 299"
FT                   /db_xref="EnsemblGenomes-Gn:STM0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19377"
FT                   /db_xref="GOA:Q8ZRD0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRD0"
FT                   /protein_id="AAL19377.1"
FT                   /translation="MDFTQQLQACVTQANQALSRFIAPLPFQNTPVVEAMQYGALLGGK
FT                   RLRPFLVYATGQMFGVSTATLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHIK
FT                   FGEANAILAGDALQTLAFAIISDAPMPEVADRDRIAMIAELANASGIAGMCGGQALDLA
FT                   AEGQRITLDALERIHRHKTGALIRAAVRLGALSAGDKGRNTLPILDRYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARNKARDLIEDARQSLHQLAAQS
FT                   LDTSALEALANYIIQRDK"
FT   gene            complement(477417..477679)
FT                   /gene="xseB"
FT                   /locus_tag="STM0424"
FT   CDS_pept        complement(477417..477659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="STM0424"
FT                   /product="exonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="similar to E. coli exonuclease VII, small subunit
FT                   (AAC73525.1); Blastp hit to AAC73525.1 (80 aa), 90%
FT                   identity in aa 1 - 80"
FT                   /db_xref="EnsemblGenomes-Gn:STM0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19378"
FT                   /db_xref="GOA:P67458"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67458"
FT                   /protein_id="AAL19378.1"
FT                   /translation="MPKKNEAPASFETALSELEHIVTRLESGDLPLEDALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEEASPEPFIADNE"
FT   regulatory      complement(477426..477431)
FT                   /gene="xseB"
FT                   /locus_tag="STM0424"
FT                   /note="putative RBS for ispA; RegulonDB:STMS1H000772"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(477674..477679)
FT                   /gene="xseB"
FT                   /locus_tag="STM0424"
FT                   /note="putative RBS for xseB; RegulonDB:STMS1H000773"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            477869..479317
FT                   /gene="thiI"
FT                   /locus_tag="STM0425"
FT   CDS_pept        477869..479317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="STM0425"
FT                   /product="sulfur transfer protein (from cys to ThiS and
FT                   from IscS to U8-tRNA)"
FT                   /note="thiamine biosynthesis protein thiI. (SW:THII_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19379"
FT                   /db_xref="GOA:P55913"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55913"
FT                   /protein_id="AAL19379.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLVIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEG
FT                   KTFCVRVKRRGKHEFSSIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAIKAKIEAEEENFDFSILDKVVEEANNVDIREIAQQTQQEVVEVE
FT                   TVSGFGPNDVILDIRSVDEQDDKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCER
FT                   GVMSRLQALYLREQGFANVKVYRP"
FT   gene            complement(479361..480165)
FT                   /gene="phnV"
FT                   /locus_tag="STM0426"
FT   CDS_pept        complement(479361..480158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnV"
FT                   /locus_tag="STM0426"
FT                   /product="2-aminoethylphosphonate transporter, memrane
FT                   component"
FT                   /note="probable membrane component of
FT                   2-aminoethylphosphonate transporter phnV (gi|11354255)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19380"
FT                   /db_xref="GOA:P96065"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017661"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96065"
FT                   /protein_id="AAL19380.1"
FT                   /translation="MLIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILP
FT                   SGFTLNHFVNALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMV
FT                   FYLPSAIPSVSVGLGILVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISA
FT                   DIENVASSLGASPWYRLRHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLP
FT                   VAIFSLTDRGNIADGAALTIVLVAITLLLMMKLERIAKRLGQK"
FT   regulatory      complement(480160..480165)
FT                   /gene="phnV"
FT                   /locus_tag="STM0426"
FT                   /note="putative RBS for phnV; RegulonDB:STMS1H000774"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(480161..481027)
FT                   /gene="phnU"
FT                   /locus_tag="STM0427"
FT   CDS_pept        complement(480161..481021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnU"
FT                   /locus_tag="STM0427"
FT                   /product="2-aminoethylphosphonate transporter, memrane
FT                   component"
FT                   /note="probable membrane component of
FT                   2-aminoethylphosphonate transporter phnU (gi|11354254)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19381"
FT                   /db_xref="GOA:P96064"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017636"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96064"
FT                   /protein_id="AAL19381.1"
FT                   /translation="MSLILPLEKPALNLRPLLWLLLPLLVLATLFFWPLSLIVEQALRG
FT                   ANGEIGLETFRQVVDSKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELI
FT                   GRVVDTFIALPTFLITLAFTFIYGSAGLLNGTLMSLFAFELPPVDFLYSMQGVILAEIT
FT                   VFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMAGGSLCLLLT
FT                   TNEFGIVLFIGAKGVNTLPMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASR
FT                   TGVRS"
FT   regulatory      complement(481022..481027)
FT                   /gene="phnU"
FT                   /locus_tag="STM0427"
FT                   /note="putative RBS for phnU; RegulonDB:STMS1H000775"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(481024..482133)
FT                   /gene="phnT"
FT                   /locus_tag="STM0428"
FT   CDS_pept        complement(481024..482133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnT"
FT                   /locus_tag="STM0428"
FT                   /product="2-aminoethylphosphonate transporter ATPase
FT                   component"
FT                   /note="probable ATPase component of 2-aminoethylphosphonate
FT                   transporter phnT (gi|11354253)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19382"
FT                   /db_xref="GOA:P96063"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017662"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96063"
FT                   /protein_id="AAL19382.1"
FT                   /translation="MLMKTTTVHAPASQGTSGIVLDSLRVAYHGNVVLKPLSLTIEPGE
FT                   VLALIGPSGSGKTTVLRAVAGFVQPAGGRILIGDTDVTHLPPYKRGLAMVVQNYALFPH
FT                   LKVEDNVAFGLRAQKQPKALINERVTQALKTVGMSDYAARYPHQLSGGQQQRVAIARAI
FT                   AVRPRVLLLDEPLSALDAQIRHNMVEEIARLHRELPELTILYVTHDQTEALTLADKIGI
FT                   MKDGSLIAHGETRALYQHPPNRFAAEFLGRANILSAIALGITEAPGLVDVSCGGAVIRA
FT                   FSRGSHHGYNKLLCIRPQHLSLTPRSAYSNRFNATLQSVHWQGDLTHLLCDVAGETVRM
FT                   VLTHVNPLPRVGDKLALWFEPDDAVLIEV"
FT   gene            complement(482139..483157)
FT                   /gene="phnS"
FT                   /locus_tag="STM0429"
FT   CDS_pept        complement(482139..483152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnS"
FT                   /locus_tag="STM0429"
FT                   /product="2-aminoethylphosphonate transporter,
FT                   periplasmic-binding component"
FT                   /note="probable periplasmic binding-protein of the
FT                   2-aminoethylphosphonate transporter PhnS (gi|11354256)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19383"
FT                   /db_xref="GOA:P96062"
FT                   /db_xref="InterPro:IPR017637"
FT                   /db_xref="PDB:4R6Y"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96062"
FT                   /protein_id="AAL19383.1"
FT                   /translation="MKLSRLALLSVFALASAPSWAESVVTVYSIDGLHDGDNSWYQVQF
FT                   DAFTKATGITVRYVEGGGGVVVERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFNTD
FT                   TASAIPDANNLYSPLVKNYLSFIYNSKLLKTAPASWQDLLDGKFKNKLQYSTPGQAADG
FT                   TAVMLQAFHSFGSKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLA
FT                   QMERNPNVKIFWPANDKGERSALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSE
FT                   LSWGMPVRSDVTPSDEHYKAATAALEGVQSWQPNWDDVAVSLSADISRWHKVTESE"
FT   regulatory      complement(483152..483157)
FT                   /gene="phnS"
FT                   /locus_tag="STM0429"
FT                   /note="putative RBS for phnS; RegulonDB:STMS1H000776"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(483350..484085)
FT                   /gene="phnR"
FT                   /locus_tag="STM0430"
FT   CDS_pept        complement(483350..484069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnR"
FT                   /locus_tag="STM0430"
FT                   /product="2-aminoethylphosphonate transport, repressor"
FT                   /note="probable repressor protein of GntR family phnR
FT                   (gi|11354257)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19384"
FT                   /db_xref="GOA:Q7CR30"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR017722"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR30"
FT                   /protein_id="AAL19384.1"
FT                   /translation="MKSIPGDIPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNT
FT                   TRITIRESLAQLESSGLIWRADRRGWFVTPERLWLDPTQNTNFHKLCREQGREPKTALL
FT                   SGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDLNG
FT                   SLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDL
FT                   DIEYWRHDSLRIEVDTH"
FT   regulatory      complement(484080..484085)
FT                   /gene="phnR"
FT                   /locus_tag="STM0430"
FT                   /note="putative RBS for phnR; RegulonDB:STMS1H000777"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            484203..485312
FT                   /gene="phnW"
FT                   /locus_tag="STM0431"
FT   regulatory      484203..484208
FT                   /gene="phnW"
FT                   /locus_tag="STM0431"
FT                   /note="putative RBS for phnW; RegulonDB:STMS1H000778"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        484209..485312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnW"
FT                   /locus_tag="STM0431"
FT                   /product="2-aminoethylphosphonate transport"
FT                   /EC_number="2.6.1.-"
FT                   /note="2-aminoethylphosphonate--pyruvate aminotransferase
FT                   phnW (gi|11354251)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19385"
FT                   /db_xref="GOA:P96060"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="PDB:1M32"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96060"
FT                   /protein_id="AAL19385.1"
FT                   /translation="MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQ
FT                   QLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMG
FT                   IAHHAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGK
FT                   TYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSL
FT                   SLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVA
FT                   GMRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFR
FT                   IGNIGEVYAADITALLTAIRTAMYWTK"
FT   gene            485312..486131
FT                   /gene="phnX"
FT                   /locus_tag="STM0432"
FT   regulatory      485312..485317
FT                   /gene="phnX"
FT                   /locus_tag="STM0432"
FT                   /note="putative RBS for phnX; RegulonDB:STMS1H000779"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        485319..486131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnX"
FT                   /locus_tag="STM0432"
FT                   /product="2-aminoethylphosphonate transport"
FT                   /EC_number="3.1.3.18"
FT                   /note="phosphonoacetaldehyde phosphonohydrolase phnX
FT                   (gi|11354252)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19386"
FT                   /db_xref="GOA:Q7ZAP3"
FT                   /db_xref="InterPro:IPR006323"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7ZAP3"
FT                   /protein_id="AAL19386.1"
FT                   /translation="MMNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQAFDVEITLAEA
FT                   RVPMGLGKWQHIEALGKLPAVDARWQAKFGRSMSAADIDAIYAAFMPLQIAKVVDFSSP
FT                   IAGVIDTIAALRAEGIKIGSCSGYPRAVMERLVPAAAGHGYRPDHWVATDDLAAGGRPG
FT                   PWMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGATWDAYQTM
FT                   SKEDVAVRREHAASKLYAAGAHYVVDSLADLPGVIAHINARLAQGERP"
FT   gene            complement(486228..486831)
FT                   /gene="thiJ"
FT                   /locus_tag="STM0433"
FT   CDS_pept        complement(486228..486818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="STM0433"
FT                   /product="4-methyl-5(beta-hydroxyethyl)-thiazole synthesis"
FT                   /note="4-methyl-5(B-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis enzyme. (SW:THIJ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19387"
FT                   /db_xref="GOA:P55880"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55880"
FT                   /protein_id="AAL19387.1"
FT                   /translation="MSAQALVCLAPGSEETEAVTTIDLLVRGGIHVTTASVASDGNLTI
FT                   VCSRGVKLLADAPLVEVADGDYDIIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIVAA
FT                   ICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLAGREKAHEVASQLVMAAGIYNYYE"
FT   gene            complement(486781..487703)
FT                   /gene="apbA"
FT                   /locus_tag="STM0434"
FT   CDS_pept        complement(486781..487692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /locus_tag="STM0434"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="2-dehydropantoate 2-reductase. (SW:APBA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19388"
FT                   /db_xref="GOA:P37402"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37402"
FT                   /protein_id="AAL19388.1"
FT                   /translation="MKITVLGCGALGQLWLSALCKHGHDVQGWLRVPQPYCSVNLIDTD
FT                   GSFFNESLTANDPDFLAKSELLLVTLKAWQVSDAVRTLASTLPVTSPILLIHNGMGTIE
FT                   ELQNIQQPMLMGTITHAARRDGNIIIHVANGTTHIGPAREQDGDYSYLADILQGVLPDV
FT                   AWHNNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHTDEINAICEEVAAVIEREGYHT
FT                   SADDLRYYVEQVIDSTAENISSMLQDVRAMRHTEIDYITGYLLKRARVHGLAVPENSRL
FT                   FEMVKRKESEYERSGTGMPRPW"
FT   regulatory      complement(486826..486831)
FT                   /gene="thiJ"
FT                   /locus_tag="STM0433"
FT                   /note="putative RBS for thiJ; RegulonDB:STMS1H000780"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(487698..487703)
FT                   /gene="apbA"
FT                   /locus_tag="STM0434"
FT                   /note="putative RBS for apbA; RegulonDB:STMS1H000781"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            487800..488309
FT                   /gene="yajQ"
FT                   /locus_tag="STM0435"
FT   CDS_pept        487800..488309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="STM0435"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73529.1); Blastp hit to AAC73529.1 (169 aa), 90%
FT                   identity in aa 1 - 169"
FT                   /db_xref="EnsemblGenomes-Gn:STM0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19389"
FT                   /db_xref="GOA:Q8ZRC9"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRC9"
FT                   /protein_id="AAL19389.1"
FT                   /translation="MKGEEKMPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATI
FT                   ELNDANKTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVPDEFVHSGKTWYVEAKL
FT                   KQGIESAVQKKIVKLIKDSKLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGGDLGQPFQ
FT                   FKNFRD"
FT   gene            complement(488356..489705)
FT                   /gene="yajR"
FT                   /locus_tag="STM0436"
FT   CDS_pept        complement(488356..489705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="STM0436"
FT                   /product="putative MFS family transporter"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC73530.1); Blastp hit to AAC73530.1 (456 aa), 89%
FT                   identity in aa 8 - 453"
FT                   /db_xref="EnsemblGenomes-Gn:STM0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19390"
FT                   /db_xref="GOA:Q8ZRC8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC8"
FT                   /protein_id="AAL19390.1"
FT                   /translation="MTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGASEALI
FT                   GIAIGIYGLAQAIFQIPFGLLSDRIGRKPLIVGGLAVFVAGSVIAALSHSIWGIILGRA
FT                   LQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIVTHSLGLNALF
FT                   WMIAALATLGILLTIWVVPNSTNHVLNRESGMVKGSFSKVLAEPRLLKLNFGIMCLHIL
FT                   LMSTFVALPGQLADAGFPAAEHWKVYLATMVIAFAAVVPFIIYAEVKRRMKQVFLFCVG
FT                   LIVVAEIVLWGAGQHFWELVIGVQLFFLAFNLMEALLPSLISKESPAGYKGTAMGVYST
FT                   SQFLGVALGGSLGGWIDGTFDGQTVFLAGAVLAMVWLAVASTMKEPPYVSSLRVEIPAD
FT                   IVADDRLKQRLLAMKGVSEALIVAEEHSAYVKIDSKVTNRFEVEQLISKG"
FT   gene            complement(489948..490109)
FT                   /locus_tag="STM0436A"
FT   CDS_pept        complement(489948..490109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0436A"
FT                   /product="IS903 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:STM0436A"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC7"
FT                   /protein_id="AAL19391.1"
FT                   /translation="MPSFQNRVPMAKQKFKITHRPATLRQRGSLTVWLDEFCYCNMEQQ
FT                   RTQPEGRG"
FT   gene            490250..491768
FT                   /locus_tag="STM0437"
FT   regulatory      490250..490255
FT                   /locus_tag="STM0437"
FT                   /note="putative RBS for STM0437; RegulonDB:STMS1H000782"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        490257..491768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0437"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73748.1); Blastp hit to AAC73748.1 (184 aa), 38%
FT                   identity in aa 61 - 150, 32% identity in aa 22 - 151, 36%
FT                   identity in aa 57 - 131, 38% identity in aa 123 - 175,
FT                   30-1073758628dentity in aa 105 - 164, 22% identity in aa 10
FT                   - 129"
FT                   /db_xref="EnsemblGenomes-Gn:STM0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19392"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC6"
FT                   /protein_id="AAL19392.1"
FT                   /translation="MEIKFLSLCILAGVLFVSQVNASANNGKDDVKYAALTQKDLDALP
FT                   VEKRASVLDELGFIHEYGLSVPMNRERALQYYKQACELGGNYGCYNVKYAYQYGDGVAK
FT                   DSAQANKYAKKMNLDNLLIEQEYIDKFSQEIYMAKALADTDKSQRAAFISILIHALNNR
FT                   PESDALFFSRIGFNQEKTFRLATLWSQDGDPQMDYQMGRLTLNDFSGRYADEPYQARPA
FT                   SLKWFRAAAEKGVVEAQSLLGGIYSGGEGDEWGIKPDIQEAQKWYGQAAKQGDSDAQIA
FT                   LGKIYYSGATGRTDYAKALALFTQVENDGTNSRSTMPLSWMYYNGLGTAPDCDKAWSYY
FT                   KKASRYVGKKVEEKIFLSKCAADIQSRKNNADALPKVTLKKERIFSRGITAKPKECALI
FT                   FQIGTDKIRNMANLHITLELKNADGMATEETLMIPPFGLNTLGIDMQNHDVDPLVTPYD
FT                   LPLYTQDFCHGIGDIHFTLKSATATINGKNVDLLKADSVRFLDKE"
FT   gene            491986..493273
FT                   /locus_tag="STM0438"
FT   regulatory      491986..491991
FT                   /locus_tag="STM0438"
FT                   /note="putative RBS for STM0438; RegulonDB:STMS1H000783"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        491990..493273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0438"
FT                   /product="putative TPR repeat protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73748.1); Blastp hit to AAC73748.1 (184 aa), 35%
FT                   identity in aa 77 - 179, 33% identity in aa 56 - 171"
FT                   /db_xref="EnsemblGenomes-Gn:STM0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19393"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC5"
FT                   /protein_id="AAL19393.1"
FT                   /translation="MDIPQAIKYYEQACDLDGDYGCFNAAYFYEYGIGTQKDITQAKTL
FT                   AKQLREKINLSNINLDKKVSERIIGSVYSNKLEAYRDLSFRPHFIQGLSFYFYAPQSDE
FT                   RKLLSRIGFDSSHLARIAILWAREGDPEVAYQTAKLVSTLYFNNETKTIDIAEALKWLR
FT                   ISAEKGDADSQTLLGFLYEHAGLGLQPDGEKARKWYEMAAQQGNGEALYTLGRMYYSGV
FT                   LVNVDYDKALYFFKKAYEKKLQEAADYLAQMYFNGQSVDVDCQQSWHYYDNSYIKKMTQ
FT                   RDYLDYCEKDRKRRNDFNQQLPELTLEKYAGLFGRIDNIPLCQIGFVVNTNKLIHVANL
FT                   RVELILKNDAGVSDERMVAFPPLGLNTLGAEQGMGDSFKSMGYLLMKNGDLCDYHKLTF
FT                   TVKSATATINGKKVDLLKTDNLHIIQNR"
FT   gene            complement(493355..494254)
FT                   /gene="cyoE"
FT                   /locus_tag="STM0439"
FT   CDS_pept        complement(493355..494245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="STM0439"
FT                   /product="protohaeme IX farnesyltransferase (haeme O
FT                   biosynthesis)"
FT                   /EC_number="2.5.1.-"
FT                   /note="similar to E. coli protoheme IX farnesyltransferase
FT                   (haeme O biosynthesis) (AAC73531.1); Blastp hit to
FT                   AAC73531.1 (296 aa), 95% identity in aa 1 - 296"
FT                   /db_xref="EnsemblGenomes-Gn:STM0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19394"
FT                   /db_xref="GOA:Q8ZRC4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRC4"
FT                   /protein_id="AAL19394.1"
FT                   /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
FT                   VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFG
FT                   ANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAA
FT                   ILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLM
FT                   LTLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSV
FT                   DFMVPNSQNLLTYVW"
FT   regulatory      complement(494249..494254)
FT                   /gene="cyoE"
FT                   /locus_tag="STM0439"
FT                   /note="putative RBS for cyoE; RegulonDB:STMS1H000784"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(494257..494600)
FT                   /gene="cyoD"
FT                   /locus_tag="STM0440"
FT   CDS_pept        complement(494257..494586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="STM0440"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="similar to E. coli cytochrome o ubiquinol oxidase
FT                   subunit IV (AAC73532.1); Blastp hit to AAC73532.1 (109 aa),
FT                   93% identity in aa 1 - 109"
FT                   /db_xref="EnsemblGenomes-Gn:STM0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19395"
FT                   /db_xref="GOA:Q7CR28"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR28"
FT                   /protein_id="AAL19395.1"
FT                   /translation="MSHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAASPAV
FT                   ILGSILAMAVVQILVHLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(494586..495212)
FT                   /gene="cyoC"
FT                   /locus_tag="STM0441"
FT   CDS_pept        complement(494586..495200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="STM0441"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.10.2.-"
FT                   /note="similar to E. coli cytochrome o ubiquinol oxidase
FT                   subunit III (AAC73533.1); Blastp hit to AAC73533.1 (204
FT                   aa), 96% identity in aa 1 - 204"
FT                   /db_xref="EnsemblGenomes-Gn:STM0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19396"
FT                   /db_xref="GOA:Q8ZRC3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC3"
FT                   /protein_id="AAL19396.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGQNKIFGFWVYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMHKNNKSQVISWLAL
FT                   TFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   VARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM"
FT   regulatory      complement(494595..494600)
FT                   /gene="cyoD"
FT                   /locus_tag="STM0440"
FT                   /note="putative RBS for cyoD; RegulonDB:STMS1H000785"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(495190..497193)
FT                   /gene="cyoB"
FT                   /locus_tag="STM0442"
FT   CDS_pept        complement(495190..497181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="STM0442"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.10.2.-"
FT                   /note="similar to E. coli cytochrome o ubiquinol oxidase
FT                   subunit I (AAC73534.1); Blastp hit to AAC73534.1 (663 aa),
FT                   95% identity in aa 1 - 663"
FT                   /db_xref="EnsemblGenomes-Gn:STM0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19397"
FT                   /db_xref="GOA:Q7CR27"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR27"
FT                   /protein_id="AAL19397.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAAIIVGGLAILAAITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNLSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPSVGVDYWIWALQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMMWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYVLGFMGMTRRLSQQIDPQFHTMLMVAAAGAALIALGILCQLIQIF
FT                   VSIRDRDQNRDLTGDPWGGRTLEWSTSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYQQ
FT                   PGQYEEIHMPKNSGAGIVIAAFATVFGFAMIWHIWWLAIVGFAGMIISWIVKSFDEDVD
FT                   YYVPVPEVEKLENQHFDEITKAGLKNGN"
FT   regulatory      complement(495207..495212)
FT                   /gene="cyoC"
FT                   /locus_tag="STM0441"
FT                   /note="putative RBS for cyoC; RegulonDB:STMS1H000786"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(497188..497193)
FT                   /gene="cyoB"
FT                   /locus_tag="STM0442"
FT                   /note="putative RBS for cyoB; RegulonDB:STMS1H000787"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(497192..498229)
FT                   /gene="cyoA"
FT                   /locus_tag="STM0443"
FT   CDS_pept        complement(497192..498148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="STM0443"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.10.2.-"
FT                   /note="similar to E. coli cytochrome o ubiquinol oxidase
FT                   subunit II (AAC73535.1); Blastp hit to AAC73535.1 (315 aa),
FT                   95% identity in aa 1 - 315"
FT                   /db_xref="EnsemblGenomes-Gn:STM0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19398"
FT                   /db_xref="GOA:Q7CR26"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR26"
FT                   /protein_id="AAL19398.1"
FT                   /translation="MRLRKYNKSLGWLSLIAGTALLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATKDRAEFDQWVAKAKQSPNTMNDMAAFEKVAMPSEYNKVEYFSSVKPDLFKDVINKF
FT                   MGHGKSMDMTQPEGEHSSHEGMEGMDMSHAESANSKG"
FT   regulatory      complement(498162..498167)
FT                   /gene="cyoA"
FT                   /locus_tag="STM0443"
FT                   /note="putative RBS for cyoA; RegulonDB:STMS1H000788"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(498205..498213)
FT                   /gene="cyoA"
FT                   /locus_tag="STM0443"
FT                   /note="putative -10_signal for cyoA;
FT                   RegulonDB:STMLTH004674"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(498221..498229)
FT                   /gene="cyoA"
FT                   /locus_tag="STM0443"
FT                   /note="putative -35_signal for cyoA;
FT                   RegulonDB:STMLTH004674"
FT                   /regulatory_class="minus_35_signal"
FT   protein_bind    complement(498365..498427)
FT                   /bound_moiety="ArcA"
FT                   /note="putative binding site for ArcA, RegulonDB:
FT                   STMS1H000013"
FT   gene            complement(498601..500094)
FT                   /gene="ampG"
FT                   /locus_tag="STM0444"
FT   CDS_pept        complement(498601..500076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="STM0444"
FT                   /product="MFS family, muropeptide transporter"
FT                   /note="similar to E. coli regulates beta-lactamase
FT                   synthesis (AAC73536.1); Blastp hit to AAC73536.1 (491 aa),
FT                   91% identity in aa 1 - 490"
FT                   /db_xref="EnsemblGenomes-Gn:STM0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19399"
FT                   /db_xref="GOA:Q8ZRC2"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC2"
FT                   /protein_id="AAL19399.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFLGRRRGWLLATQLLLLAAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADRWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPSPKSLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKNMFSMGAAVFFENLCGGMGTAAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWPTFYLFSVVAAVPGLLLL
FT                   LVCRQTLEYSWQSERFIPRTQYRGAYNFALSILLAGVALLAVWVLLLTMNAVDYTNFSF
FT                   LPELLETAVVVAVCGIVFGGLLDYLALRKTRLL"
FT   regulatory      complement(500089..500094)
FT                   /gene="ampG"
FT                   /locus_tag="STM0444"
FT                   /note="putative RBS for ampG; RegulonDB:STMS1H000789"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(500120..500760)
FT                   /gene="yajG"
FT                   /locus_tag="STM0445"
FT   CDS_pept        complement(500120..500752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="STM0445"
FT                   /product="putative lipoprotein"
FT                   /note="similar to E. coli putative polymerase/proteinase
FT                   (AAC73537.1); Blastp hit to AAC73537.1 (226 aa), 85%
FT                   identity in aa 20 - 226"
FT                   /db_xref="EnsemblGenomes-Gn:STM0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19400"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC1"
FT                   /protein_id="AAL19400.1"
FT                   /translation="MMAGIFTYHVLSVIESLNMLKKLLFPLVALFMLAGCATPPTTIDV
FT                   APKITLPQQDPSLMGVTVSITGADQRQDQALAKVTRNNQLVTLTASRDLRFLLQEVLEK
FT                   QMTARGYMIGPNGAVNLQIIVNQLYADVSQGSVRYNIATKADIAIIATAANGSKMTKNY
FT                   RANYSIEGAFQASNQNIADAVNSVLTDTIADMSQDTSIHDFIKQNAR"
FT   regulatory      complement(500755..500760)
FT                   /gene="yajG"
FT                   /locus_tag="STM0445"
FT                   /note="putative RBS for yajG; RegulonDB:STMS1H000790"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            500990..501319
FT                   /gene="bolA"
FT                   /locus_tag="STM0446"
FT   regulatory      500990..500995
FT                   /gene="bolA"
FT                   /locus_tag="STM0446"
FT                   /note="putative RBS for bolA; RegulonDB:STMS1H000791"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        501002..501319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="STM0446"
FT                   /product="morphogene; putative regulator of murein genes
FT                   (BolA family)"
FT                   /note="similar to E. coli possible regulator of murein
FT                   genes (AAC73538.1); Blastp hit to AAC73538.1 (116 aa), 92%
FT                   identity in aa 12 - 116"
FT                   /db_xref="EnsemblGenomes-Gn:STM0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19401"
FT                   /db_xref="GOA:Q7CR25"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR25"
FT                   /protein_id="AAL19401.1"
FT                   /translation="MMIREQIEEKLRTAFDPVFLEVVDESYRHNVPAGSESHFKVVLVS
FT                   DRFTGERFLNRHRMIYGTLTAELSTTVHALALHTYTLKEWEGLQDTIFASPPCRGAGSI
FT                   A"
FT   gene            501655..502964
FT                   /gene="tig"
FT                   /locus_tag="STM0447"
FT   regulatory      501655..501660
FT                   /gene="tig"
FT                   /locus_tag="STM0447"
FT                   /note="putative RBS for tig; RegulonDB:STMS1H000792"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        501666..502964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="STM0447"
FT                   /product="peptidyl-prolyl cis/trans isomerase"
FT                   /note="trigger factor; a molecular chaperone involved in
FT                   cell division; similar to E. coli trigger factor; a
FT                   molecular chaperone involved in cell division (AAC73539.1);
FT                   Blastp hit to AAC73539.1 (432 aa), 95% identity in aa 1 -
FT                   432"
FT                   /db_xref="EnsemblGenomes-Gn:STM0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19402"
FT                   /db_xref="GOA:P66932"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66932"
FT                   /protein_id="AAL19402.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEYKVGEDFT
FT                   YSVEFEVYPEVELTGLESIEVEKPVVEVTDADVDVMLDTLRKQQATWKEKDGAADAEDR
FT                   VTIDFTGSVDGEEFEGGKATDFVLAMGQGRMIPGFEDGVKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFVINLKKVEERELPELTEEFIKRFGVEDGSVAGLRAEVRKNMERELKGA
FT                   VRNRVKSQAIEGLVKANDIDVPSALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVSEKATSFNELMNQQA"
FT   gene            503199..503834
FT                   /gene="clpP"
FT                   /locus_tag="STM0448"
FT   regulatory      503199..503204
FT                   /gene="clpP"
FT                   /locus_tag="STM0448"
FT                   /note="putative RBS for clpP; RegulonDB:STMS1H000793"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        503211..503834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="STM0448"
FT                   /product="proteolytic subunit of clpA-clpP ATP-dependent
FT                   serine protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="heat shock protein F21.5; similar to E. coli
FT                   ATP-dependent proteolytic subunit of clpA-clpP serine
FT                   protease, heat shock protein F21.5 (AAC73540.1); Blastp hit
FT                   to AAC73540.1 (207 aa), 99% identity in aa 1 - 207"
FT                   /db_xref="EnsemblGenomes-Gn:STM0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19403"
FT                   /db_xref="GOA:P0A1D7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1D7"
FT                   /protein_id="AAL19403.1"
FT                   /translation="MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
FT   gene            504073..505357
FT                   /gene="clpX"
FT                   /locus_tag="STM0449"
FT   regulatory      504073..504078
FT                   /gene="clpX"
FT                   /locus_tag="STM0449"
FT                   /note="putative RBS for clpX; RegulonDB:STMS1H000794"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        504086..505357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="STM0449"
FT                   /product="specificity component of clpA-clpP ATP-dependent
FT                   serine protease, chaperone"
FT                   /note="similar to E. coli ATP-dependent specificity
FT                   component of clpP serine protease, chaperone (AAC73541.1);
FT                   Blastp hit to AAC73541.1 (424 aa), 98% identity in aa 1 -
FT                   424"
FT                   /db_xref="EnsemblGenomes-Gn:STM0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19404"
FT                   /db_xref="GOA:Q8ZRC0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRC0"
FT                   /protein_id="AAL19404.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRTHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVIANRVETGSGIGFGATVKAKSDKA
FT                   SEGELLSQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIARKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIAGQSKPLLIYGKPEAQASGE"
FT   gene            505532..507897
FT                   /gene="lon"
FT                   /locus_tag="STM0450"
FT   regulatory      505532..505537
FT                   /gene="lon"
FT                   /locus_tag="STM0450"
FT                   /note="putative RBS for lon; RegulonDB:STMS1H000795"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        505543..507897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="STM0450"
FT                   /product="DNA-binding protein"
FT                   /EC_number="3.4.21.53"
FT                   /note="ATP-dependent protease la; cleaves RcsA and SulA;
FT                   heat shock k-protein (DNA binding activity); similar to E.
FT                   coli DNA-binding, ATP-dependent protease La; heat shock
FT                   K-protein (AAC73542.1); Blastp hit to AAC73542.1 (784 aa),
FT                   99% identity in aa 1 - 784"
FT                   /db_xref="EnsemblGenomes-Gn:STM0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19405"
FT                   /db_xref="GOA:Q8ZRB9"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB9"
FT                   /protein_id="AAL19405.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLDSPAIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYIRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRSLEREISKLCRKAVKQLLLDKSLKHIEINGDNLH
FT                   DYLGVQRFDYGRADSENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   gene            508058..508378
FT                   /gene="hupB"
FT                   /locus_tag="STM0451"
FT   regulatory      508058..508066
FT                   /gene="hupB"
FT                   /locus_tag="STM0451"
FT                   /note="putative -35_signal for hupB;
FT                   RegulonDB:STMLTH004679"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      508085..508093
FT                   /gene="hupB"
FT                   /locus_tag="STM0451"
FT                   /note="putative -10_signal for hupB;
FT                   RegulonDB:STMLTH004679"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      508093..508098
FT                   /gene="hupB"
FT                   /locus_tag="STM0451"
FT                   /note="putative RBS for hupB; RegulonDB:STMS1H000796"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        508106..508378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="STM0451"
FT                   /product="DNA-binding protein HU-beta, NS1 (HU-1)"
FT                   /note="DNA-binding protein HU-beta (NS1) (HU-1).
FT                   (SW:DBHB_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19406"
FT                   /db_xref="GOA:P0A1R8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1R8"
FT                   /protein_id="AAL19406.1"
FT                   /translation="MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   gene            508651..510540
FT                   /gene="cypD"
FT                   /locus_tag="STM0452"
FT   regulatory      508651..508656
FT                   /gene="cypD"
FT                   /locus_tag="STM0452"
FT                   /note="putative RBS for cypD; RegulonDB:STMS1H000797"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        508669..510540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypD"
FT                   /locus_tag="STM0452"
FT                   /product="peptidyl prolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="similar to E. coli putative protease maturation
FT                   protein (AAC73544.1); Blastp hit to AAC73544.1 (623 aa),
FT                   88% identity in aa 1 - 623"
FT                   /db_xref="EnsemblGenomes-Gn:STM0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19407"
FT                   /db_xref="GOA:Q8ZRB8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB8"
FT                   /protein_id="AAL19407.1"
FT                   /translation="MMDSLRTAANSLVLKIIFVIIIVSFILTGVSGYLIGGSNNYAAKV
FT                   NGQEISRAQFENAFNNERNRMQQQLGDRYSELAANEGYMKSLRQQVLNRLIDEALLDQY
FT                   SRELKLGISDEQVKQAIFATPAFQVDGKFDNNRYNAIVNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVSQQRVVREAVIDVNALAAKQQVTDQEVSSYYDQNK
FT                   VRFMTPEQFRVSYIKLDAATMQAPVSDADIQAYYDQHVDQFTQPERIRYSIIQTKTEDD
FT                   AKAVLDALNKGEDFATLAKEKSTDIISARNGGDMGWLEESATVPELKNAGLKEKGQISG
FT                   VIKSSVGFLVARLDDIQPAKVKPLSEVRDDIAAKVKQEKALDAYYALQQKVSDAASNDN
FT                   ESLAGAEQVAGVKAVETGWFSRDTLPEELNFKPVADAIFNGGLVGENGTPGPNSDIITV
FT                   DGDRAFVVRVSEHKPEAVKPLAEVKEQVTALVKHNKAEQQAKLDAEKLLVELKAGKGAE
FT                   AMKAAGLSFGEPKTLSRTSQDPVSQAAFALSLPTKDKPVYGVANDMQGNVVLLAFDEVK
FT                   AGAMPEAQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   gene            510676..511064
FT                   /gene="ybaV"
FT                   /locus_tag="STM0453"
FT   regulatory      510676..510681
FT                   /gene="ybaV"
FT                   /locus_tag="STM0453"
FT                   /note="putative RBS for ybaV; RegulonDB:STMS1H000798"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        510690..511064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="STM0453"
FT                   /product="putative DNA uptake protein and related
FT                   DNA-binding proteins"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73545.1); Blastp hit to AAC73545.1 (123 aa), 83%
FT                   identity in aa 1 - 123"
FT                   /db_xref="EnsemblGenomes-Gn:STM0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19408"
FT                   /db_xref="GOA:Q7CR24"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR24"
FT                   /protein_id="AAL19408.1"
FT                   /translation="MKHGIKALLITLSLTCAGMAHSALAATPVAKNAAVETKADTPSSS
FT                   SAKAALPAKASDDEGTRVSINTASAEDLARVMNGVGLKKAQAIVSYREEYGPFKTVDDL
FT                   KQVPGMGSALVERNLAVLTL"
FT   gene            511154..511566
FT                   /gene="ybaW"
FT                   /locus_tag="STM0454"
FT   regulatory      511154..511159
FT                   /gene="ybaW"
FT                   /locus_tag="STM0454"
FT                   /note="putative RBS for ybaW; RegulonDB:STMS1H000799"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        511168..511566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="STM0454"
FT                   /product="putative esterase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73546.1); Blastp hit to AAC73546.1 (132 aa), 94%
FT                   identity in aa 1 - 132"
FT                   /db_xref="EnsemblGenomes-Gn:STM0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19409"
FT                   /db_xref="GOA:Q7CR23"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR23"
FT                   /protein_id="AAL19409.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   ARNIAFVVVNININYRRPAVLSDLLTVTSQVQQLNGKSGVLSQTITLEPEGQVVADALI
FT                   TFVCIDLKTQKALPLEGELREKLEQMVQ"
FT   gene            complement(511672..512377)
FT                   /gene="ybaX"
FT                   /locus_tag="STM0455"
FT   CDS_pept        complement(511672..512367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="STM0455"
FT                   /product="putative (aluminum) resistance protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73547.1); Blastp hit to AAC73547.1 (231 aa), 93%
FT                   identity in aa 1 - 231"
FT                   /db_xref="EnsemblGenomes-Gn:STM0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19410"
FT                   /db_xref="GOA:Q7CR22"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR22"
FT                   /protein_id="AAL19410.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLAQARHQYDEVHCVTFDYGQRHRAEIDV
FT                   ARALALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPNADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVNLGMAKDIRFETPLMWI
FT                   DKAETWALADYWGQLDLVREETLTCYNGIKGDGCGHCAACNLRANGLNHYLSNKAAVMA
FT                   AMKQKTGLR"
FT   regulatory      complement(512372..512377)
FT                   /gene="ybaX"
FT                   /locus_tag="STM0455"
FT                   /note="putative RBS for ybaX; RegulonDB:STMS1H000800"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(512432..514142)
FT                   /gene="ybaE"
FT                   /locus_tag="STM0456"
FT   CDS_pept        complement(512432..514132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="STM0456"
FT                   /product="putative ABC transporter periplasmic binding
FT                   protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73548.1); Blastp hit to AAC73548.1 (566 aa), 79%
FT                   identity in aa 1 - 565"
FT                   /db_xref="EnsemblGenomes-Gn:STM0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19411"
FT                   /db_xref="GOA:Q8ZRB7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB7"
FT                   /protein_id="AAL19411.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGETQHVTVSELAERCFCSERHLRTLLR
FT                   QAQQAGWLRWEAQSGRGKRGRLQFLVTPESLRTAMMEQALEKGQQLNVLELAQLAPGEL
FT                   RAMLQPFMGGQWQNDTPTLRIPYYRPLDPLQPGFLPGRAEQHLAGQVFSGLTRFDRDSQ
FT                   YPCGDLAHHWEVSADGLRWDFYIRSTLHWHNGDAVDTAQLHERLERLLTLPALSKLFIS
FT                   VARIEVTHPQCLTFLLHRPDYWLAHRLASYCSGLAHPDLPLIGTGPFRLALFTPELVRL
FT                   ESHDHYHLSHPLLKAIEFWITPQLFAQDLGTSCRHPVQIAIGKPEELATLSQVSSGISL
FT                   GFCYLTLKKGSRLNVQQARRLIHIIHHTSLLKTLPVDENLIMPSQGLLPGWTIPQWQDV
FT                   DETPLPKKLTLAYHLPVELHTMAEQLRHYLATLGCELTLIFHNAKNWDNCPALAQADLM
FT                   MGDRLIGEAPEYTLEQWLRCDQIWSHVLDAPAFSHLQATLDALQIQPNEKDRRAALQQV
FT                   FANLMDDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFSEAWLPPPSP"
FT   regulatory      complement(514137..514142)
FT                   /gene="ybaE"
FT                   /locus_tag="STM0456"
FT                   /note="putative RBS for ybaE; RegulonDB:STMS1H000801"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            514221..515051
FT                   /gene="cof"
FT                   /locus_tag="STM0457"
FT   regulatory      514221..514226
FT                   /gene="cof"
FT                   /locus_tag="STM0457"
FT                   /note="putative RBS for cof; RegulonDB:STMS1H000802"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        514233..515051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="STM0457"
FT                   /product="putative hydrolase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73549.1); Blastp hit to AAC73549.1 (276 aa), 81%
FT                   identity in aa 5 - 276"
FT                   /db_xref="EnsemblGenomes-Gn:STM0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19412"
FT                   /db_xref="GOA:Q8ZRB6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRB6"
FT                   /protein_id="AAL19412.1"
FT                   /translation="MARLAAFDMDGTLLMPDHHLGRETIATLARLRERDITLTFATGRH
FT                   VLEMRHILGTLSLDAYLITGNGTRIHSLEGDVLHRQDLDPQVADTVMHHAWDTRASMHV
FT                   FNDNGWFTGQEIPALLQAHVYSGFRYQVIDIKSIPAHQVTKICFCGDHDDLIRLRIQLN
FT                   EALEERAHLCFSAVDCLEVLPLGCNKGSALAVLSNHLGLSLADCMAFGDAMNDREMLGS
FT                   VGRGLIMGNAMPQLIAALPHLSVIGHCGNQAVSHFLTHWLDNPHLPYSPE"
FT   gene            complement(515101..516161)
FT                   /locus_tag="STM0458"
FT   CDS_pept        complement(515101..516156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0458"
FT                   /product="putative cysteine synthase/cystathionine
FT                   beta-synthase"
FT                   /note="similar to E. coli cysteine synthase B,
FT                   O-acetylserine sulfhydrolase B (AAC75474.1); Blastp hit to
FT                   AAC75474.1 (303 aa), 26% identity in aa 6 - 207, 35%
FT                   identity in aa 198 - 289"
FT                   /db_xref="EnsemblGenomes-Gn:STM0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19413"
FT                   /db_xref="GOA:Q8ZRB5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB5"
FT                   /protein_id="AAL19413.1"
FT                   /translation="MMSSNWVKNAINEINADHQRSADTHLIRLPLSAFPGIQLYLKDES
FT                   THPTGSLKHRLARSLFLYGLCNGWIKEGTPIIEASSGSTAISEAWFARLLGLPFIAVMP
FT                   ACTAKRKIEQIQFYGGHCHFVESACEIYAASERLAHELNGHYMDQFTYAERATDWRGNN
FT                   NIADSIFRQMRNELHPVPRFIVMSAGTGGTSATIGRYIRCQGYDTQLMVVDPENSVFLP
FT                   YWQDRDASLRSPVGSKIEGIGRPRVEPSFIPDVVDEMLRVPDAASVATAHWLETQLGRK
FT                   VGASTGTNMWGALQLAARMREAGETGAIVTLLCDSGDRYLDTYYHPAWVSDHIGDLTPW
FT                   SAAIAKLLTGD"
FT   regulatory      complement(516156..516161)
FT                   /locus_tag="STM0458"
FT                   /note="putative RBS for STM0458; RegulonDB:STMS1H000803"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            516258..516727
FT                   /gene="ybaO"
FT                   /locus_tag="STM0459"
FT   regulatory      516258..516263
FT                   /gene="ybaO"
FT                   /locus_tag="STM0459"
FT                   /note="putative RBS for ybaO; RegulonDB:STMS1H000804"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        516269..516727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="STM0459"
FT                   /product="putative transcriptional regulator (AsnC family)"
FT                   /note="similar to E. coli putative LRP-like transcriptional
FT                   regulator (AAC73550.1); Blastp hit to AAC73550.1 (181 aa),
FT                   95% identity in aa 30 - 181"
FT                   /db_xref="EnsemblGenomes-Gn:STM0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19414"
FT                   /db_xref="GOA:Q7CR21"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR21"
FT                   /protein_id="AAL19414.1"
FT                   /translation="MLDKIDRKLLCLLQQDCTLSLQALADAVNLTTTPCWKRLKRLEDD
FT                   GILLGRVALLDPEKLGLGLTAFVLIKTQHHSSEWYCRFVTVVSEMPEVLGFWRMAGEYD
FT                   YLMRVQVADMKRYDDFYKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
FT   gene            516755..518540
FT                   /gene="mdlA"
FT                   /locus_tag="STM0460"
FT   regulatory      516755..516760
FT                   /gene="mdlA"
FT                   /locus_tag="STM0460"
FT                   /note="putative RBS for mdlA; RegulonDB:STMS1H000805"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        516768..518540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="STM0460"
FT                   /product="putative ABC superfamily (atp) transporter"
FT                   /note="similar to E. coli ATP-binding component of a
FT                   transport system (AAC73551.1); Blastp hit to AAC73551.1
FT                   (590 aa), 88% identity in aa 1 - 590"
FT                   /db_xref="EnsemblGenomes-Gn:STM0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19415"
FT                   /db_xref="GOA:Q8ZRB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB4"
FT                   /protein_id="AAL19415.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLMLIAMLQLIPPKVVGIVVDG
FT                   VTAQQFTPGRIAMWIGTIALIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYQRHRTGDLIARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIVMSTQISWQLTLL
FT                   ALLPMPIMALMIKRYGDRLHDYFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSSL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAISGGSWMVVNGSLTLGELTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVKDGEEPVPAGRGELTAAIR
FT                   EFCYPQTTHPALENVNFRLKPGQMLGICGPTGAGKSTILSLIQRHFDVTQGEIRFHDMP
FT                   LTHLQLDSWRSRLAVVSQTPFLFSDSIANNIALGRPEATQEEIEQVARLASVHEDILRL
FT                   PQGYDTQVGERGVMLSGGQKQRISIARALLLNAEILLLDDALSAVDGRTEHQILHNLRQ
FT                   WGEGRTVIISAHRLSALTDANEIIVMQHGHVVQRGDHDQLAQQIGWYRDMYRYQQLEAA
FT                   LDDAPERGEEAVNA"
FT   gene            518520..520314
FT                   /gene="mdlB"
FT                   /locus_tag="STM0461"
FT   regulatory      518520..518525
FT                   /gene="mdlA"
FT                   /locus_tag="STM0460"
FT                   /note="putative RBS for mdlB; RegulonDB:STMS1H000806"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        518533..520314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="STM0461"
FT                   /product="putative ABC superfamily (atp&membrane)
FT                   transporter"
FT                   /note="similar to E. coli putative ATP-binding component of
FT                   a transport system (AAC73552.1); Blastp hit to AAC73552.1
FT                   (593 aa), 88% identity in aa 1 - 593"
FT                   /db_xref="EnsemblGenomes-Gn:STM0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19416"
FT                   /db_xref="GOA:Q8ZRB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB3"
FT                   /protein_id="AAL19416.1"
FT                   /translation="MRSFGQLWPTLKRLLAYGSPWRKPLSVAVMMLWIAAAAEVSGPLL
FT                   ISYFIDNMVARHHLPLGKVAGLAAAYVGLQFLAAGLHYAQSLLFNRAAVGVVQSLRTDV
FT                   MDAALRQPLSAFDTQPVGQLISRVTNDTEVIRDLYVTVVATVLRSAALIGAMLVAMFSL
FT                   DWRMALVAILIFPAVLTVMIIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSALILCGLLMLFSFTSAGTIEV
FT                   GVLYAFISYLSRLNEPLIELTTQQSMLQQAVVAGERVFELMDRPRQRYGSDDRPLQSGA
FT                   IDIDHLSFAYRDDNLVLQDITLSVPSRSFVALVGHTGSGKSTLASLLMGYYPLTQGEIR
FT                   LDGREIASLNHRVLRQGVAMVQQDPVVMADTFLANVTLGRDVSEAQVWQALETVQLADL
FT                   ARGLSDGLHTHLGEQGNTLSVGQKQLLALARVLVDAPQILILDEATASIDSGTEQAIQQ
FT                   ALAAIRERTTLVVIAHRLSTIVEADTILVLHRGQAVERGTHQQLLAAQGRYWQMYQLQL
FT                   VGEELAASVHEEPGPAA"
FT   gene            520515..520865
FT                   /gene="glnK"
FT                   /locus_tag="STM0462"
FT   regulatory      520515..520520
FT                   /gene="glnK"
FT                   /locus_tag="STM0462"
FT                   /note="putative RBS for glnK; RegulonDB:STMS1H000807"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        520527..520865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="STM0462"
FT                   /product="regulatory protein P-II 2"
FT                   /note="nitrogen assimilation by glutamine synthetase;
FT                   regulates GlnL (NRII) and GlnE (ATase); similar to E. coli
FT                   nitrogen regulatory protein P-II 2 (AAC73553.1); Blastp hit
FT                   to AAC73553.1 (112 aa), 97% identity in aa 1 - 112"
FT                   /db_xref="EnsemblGenomes-Gn:STM0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19417"
FT                   /db_xref="GOA:Q7CR20"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR20"
FT                   /protein_id="AAL19417.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLEEVIDIISKAAYTGKIGDGKIFVAELMRVIRIRT
FT                   GEADEAAL"
FT   gene            520883..522183
FT                   /gene="amtB"
FT                   /locus_tag="STM0463"
FT   regulatory      520883..520888
FT                   /gene="amtB"
FT                   /locus_tag="STM0463"
FT                   /note="putative RBS for amtB; RegulonDB:STMS1H000808"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        520897..522183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="STM0463"
FT                   /product="putative Amt family, ammonium transport protein"
FT                   /note="similar to E. coli probable ammonium transporter
FT                   (AAC73554.1); Blastp hit to AAC73554.1 (428 aa), 92%
FT                   identity in aa 1 - 428"
FT                   /db_xref="EnsemblGenomes-Gn:STM0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19418"
FT                   /db_xref="GOA:Q7CR19"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR19"
FT                   /protein_id="AAL19418.1"
FT                   /translation="MKIAMIKTTLASLALLPGLTIAAPAVADKADSAFMMICTALVLFM
FT                   TIPGIALFYGGLIRAKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNHFFGNADGAM
FT                   LKNIALTAVTGTIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWFTLSYI
FT                   PIAHMVWGGGLLAAHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSAGSANEIAALAFVNTVVATAAAILGWIIGEWTLRGKPSLL
FT                   GACSGAIAGLVGVTPACGYVGVGGALVIGVIAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIVGCILTGVFAASSLGGVGFVDGVTMGHQVMVQLESIAITVVWSGVVAFVGYKLA
FT                   DILVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(522283..523156)
FT                   /gene="tesB"
FT                   /locus_tag="STM0464"
FT   CDS_pept        complement(522283..523143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="STM0464"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.-"
FT                   /note="similar to E. coli acyl-CoA thioesterase II
FT                   (AAC73555.1); Blastp hit to AAC73555.1 (286 aa), 91%
FT                   identity in aa 1 - 286"
FT                   /db_xref="EnsemblGenomes-Gn:STM0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19419"
FT                   /db_xref="GOA:Q8ZRB2"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB2"
FT                   /protein_id="AAL19419.1"
FT                   /translation="MSQTLNNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEARLVHSFHSYFLRPGDSQKPIIYDVEVLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEPGFEHQKTMPTVVGPEGLPSETEIAQSLAHLLPPILKEKFLCDRPLEIRPV
FT                   EFHNPLKGHVAAPVRQVWIRANGTVPDDIRVHQYLLGYASDLNFLPVALQPHGIGFLEK
FT                   GIQIATIDHSMWFHRPFNFNEWLLYSVESTSASSARGFVRGEFYTQDGALVASTVQEGV
FT                   MRNHN"
FT   regulatory      complement(523151..523156)
FT                   /gene="tesB"
FT                   /locus_tag="STM0464"
FT                   /note="putative RBS for tesB; RegulonDB:STMS1H000809"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            523346..523927
FT                   /gene="ybaY"
FT                   /locus_tag="STM0465"
FT   regulatory      523346..523351
FT                   /gene="ybaY"
FT                   /locus_tag="STM0465"
FT                   /note="putative RBS for ybaY; RegulonDB:STMS1H000810"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        523358..523927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="STM0465"
FT                   /product="glycoprotein/polysaccharide metabolism"
FT                   /note="similar to E. coli glycoprotein/polysaccharide
FT                   metabolism (AAC73556.1); Blastp hit to AAC73556.1 (190 aa),
FT                   88% identity in aa 1 - 190"
FT                   /db_xref="EnsemblGenomes-Gn:STM0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19420"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB1"
FT                   /protein_id="AAL19420.1"
FT                   /translation="MKLVHIVSGLAVAISLAACADKSADIQTPAPNPNMSITANQSTIQ
FT                   QPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLSQKAVRTEGKQAPFSFVLPF
FT                   NPSDIQPNARILLSAAITVDNKLVFITDSVKPVINNGGTKADLTLVPVQQTAVPVQASG
FT                   GATTTVPSTSPTQVNSSSAVPAPTQY"
FT   gene            complement(523960..524359)
FT                   /gene="ybaZ"
FT                   /locus_tag="STM0466"
FT   CDS_pept        complement(523960..524349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="STM0466"
FT                   /product="putative methyltransferase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73557.1); Blastp hit to AAC73557.1 (129 aa), 82%
FT                   identity in aa 1 - 129"
FT                   /db_xref="EnsemblGenomes-Gn:STM0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19421"
FT                   /db_xref="GOA:Q7CR18"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR18"
FT                   /protein_id="AAL19421.1"
FT                   /translation="MLVSCASGLSSPLIPDYPEALTQDSIMDIQDTFPQRVWQIVASIP
FT                   EGFVTTYGDVARLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGAISLTGPDLQRQR
FT                   QALLAEGVVVSGSGQIDLQRYRWVY"
FT   regulatory      complement(524354..524359)
FT                   /gene="ybaZ"
FT                   /locus_tag="STM0466"
FT                   /note="putative RBS for ybaZ; RegulonDB:STMS1H000811"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            524427..524542
FT                   /gene="ffs"
FT                   /locus_tag="STM0467"
FT   ncRNA           524427..524542
FT                   /gene="ffs"
FT                   /locus_tag="STM0467"
FT                   /product="signal recognition particle, RNA component"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(524580..526142)
FT                   /gene="ylaB"
FT                   /locus_tag="STM0468"
FT   CDS_pept        complement(524580..526130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="STM0468"
FT                   /product="putative diguanylate cyclase/phosphodiesterase
FT                   domain 2"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73559.1); Blastp hit to AAC73559.1 (518 aa), 67%
FT                   identity in aa 3 - 518"
FT                   /db_xref="EnsemblGenomes-Gn:STM0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19422"
FT                   /db_xref="GOA:Q8ZRB0"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB0"
FT                   /protein_id="AAL19422.1"
FT                   /translation="MTTRHLVSLVTGVLILSVLFPIGLSLWLAHRQVEKRFNEELDIFS
FT                   SRVALRTERVSDQAKAALTHIASFKGEPCSSAHLLAMRRVSYSFRYVQEVLYLKNSIPV
FT                   CSSLEKESHIPAFPPPMKITRDGYRAWFTAQNDLGIKRYMAALGSDSYIVMIDPASFID
FT                   VIPFGAWPIDVAIIGRERNTVVASSGNLDPAILPLIHHETPLRLENRGIQYAIHPFPEM
FT                   GITIVSWAPTAPLERSWYRQAFIWLPAGIVTGLLAAAFILRILRRLQSPRHRLQDAIDN
FT                   REINVHYQPIVSLSSGKIVGAEALARWQQADGTFLSPEIFIALAEQTGLTEPLTRLIID
FT                   TVFEDMGSWLKSHPEQHISINLEASDLASETLPTLLSTLLNRSQISPSQIALELTEREF
FT                   ADPKTSAPIVARYRNAGHSIYIDDFGTGYSSLSYLQNLDVDVLKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETARQEQWLRQHGVHYGQGWLYSKPLPATAFILWAEQRL"
FT   regulatory      complement(526137..526142)
FT                   /gene="ylaB"
FT                   /locus_tag="STM0468"
FT                   /note="putative RBS for ylaB; RegulonDB:STMS1H000812"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            526346..526615
FT                   /gene="rpmE2"
FT                   /locus_tag="STM0469"
FT   regulatory      526346..526351
FT                   /gene="rpmE2"
FT                   /locus_tag="STM0469"
FT                   /note="putative RBS for rpmE2; RegulonDB:STMS1H000813"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        526355..526615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE2"
FT                   /locus_tag="STM0469"
FT                   /product="putative 50S ribosomal protein L31 (second copy)"
FT                   /note="similar to E. coli putative ribosomal protein
FT                   (AAC73399.1); Blastp hit to AAC73399.1 (87 aa), 74%
FT                   identity in aa 1 - 86"
FT                   /db_xref="EnsemblGenomes-Gn:STM0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19423"
FT                   /db_xref="GOA:P66193"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66193"
FT                   /protein_id="AAL19423.1"
FT                   /translation="MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGRQKTFDSESSAARFQKRFGHFIGAKRG"
FT   gene            526616..526761
FT                   /gene="rpmJ2"
FT                   /locus_tag="STM0470"
FT   regulatory      526616..526621
FT                   /gene="rpmJ2"
FT                   /locus_tag="STM0470"
FT                   /note="putative RBS for rpmJ2; RegulonDB:STMS1H000814"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        526621..526761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ2"
FT                   /locus_tag="STM0470"
FT                   /product="putative 50S ribosomal protein L36 (second copy)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19424"
FT                   /db_xref="GOA:P66296"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66296"
FT                   /protein_id="AAL19424.1"
FT                   /translation="MQVLNSLRNAKQRHPDCQIVKRKGRLYVICKTNPRFKAVQGRKKR
FT                   R"
FT   gene            complement(526817..527297)
FT                   /gene="ylaC"
FT                   /locus_tag="STM0471"
FT   CDS_pept        complement(526817..527287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="STM0471"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73560.1); Blastp hit to AAC73560.1 (169 aa), 80%
FT                   identity in aa 14 - 168"
FT                   /db_xref="EnsemblGenomes-Gn:STM0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19425"
FT                   /db_xref="GOA:Q8ZRA9"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA9"
FT                   /protein_id="AAL19425.1"
FT                   /translation="MTEIQRLLSETIDDLNIREKRDNRPRFSISFIRKHPGLFIAMYAA
FT                   WFATLAVMLQSETLVGSVWLLVVLFIAFNGFFFFDIAPRYHYNDIDVLDLRVCYNGEWY
FT                   NTRFVPPTLIETILQSPQVDNEHKVQLQKMVARKGELSFYDIFTLARAEASR"
FT   regulatory      complement(527292..527297)
FT                   /gene="ylaC"
FT                   /locus_tag="STM0471"
FT                   /note="putative RBS for ylaC; RegulonDB:STMS1H000815"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(527404..527969)
FT                   /gene="maa"
FT                   /locus_tag="STM0472"
FT   CDS_pept        complement(527404..527955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="STM0472"
FT                   /product="maltose o-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="similar to E. coli putative transferase
FT                   (AAC73561.1); Blastp hit to AAC73561.1 (183 aa), 79%
FT                   identity in aa 1 - 183"
FT                   /db_xref="EnsemblGenomes-Gn:STM0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19426"
FT                   /db_xref="GOA:Q8ZRA8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA8"
FT                   /protein_id="AAL19426.1"
FT                   /translation="MSDEKQKMIAGALYCPTDETLCQDRLRARQLIHQYNYTTPDEINK
FT                   RQAILRDLLGRCEDAYIEPSFRCDYGYNIFLGHSFYANFDCVMLDVCPIHIGDNCMLAP
FT                   GVHIYTATHPLDAVERNSGRELGKPVTIGNNVWIGGRAVVNPGVTIGDNVVVASGAVVI
FT                   KNVPPDVVVGGNPARIIKKL"
FT   regulatory      complement(527964..527969)
FT                   /gene="maa"
FT                   /locus_tag="STM0472"
FT                   /note="putative RBS for maa; RegulonDB:STMS1H000816"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(528134..528364)
FT                   /gene="hha"
FT                   /locus_tag="STM0473"
FT   CDS_pept        complement(528134..528352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="STM0473"
FT                   /product="hemolysin expression modulating protein (involved
FT                   in environmental regulation of virulence factors)"
FT                   /note="similar to E. coli haemolysin expression modulating
FT                   protein (AAC73562.1); Blastp hit to AAC73562.1 (72 aa), 98%
FT                   identity in aa 1 - 72"
FT                   /db_xref="EnsemblGenomes-Gn:STM0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19427"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="PDB:4ICG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR17"
FT                   /protein_id="AAL19427.1"
FT                   /translation="MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   regulatory      complement(528359..528364)
FT                   /gene="hha"
FT                   /locus_tag="STM0473"
FT                   /note="putative RBS for hha; RegulonDB:STMS1H000817"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(528380..528767)
FT                   /gene="ybaJ"
FT                   /locus_tag="STM0474"
FT   CDS_pept        complement(528380..528754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="STM0474"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73563.1); Blastp hit to AAC73563.1 (124 aa), 95%
FT                   identity in aa 1 - 124"
FT                   /db_xref="EnsemblGenomes-Gn:STM0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19428"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR16"
FT                   /protein_id="AAL19428.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYLDDTFMLFSSYGINTQDLQKWRKSG
FT                   NRLFRCFVNATRANPVSLSC"
FT   regulatory      complement(528762..528767)
FT                   /gene="ybaJ"
FT                   /locus_tag="STM0474"
FT                   /note="putative RBS for ybaJ; RegulonDB:STMS1H000818"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(529250..532415)
FT                   /gene="acrB"
FT                   /locus_tag="STM0475"
FT   CDS_pept        complement(529250..532399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="STM0475"
FT                   /product="RND family, acridine efflux pump"
FT                   /note="similar to E. coli acridine efflux pump
FT                   (AAC73564.1); Blastp hit to AAC73564.1 (1049 aa), 94%
FT                   identity in aa 1 - 1048"
FT                   /db_xref="EnsemblGenomes-Gn:STM0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19429"
FT                   /db_xref="GOA:Q8ZRA7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA7"
FT                   /protein_id="AAL19429.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SATYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DPISRTSGVGDVQLFGSQYAMRIWMNPTELTKYQLTPVDVINAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTDEFGKILLKVNQDGSQVRLRDVAKIELGGENYDVIAKF
FT                   NGQPASGLGIKLATGANALDTATAIRAELKKMEPFFPPGMKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMTEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFIPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPVAKGDHGEGKKGFFGWFN
FT                   RLFDKSTHHYTDSVGNILRSTGRYLLLYLIIVVGMAYLFVRLPSSFLPDEDQGVFLTMV
FT                   QLPAGATQERTQKVLDEVTDYYLNKEKANVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEKNKVEAITQRATAAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLFGEVAKYPDLLVGVRPNGLEDTPQFKIDIDQEKAQALGVSISDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDINDWYVRGSDGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMAMMEELASKLPSGIGYDWTGMSYQERLSGN
FT                   QAPALYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLVEATLEAVRMRLRPILMTSLAFMLGVMPL
FT                   VISSGAGSGAQNAVGTGVLGGMVTATVLAIFFVPVFFVVVRRRFSRKSEDIEHSHSTEH
FT                   R"
FT   regulatory      complement(532410..532415)
FT                   /gene="acrB"
FT                   /locus_tag="STM0475"
FT                   /note="putative RBS for acrB; RegulonDB:STMS1H000819"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(532422..533626)
FT                   /gene="acrA"
FT                   /locus_tag="STM0476"
FT   CDS_pept        complement(532422..533615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="STM0476"
FT                   /product="acridine efflux pump"
FT                   /note="similar to E. coli acridine efflux pump
FT                   (AAC73565.1); Blastp hit to AAC73565.1 (397 aa), 91%
FT                   identity in aa 1 - 397"
FT                   /db_xref="EnsemblGenomes-Gn:STM0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19430"
FT                   /db_xref="GOA:Q8ZRA6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA6"
FT                   /protein_id="AAL19430.1"
FT                   /translation="MNKNRGLTPLAVVLMLSGSLALTGCDDKQDQQGGQQMPEVGVVTL
FT                   KTEPLQITTELPGRTVAYRIAEVRPQVSGIILKRNFVEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAELTVKRYQKLLGTQYISKQEYDQALADAQQATAAVVAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSSVTEGALVQNGQASALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGSLKQENGKAKVDLVTSDGIKFPQSGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLQEGTKPTALLVPQQGVTRTPRGDATVLVVGADNKVETRQIVAS
FT                   QAIGDKWLVTDGLKAGDRVVVSGLQKVRPGAQVKVQEITADNKQQAASGDQPAQPRS"
FT   regulatory      complement(533621..533626)
FT                   /gene="acrA"
FT                   /locus_tag="STM0476"
FT                   /note="putative RBS for acrA; RegulonDB:STMS1H000820"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            533757..534410
FT                   /gene="acrR"
FT                   /locus_tag="STM0477"
FT   CDS_pept        533757..534410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="STM0477"
FT                   /product="acrAB operon repressor (TetR/AcrR family)"
FT                   /note="similar to E. coli acrAB operon repressor
FT                   (AAC73566.1); Blastp hit to AAC73566.1 (215 aa), 87%
FT                   identity in aa 1 - 214"
FT                   /db_xref="EnsemblGenomes-Gn:STM0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19431"
FT                   /db_xref="GOA:Q7CR15"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:3LHQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR15"
FT                   /protein_id="AAL19431.1"
FT                   /translation="MARKTKQQALETRQHILDVALRLFSQQGVSATSLAEIANAAGVTR
FT                   GAIYWHFKNKSDLFSEIWELSESNIGELEIEYQAKFPDDPLSVLREILVHILEATVTEE
FT                   RRRLLMEIIFHKCEFVGEMVVVQQAQRSLCLESYDRIEQTLKHCINAKMLPENLLTRRA
FT                   AILMRSFISGLMENWLFAPQSFDLKKEARAYVTILLEMYQLCPTLRASTVNGSP"
FT   gene            534529..537891
FT                   /gene="aefA"
FT                   /locus_tag="STM0478"
FT   CDS_pept        534529..537891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aefA"
FT                   /locus_tag="STM0478"
FT                   /product="putative small-conductance mechanosensitive
FT                   channel"
FT                   /note="similar to E. coli putative alpha helix protein
FT                   (AAC73567.1); Blastp hit to AAC73567.1 (1120 aa), 89%
FT                   identity in aa 1 - 1117"
FT                   /db_xref="EnsemblGenomes-Gn:STM0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19432"
FT                   /db_xref="GOA:Q8ZRA5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA5"
FT                   /protein_id="AAL19432.1"
FT                   /translation="MTMLQLYKRSQHFVFITISVLIILLSCQSLAFARGQTNGDLPSKA
FT                   DVQNQLDTLNKQKDLSAQDKLVQQDLIDTLATLEKIERVKEETVQLRQKVAQAPEKMRQ
FT                   ATAALNALSDVDNDDEMRKTLSALSLRQLELRVAQVLDDLQNSQNDLAAYNSQLVSLQT
FT                   QPERVQNAMYTASQQIQQIRNRLDGNNVGEAALRPSQQVLLQAQQALLNAQIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSNRLEHQLQLLQEAVNSKRLTLTEKTAQEAISPDETARI
FT                   QANPLVKQELDINHQLSQRLIVATENGNMLMQQNIKVKNWLDRALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELEDMTNRIADLRLEQFEINQQRDALFQSDAFVDKLEEG
FT                   HTSEVNDEVHDALLQVVEMRRELLDQLNKQLGNQLMMAINLQVNQQQLMSVSKNLKAIL
FT                   TQQIFWVNSNRPMDWDWLKAFPQTLKEQFSAMKITVNWQKAWPAVFIAFLAGLPLLLIA
FT                   GLIRWRLKWLKAYQQKLAAAVGSLRNDSQLNTPKAILIDLIRALPVCLIILALGLILLT
FT                   MQLNISDLLWAFSKKLAMFWLVFGLCWKVLEKEGVAIRHFGMPAQLTSHWRRQIVRISL
FT                   ALLPLHFWSVVAELSPLNLMDDVLGQAVIFLNLLVITLLVWPLCRESWRDKESHGIRLV
FT                   TVTILSIIPVALMVLTATGYFYTTLRLAGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPQEEPTIALEQINQQTLRITMLLMLALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGSEAGAAVVKSVTMGSLLFAIIAAMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYVIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGTYSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLSDTTTRLVIRLGVAYGSDLEKVKRVLLQAAMEHPKVMHDPEPAVFFTTFGAS
FT                   TLDHELRLYVRELRDRSHTVDELNRAIDRLCRENDINIAFNQLEVHLHNAKGDEVTEVK
FT                   RDLNGGDLAPTAS"
FT   gene            complement(537933..538874)
FT                   /locus_tag="STM0479"
FT   CDS_pept        complement(537933..538868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0479"
FT                   /product="putative transposase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC75365.1); Blastp hit to AAC75365.1 (296 aa), 49%
FT                   identity in aa 7 - 296"
FT                   /db_xref="EnsemblGenomes-Gn:STM0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19433"
FT                   /db_xref="GOA:Q8ZRA4"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA4"
FT                   /protein_id="AAL19433.1"
FT                   /translation="MERLPTTPHDAVFRQMLMQKEVARDFLAIHMPEDFLAICDLDSLK
FT                   LESGSFVEDNLRSRYSDILYSLHTQHGPGYVYALIEHQSKSDRLMAFRLMRYAIAAMQR
FT                   HLDAGHDTLPLVVPILFYHGPESPWPYSLNWHNMFVKPDMAKALYSRDFALVDLTTMPD
FT                   NQLLQHRRIAMLELLQKHIRQRDLSELLDPLITLLTQDHLTDAQLSVLINYMLKAGNAA
FT                   EPGALIRQLAQGAPQYKEQLMTIAEWLEEKGRTEGLQKGLQKGLEQGLAQGREAEARAI
FT                   ARKMLANGLEPGLIASVTGITPEELSTLSH"
FT   regulatory      complement(538869..538874)
FT                   /locus_tag="STM0479"
FT                   /note="putative RBS for STM0479; RegulonDB:STMS1H000821"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(538938..539116)
FT                   /gene="ybaM"
FT                   /locus_tag="STM0480"
FT   CDS_pept        complement(538938..539105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="STM0480"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73568.1); Blastp hit to AAC73568.1 (53 aa), 80%
FT                   identity in aa 1 - 49"
FT                   /db_xref="EnsemblGenomes-Gn:STM0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19434"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR14"
FT                   /protein_id="AAL19434.1"
FT                   /translation="MSLENAPDEVKLAVDLIVLLEENRLPARTVLRALEIVMRDYENKL
FT                   KSTEDDSQTE"
FT   regulatory      complement(539111..539116)
FT                   /gene="ybaM"
FT                   /locus_tag="STM0480"
FT                   /note="putative RBS for ybaM; RegulonDB:STMS1H000822"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(539119..539634)
FT                   /gene="priC"
FT                   /locus_tag="STM0481"
FT   CDS_pept        complement(539119..539634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="STM0481"
FT                   /product="primosomal replication protein N"
FT                   /note="similar to E. coli primosomal replication protein
FT                   N'' (AAC73569.1); Blastp hit to AAC73569.1 (175 aa), 73%
FT                   identity in aa 5 - 175"
FT                   /db_xref="EnsemblGenomes-Gn:STM0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19435"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA3"
FT                   /protein_id="AAL19435.1"
FT                   /translation="MLLQTLEERLATLRQRCAPLAQHATLSARFDRHLFRTRSTLLQGY
FT                   LEEAGANLVALRQAVKHEQLPQVAWLAEHLASQLEAISRETAAWSLRQWDAAAPGLGRW
FT                   QRRRIQHQEFERRLLAMTQERKIRLAQATGLVEQQTLQKEVEIYEGRLARCRHALEKIE
FT                   NVLARLTR"
FT   gene            539715..540092
FT                   /gene="ybaN"
FT                   /locus_tag="STM0482"
FT   CDS_pept        539715..540092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="STM0482"
FT                   /product="putative phage gene 58"
FT                   /note="similar to E. coli putative gene 58 (AAC73570.1);
FT                   Blastp hit to AAC73570.1 (125 aa), 84% identity in aa 1 -
FT                   124"
FT                   /db_xref="EnsemblGenomes-Gn:STM0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19436"
FT                   /db_xref="GOA:Q7CR13"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR13"
FT                   /protein_id="AAL19436.1"
FT                   /translation="MQRTILIIIGWLAVVLGTLGVVLPLLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGGYLRHWQRYRAMPPGAKPRAIALILLTFGISLWLVNMMWVRVLLLVI
FT                   LACLLIFMWRIPVIDEKQQKR"
FT   gene            540232..540796
FT                   /gene="apt"
FT                   /locus_tag="STM0483"
FT   regulatory      540232..540237
FT                   /gene="apt"
FT                   /locus_tag="STM0483"
FT                   /note="putative RBS for apt; RegulonDB:STMS1H000823"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        540245..540796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="STM0483"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="similar to E. coli adenine phosphoribosyltransferase
FT                   (AAC73571.1); Blastp hit to AAC73571.1 (183 aa), 95%
FT                   identity in aa 1 - 183"
FT                   /db_xref="EnsemblGenomes-Gn:STM0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19437"
FT                   /db_xref="GOA:Q8ZRA2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRA2"
FT                   /protein_id="AAL19437.1"
FT                   /translation="MTATAQQLEFLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   ELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
FT                   GTDQLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFIINLFDLGG
FT                   EQRLEKQGITCYSLVPFPGH"
FT   gene            540910..542838
FT                   /gene="dnaX"
FT                   /locus_tag="STM0484"
FT   CDS_pept        540910..542838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="STM0484"
FT                   /product="DNA polymerase III, tau and gamma subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA elongation factor III; DNA polymerase III
FT                   subunit TAU [contains: DNA polymerase III subunit gamma].
FT                   (SW:DP3X_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19438"
FT                   /db_xref="GOA:P74876"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P74876"
FT                   /protein_id="AAL19438.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAVVDANGERVMSLINEAAARGIEWEAL
FT                   LVEMLSLLHRIAMVQLSPAALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLIGRKELP
FT                   WAPDRRMGVEMTLLRALAFHPRMPLPEPETPRQSFAPVAPTAVMTPPQLQQPSAPAPQT
FT                   SPAPLPASTSQVLAARNQLQRAQGVTKTKKSEPAAASRARPVNNSALERLASVSERVQA
FT                   RPAPSALETAPVKKEAYRWKATTPVVQTKEVVATPKALKKALEHEKTPELAAKLAAEAI
FT                   ERDPWAAQVSQLSLPKLVEQVALNAWKEQNGNAVCLHLRSTQRHLNSSGAQQKLAQALS
FT                   DLTGTTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELD
FT                   EESIRPI"
FT   gene            542874..543213
FT                   /gene="ybaB"
FT                   /locus_tag="STM0485"
FT   regulatory      542874..542879
FT                   /gene="ybaB"
FT                   /locus_tag="STM0485"
FT                   /note="putative RBS for ybaB; RegulonDB:STMS1H000825"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        542884..543213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="STM0485"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73573.1); Blastp hit to AAC73573.1 (109 aa), 100%
FT                   identity in aa 1 - 109"
FT                   /db_xref="EnsemblGenomes-Gn:STM0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19439"
FT                   /db_xref="GOA:P0A8B8"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8B8"
FT                   /protein_id="AAL19439.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   gene            543199..543818
FT                   /gene="recR"
FT                   /locus_tag="STM0486"
FT   regulatory      543199..543204
FT                   /gene="ybaB"
FT                   /locus_tag="STM0485"
FT                   /note="putative RBS for recR; RegulonDB:STMS1H000826"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        543213..543818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="STM0486"
FT                   /product="putative recombination protein, gap repair"
FT                   /note="similar to E. coli recombination and repair
FT                   (AAC73574.1); Blastp hit to AAC73574.1 (201 aa), 96%
FT                   identity in aa 1 - 201"
FT                   /db_xref="EnsemblGenomes-Gn:STM0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19440"
FT                   /db_xref="GOA:P65992"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65992"
FT                   /protein_id="AAL19440.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAE
FT                   AGVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIIF"
FT   gene            543905..545803
FT                   /gene="htpG"
FT                   /locus_tag="STM0487"
FT   CDS_pept        543905..545803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="STM0487"
FT                   /product="chaperone Hsp90, heat shock protein C 62.5"
FT                   /note="similar to E. coli chaperone Hsp90, heat shock
FT                   protein C 62.5 (AAC73575.1); Blastp hit to AAC73575.1 (624
FT                   aa), 94% identity in aa 1 - 624"
FT                   /db_xref="EnsemblGenomes-Gn:STM0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19441"
FT                   /db_xref="GOA:P58480"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58480"
FT                   /protein_id="AAL19441.1"
FT                   /translation="MALLRSIHMKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELIS
FT                   NASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTIADNGVGMNRDEVIDHLGT
FT                   IAKSGTKSFLESMGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWE
FT                   SAGEGEYTVADITKNDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKRE
FT                   EKDGETVISWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQE
FT                   YTSLLYIPSQAPWDLWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPL
FT                   NVSREILQDSTVTRNLRSALTKRVLQMLEKLAKDDAEKYQTFWKQFGLVLKEGPAEDHA
FT                   NQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKNSPHLELL
FT                   RKKGIEVLLLSDRIDEWMMNYLTEFDGKAFQSVAKADESIEKLADEVDENAKEAEKALE
FT                   PFVERVKTLLGDRVKDVRLTHRLTDTPAIVTTDADEMSTQMAKLFAAAGQSVPEVKYIF
FT                   ELNPDHVLVKRTADTKDEAQFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS"
FT   gene            546029..546688
FT                   /gene="adk"
FT                   /locus_tag="STM0488"
FT   regulatory      546029..546034
FT                   /gene="adk"
FT                   /locus_tag="STM0488"
FT                   /note="putative RBS for adk; RegulonDB:STMS1H000827"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        546044..546688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="STM0488"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="adenylate kinase. (SW:KAD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19442"
FT                   /db_xref="GOA:P0A1V4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1V4"
FT                   /protein_id="AAL19442.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGIVVD
FT                   YVLEFDVPDELIVDRIVGRRVHAASGRVYHVKFNPPKVEGKDDVTGEDLTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYQKEAEAGNTKYAKVDGTQAVADVRAALEKILG"
FT   gene            546908..547879
FT                   /gene="hemH"
FT                   /locus_tag="STM0489"
FT   regulatory      546908..546913
FT                   /gene="hemH"
FT                   /locus_tag="STM0489"
FT                   /note="putative RBS for hemH; RegulonDB:STMS1H000828"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        546917..547879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="STM0489"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="ferrochelatase. (SW:HEMZ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19443"
FT                   /db_xref="GOA:P37408"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37408"
FT                   /protein_id="AAL19443.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTPRLLW
FT                   WPLLRGVILPLRSPRVAKLYQSIWMDGGSPLMVYSREQQQALAARLPDTPVALGMSYGS
FT                   PSLESAVDELLASDVDHIVVLPLYPQYSCSTVGAVWDELGRILARKRRIPGISFIRDYA
FT                   DDGAYIDALAKSARESFARHGEPDVLLLSYHGIPQRYADEGDDYPQRCRDTTRELVSAL
FT                   GLPPEKVMMTFQSRFGREPWLTPYTDETLKMLGEKGTGHIQVMCPGFAADCLETLEEIA
FT                   EQNREIFLEAGGKKYAYIPALNATPEHIDMMLKLTAPYR"
FT   gene            complement(547876..548859)
FT                   /gene="aes"
FT                   /locus_tag="STM0490"
FT   CDS_pept        complement(547876..548847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="STM0490"
FT                   /product="acetyl esterase"
FT                   /EC_number="3.1.1.-"
FT                   /note="similar to E. coli putative lipase (AAC73578.1);
FT                   Blastp hit to AAC73578.1 (319 aa), 75% identity in aa 1 -
FT                   319"
FT                   /db_xref="EnsemblGenomes-Gn:STM0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19444"
FT                   /db_xref="GOA:Q8ZRA1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="PDB:3GA7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRA1"
FT                   /protein_id="AAL19444.1"
FT                   /translation="MKPENKIPVLTRLSDEMTAVVNFQQPGLPPWPADGDIETQRQYYL
FT                   LERRFWNADAPSMTTRTCAVPTPYGDVTTRLYSPQPTSQATLYYLHGGGFILGNLDTHD
FT                   RIMRLLARYTGCTVIGIDYSLSPQARYPQAIEETVAVCSYFSQHADEYSLNVEKIGFAG
FT                   DSAGAMLALASALWLRDKHIRCGNVIAILLWYGLYGLQDSVSRRLFGGAWDGLTREDLD
FT                   MYEKAYLRNDEDRESPWYCLFNNDLTRDVPPCFIASAEFDPLIDDSRLLHQTLQAHQQP
FT                   CEYKMYPGTLHAFLHYSRMMTIADDALQDGARFFMARMKTPR"
FT   regulatory      complement(548854..548859)
FT                   /gene="aes"
FT                   /locus_tag="STM0490"
FT                   /note="putative RBS for aes; RegulonDB:STMS1H000829"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            549000..550304
FT                   /gene="gsk"
FT                   /locus_tag="STM0491"
FT   CDS_pept        549000..550304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="STM0491"
FT                   /product="inosine-guanosine kinase"
FT                   /EC_number="2.7.1.73"
FT                   /note="similar to E. coli inosine-guanosine kinase
FT                   (AAC73579.1); Blastp hit to AAC73579.1 (434 aa), 94%
FT                   identity in aa 1 - 434"
FT                   /db_xref="EnsemblGenomes-Gn:STM0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19445"
FT                   /db_xref="GOA:Q8ZRA0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA0"
FT                   /protein_id="AAL19445.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQIQPEQETNASWVVGIDQTLVD
FT                   IEAKVDDDFITRYGLSAGHSLVIEDEVAEKLYQELTRENLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQAVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEAVIAGASALVLTSYLVRCKPGEPMPDATMKAIEYAKKHNVP
FT                   VVMTLGTKFVIADNPQWWQAFLKENVSILAMNEEEAEALTGENDPLLAADKALDWVDLV
FT                   LCTAGPIGLYMAGFTEEEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCINPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   gene            complement(550353..552040)
FT                   /gene="ybaL"
FT                   /locus_tag="STM0492"
FT   CDS_pept        complement(550353..552029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="STM0492"
FT                   /product="putative CPA2 family transport protein"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC73580.1); Blastp hit to AAC73580.1 (558 aa), 94%
FT                   identity in aa 1 - 556"
FT                   /db_xref="EnsemblGenomes-Gn:STM0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19446"
FT                   /db_xref="GOA:Q8ZR99"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR99"
FT                   /protein_id="AAL19446.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMIANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAVAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLLDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMVEKGDVGIASLTVDMGITIGKVVAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLVLIQQPLAVLATLAIIVFGKSIAAFFLVRLFGHSPRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFTLLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGFGRVGSLLGEKLLAAGIPLVVIETSRTRVDELRE
FT                   RGIRAVLGNAANEEIMNLAHLDCARWLLLTIPNGYEAGEIVASARGKSPDIEIIARAHY
FT                   DDEVKYITERGANQVVMGEREIARAMLELLETPPAGEVVAS"
FT   regulatory      complement(552035..552040)
FT                   /gene="ybaL"
FT                   /locus_tag="STM0492"
FT                   /note="putative RBS for ybaL; RegulonDB:STMS1H000830"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(552244..553464)
FT                   /gene="fsr"
FT                   /locus_tag="STM0493"
FT   CDS_pept        complement(552244..553464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="STM0493"
FT                   /product="putative MFS family of transport protein"
FT                   /note="similar to E. coli fosmidomycin resistance protein
FT                   (AAC73581.1); Blastp hit to AAC73581.1 (406 aa), 93%
FT                   identity in aa 1 - 405"
FT                   /db_xref="EnsemblGenomes-Gn:STM0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19447"
FT                   /db_xref="GOA:Q8ZR98"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR98"
FT                   /protein_id="AAL19447.1"
FT                   /translation="MAMSEPTQPLAGAPAAAAKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQAEFSLTFVQIGLITLTFQLASSLLQPVVGYWTDKYPMPWSLPVGMCFTLSGL
FT                   VLLAMAGSFGGVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYAAQHRIAKGKPKAIIANPLPR
FT                   NKVVLAVSVLLLLIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLVLPYATLYWTGILTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIYLVYKICAFLPLLGILTIFL
FT                   PDNRHKA"
FT   gene            553624..555289
FT                   /gene="ushA"
FT                   /locus_tag="STM0494"
FT   regulatory      553624..553629
FT                   /gene="ushA"
FT                   /locus_tag="STM0494"
FT                   /note="putative RBS for ushA; RegulonDB:STMS1H000831"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        553637..555289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="STM0494"
FT                   /product="UDP-sugar hydrolase 5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.6.1.45"
FT                   /note="silent protein USHA(0) precursor. (SW:USHA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19448"
FT                   /db_xref="GOA:P06196"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06196"
FT                   /protein_id="AAL19448.1"
FT                   /translation="MKFLKRGVALALLAAFALTTQPAQAYEKDKTYKITILHTNDHHGH
FT                   FWRSEYGEYGLAAQKTLVDSIRKEVAQEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLIGYDAMAVGNHEFDNPLTVLRQQEKWAKFPFLYANIYQKSTGERLFKPWAIFTRQDI
FT                   KIAVIGLTTDDTAKIGNPEYFTDIEFRKPAEEAKVVIQELNMNEKPDVIIATTHMGHYD
FT                   NGDHGSNAPGDVEMARSLPAGSLAMIVGGHSQDPVCMASENKKQVNYVPGTPCAPDKQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWDNGKSERVLYTPEIA
FT                   ENPQMLSLLTPFQNKGKAQLEVKIGSVNGLLEGDRSKVRFVQTNMGRVILAAQIARTGA
FT                   DFGVMSGGGIRDSIEAGDITYKSVLKVQPFGNIVVYADMSGKEVVDYLTAVAQMKPDSG
FT                   AYPQLANVSFVAKEGKLTDLKIKGEPVDPAKTYRMATLSFNATGGDGYPRIDNKPGYVN
FT                   TGFIDAEVLKEFIQQNSPLDAAAFTPNGEVSWL"
FT   gene            complement(555406..555895)
FT                   /gene="ybaK"
FT                   /locus_tag="STM0495"
FT   CDS_pept        complement(555406..555885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="STM0495"
FT                   /product="putative cytoplasmic protein"
FT                   /note="protein YBAK. (SW:YBAK_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19449"
FT                   /db_xref="GOA:P37174"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37174"
FT                   /protein_id="AAL19449.1"
FT                   /translation="MTPAVKLLEKNKIPFNIHTYDHDPNETNFGDEVVRKLGLNADQVY
FT                   KTLLVAVNGDMKQLAVAVTPVAGQLDLKKVAKALGAKKVDMADPMVAQRTTGYLVGGIS
FT                   PLGQKKRLPTLIDAPARTFATIYVSGGKRGLDIELAADDLAAILGAKFADIARRD"
FT   regulatory      complement(555890..555895)
FT                   /gene="ybaK"
FT                   /locus_tag="STM0495"
FT                   /note="putative RBS for ybaK; RegulonDB:STMS1H000832"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(556087..556893)
FT                   /gene="ybaP"
FT                   /locus_tag="STM0496"
FT   CDS_pept        complement(556087..556881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="STM0496"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli putative ligase (AAC73584.1);
FT                   Blastp hit to AAC73584.1 (264 aa), 66% identity in aa 1 -
FT                   264"
FT                   /db_xref="EnsemblGenomes-Gn:STM0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19450"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR97"
FT                   /protein_id="AAL19450.1"
FT                   /translation="MELLNQLKRLWRALRGTPNSWPAIDLSLPGGRHLHLVGSIHMGTR
FT                   DMAPLPAKLVKKLHQADALVVEADISGNETPFSNLPKCPPLVERLSAGQLSALEKRVSE
FT                   LGMPLIHFDNQPLWQIAMVLQATQAQRLGLRPDYGIDYQLLQAAREMSLPVQELEGAKH
FT                   QLELLCDLPDGGMALLDDTLTHWHTNARLLQVMIGWWLEQPPTSVGASLPRTFSQPLYD
FT                   VLMVKRNEAWRDALLALPPGRYVVAVGALHLYGEGNLPQILK"
FT   regulatory      complement(556888..556893)
FT                   /gene="ybaP"
FT                   /locus_tag="STM0496"
FT                   /note="putative RBS for ybaP; RegulonDB:STMS1H000833"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(556967..557800)
FT                   /locus_tag="STM0497"
FT   CDS_pept        complement(556967..557794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0497"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19451"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR96"
FT                   /protein_id="AAL19451.1"
FT                   /translation="MFRKAVTLLFLLSPAVSYAGLFDSTPELKCGNDNAVTAAKEWIYN
FT                   EALGRLQQDYIKEPSTLFFDIPQTQYEQQLRAIPVQFSDVITQNPQAENANLRTCSATV
FT                   AMGIPQPLFKLMKDLPNTLFYISQGDGQVINNTVTWKQVNYNIQLADNNKDIVVTSVQK
FT                   TDKLARSIYVMARMTVSGDSIIKKKNNSLIEIAAKKFESRDRELNQVWNSLPASARTAL
FT                   KQEQRVWVTQKEQQCGKLSDAKSEAIPAEKRISIYKCQLEMTIARTAYLDGSE"
FT   regulatory      complement(557795..557800)
FT                   /locus_tag="STM0497"
FT                   /note="putative RBS for STM0497; RegulonDB:STMS1H000834"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(557948..560463)
FT                   /gene="copA"
FT                   /locus_tag="STM0498"
FT   CDS_pept        complement(557948..560449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="STM0498"
FT                   /product="putative copper-transporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="similar to E. coli putative ATPase (AAC73586.1);
FT                   Blastp hit to AAC73586.1 (834 aa), 93% identity in aa 1 -
FT                   833"
FT                   /db_xref="EnsemblGenomes-Gn:STM0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19452"
FT                   /db_xref="GOA:Q8ZR95"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZR95"
FT                   /protein_id="AAL19452.1"
FT                   /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTG
FT                   TASADALIETIKQAGYGATLSHPKAKPLTESSIPSEALAAVPHELPVATADEESQQLLL
FT                   SGMSCASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGAEAI
FT                   EDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTDDNRSLWLAIG
FT                   LITLAVMVFAGGHFYRNAWKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEAR
FT                   HLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARVVTEDGEKSVPLADV
FT                   QPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVL
FT                   FRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFG
FT                   PAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLD
FT                   TLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSSHPLAHAILEKAGDDKL
FT                   PQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLA
FT                   IDGKAAALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAG
FT                   VLPDGKADAIKRLQSQGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLMR
FT                   HSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAAM
FT                   ALSSITVVSNANRLLRFKPKA"
FT   regulatory      complement(560458..560463)
FT                   /gene="copA"
FT                   /locus_tag="STM0498"
FT                   /note="putative RBS for copA; RegulonDB:STMS1H000835"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            560548..560975
FT                   /gene="cueR"
FT                   /locus_tag="STM0499"
FT   regulatory      560548..560553
FT                   /gene="cueR"
FT                   /locus_tag="STM0499"
FT                   /note="putative RBS for cueR; RegulonDB:STMS1H000836"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        560559..560975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="STM0499"
FT                   /product="putative heavy metal transcriptional repressor
FT                   (MerR family)"
FT                   /note="similar to E. coli putative transcriptional
FT                   regulator (AAC73589.1); Blastp hit to AAC73589.1 (135 aa),
FT                   91% identity in aa 1 - 134"
FT                   /db_xref="EnsemblGenomes-Gn:STM0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19453"
FT                   /db_xref="GOA:Q93CH6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93CH6"
FT                   /protein_id="AAL19453.1"
FT                   /translation="MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHLN
FT                   ELTLLRQARQVGFNLEECGELVNLFNDPRRHSADVKKRTLEKVAEIERHISELQSMRDQ
FT                   LLALAESCPGDDSADCPIIDNLSGCCHHKAQKPR"
FT   gene            complement(560976..561440)
FT                   /gene="ybbJ"
FT                   /locus_tag="STM0500"
FT   CDS_pept        complement(560976..561428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="STM0500"
FT                   /product="putative membrane protein implicated in
FT                   regulation of membrane protease activity"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73590.1); Blastp hit to AAC73590.1 (151 aa), 85%
FT                   identity in aa 3 - 149"
FT                   /db_xref="EnsemblGenomes-Gn:STM0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19454"
FT                   /db_xref="GOA:Q7CR12"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR12"
FT                   /protein_id="AAL19454.1"
FT                   /translation="MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLT
FT                   VWLLPLGWEWQGVLFAALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLVGRRFMLD
FT                   AALVNGRGHMRVGDSSWPVCADEDLRAGTHVEVIAVEGITLRIRAV"
FT   gene            complement(561425..562356)
FT                   /gene="ybbK"
FT                   /locus_tag="STM0501"
FT   CDS_pept        complement(561425..562342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="STM0501"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli putative protease (AAC73591.1);
FT                   Blastp hit to AAC73591.1 (305 aa), 95% identity in aa 1 -
FT                   302"
FT                   /db_xref="EnsemblGenomes-Gn:STM0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19455"
FT                   /db_xref="GOA:Q8ZR94"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR94"
FT                   /protein_id="AAL19455.1"
FT                   /translation="MLILIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINTRLLHIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGVRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATQMVSEAIAAGDIQAINYFVAQKYTEALQQIGSANNSKVVMMPLDA
FT                   SSLMGAIAGISELVKDSASERKKA"
FT   regulatory      complement(561435..561440)
FT                   /gene="ybbJ"
FT                   /locus_tag="STM0500"
FT                   /note="putative RBS for ybbJ; RegulonDB:STMS1H000837"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(562351..562356)
FT                   /gene="ybbK"
FT                   /locus_tag="STM0501"
FT                   /note="putative RBS for ybbK; RegulonDB:STMS1H000838"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            562474..563166
FT                   /gene="ybbL"
FT                   /locus_tag="STM0502"
FT   regulatory      562474..562479
FT                   /gene="ybbL"
FT                   /locus_tag="STM0502"
FT                   /note="putative RBS for ybbL; RegulonDB:STMS1H000839"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        562489..563166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="STM0502"
FT                   /product="putative ABC-type sugar/spermidine/putrescine
FT                   transport system, ATPase component"
FT                   /note="similar to E. coli putative ATP-binding component of
FT                   a transport system (AAC73592.1); Blastp hit to AAC73592.1
FT                   (225 aa), 74% identity in aa 1 - 225"
FT                   /db_xref="EnsemblGenomes-Gn:STM0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19456"
FT                   /db_xref="GOA:Q8ZR93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR93"
FT                   /protein_id="AAL19456.1"
FT                   /translation="MTERSMLLELKQVGYRTATTKIVNNISFTLQRGEFKLITGPSGCG
FT                   KSTLLKMVASLISPDIGVILFEGQDITTLSPEAYRQQVSYCAQTPALFGDTVYDNLIFP
FT                   WQIRHQRPQPTAFADDLARFELPETILQKPITALSGGEKQRIALIRNLQFLPKILLLDE
FT                   ITSALDEHNKRNVNDIIHRYVRDKQVAVLWVTHDKDEIQHADKVITLTPSAGEMQEARY
FT                   ERA"
FT   gene            563140..563932
FT                   /gene="ybbM"
FT                   /locus_tag="STM0503"
FT   regulatory      563140..563145
FT                   /gene="ybbL"
FT                   /locus_tag="STM0502"
FT                   /note="putative RBS for ybbM; RegulonDB:STMS1H000840"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        563153..563932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="STM0503"
FT                   /product="putative YbbM family transport protein, metal
FT                   resistance protein"
FT                   /note="similar to E. coli putative metal resistance protein
FT                   (AAC73593.1); Blastp hit to AAC73593.1 (268 aa), 88%
FT                   identity in aa 10 - 267"
FT                   /db_xref="EnsemblGenomes-Gn:STM0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19457"
FT                   /db_xref="GOA:Q8XEU4"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEU4"
FT                   /protein_id="AAL19457.1"
FT                   /translation="MNEHNITNTSLALSMLLVVVAMLISHKEKLALEKDILWSVCRAVI
FT                   QLIIVGYVLKYIFGVNHAALTLLMVLFICFNAAWNAQKRSKYIDKAFLSSFIAITVGAG
FT                   LTLTVLVLTGSIEFAPMQVIPIAGMVAGNAMVAVGLCYNQLGLRFHSEQQQIQEKLSLG
FT                   ATPKMASAGLIRDSIRASLIPTIDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVMPLKKS"
FT   gene            complement(564018..564872)
FT                   /gene="ybbN"
FT                   /locus_tag="STM0504"
FT   CDS_pept        complement(564018..564872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="STM0504"
FT                   /product="putative thioredoxin protein"
FT                   /note="similar to E. coli putative thioredoxin-like protein
FT                   (AAC73594.1); Blastp hit to AAC73594.1 (296 aa), 94%
FT                   identity in aa 13 - 296"
FT                   /db_xref="EnsemblGenomes-Gn:STM0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19458"
FT                   /db_xref="GOA:Q8ZR92"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:3QDN"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR92"
FT                   /protein_id="AAL19458.1"
FT                   /translation="MSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVL
FT                   ESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRA
FT                   LLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNSEIGLLLAEAQIALNR
FT                   SEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVADNPQDAALATQL
FT                   ALQLHQVGRNEEALELLFSHLRKDLTAAEGQTRKTFQEILAALGTGDALASKYRRQLYA
FT                   LLY"
FT   gene            complement(564932..565713)
FT                   /gene="ybbO"
FT                   /locus_tag="STM0505"
FT   CDS_pept        complement(564932..565702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="STM0505"
FT                   /product="putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="similar to E. coli putative oxidoreductase
FT                   (AAC73595.1); Blastp hit to AAC73595.1 (269 aa), 90%
FT                   identity in aa 14 - 268"
FT                   /db_xref="EnsemblGenomes-Gn:STM0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19459"
FT                   /db_xref="GOA:Q7CR11"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR11"
FT                   /protein_id="AAL19459.1"
FT                   /translation="MQKSVLITGCSSGIGLDSALELKRQGFQILAGCRKPDDVARMNSM
FT                   GFTGVLIDLDSPESVDRAADEVIALTDNRLYGIFNNAGYGVYGPLSTISREQMEQQFSS
FT                   NFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDALRME
FT                   LRHTGIKVSLIEPGPIRTRFTDNVNQTQRDKPVENPGIAARFTRDPDAVVAKVRHAFAS
FT                   DKPRLRYPVTLVTWAVMALKRILPGRMLDKILQS"
FT   regulatory      complement(565708..565713)
FT                   /gene="ybbO"
FT                   /locus_tag="STM0505"
FT                   /note="putative RBS for ybbO; RegulonDB:STMS1H000841"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(565857..566488)
FT                   /gene="tesA"
FT                   /locus_tag="STM0506"
FT   CDS_pept        complement(565857..566471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="STM0506"
FT                   /product="multifunctional acyl-CoA thioesterase I; also
FT                   functions as protease I, lysophospholipaseL(I)"
FT                   /EC_number="3.1.2.-"
FT                   /note="similar to E. coli acyl-CoA thioesterase I; also
FT                   functions as protease I (AAC73596.1); Blastp hit to
FT                   AAC73596.1 (208 aa), 89% identity in aa 2 - 205"
FT                   /db_xref="EnsemblGenomes-Gn:STM0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19460"
FT                   /db_xref="GOA:Q8ZR91"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR91"
FT                   /protein_id="AAL19460.1"
FT                   /translation="MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAAS
FT                   AAWPSLLNDKWQNKTSVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGF
FT                   APAQTEQTLRKIIQTVKAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLP
FT                   FFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLTPFLS"
FT   gene            566430..567128
FT                   /gene="ybbA"
FT                   /locus_tag="STM0507"
FT   regulatory      566430..566435
FT                   /gene="ybbA"
FT                   /locus_tag="STM0507"
FT                   /note="putative RBS for ybbA; RegulonDB:STMS1H000843"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        566442..567128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="STM0507"
FT                   /product="putative ABC superfamily (atp_bind) transporter"
FT                   /note="similar to E. coli putative ATP-binding component of
FT                   a transport system (AAC73597.1); Blastp hit to AAC73597.1
FT                   (228 aa), 92% identity in aa 1 - 228"
FT                   /db_xref="EnsemblGenomes-Gn:STM0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19461"
FT                   /db_xref="GOA:Q7CR10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR10"
FT                   /protein_id="AAL19461.1"
FT                   /translation="MPAENSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRAQHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALAARCDRRLRLVNG
FT                   QLQEEA"
FT   regulatory      complement(566483..566488)
FT                   /gene="tesA"
FT                   /locus_tag="STM0506"
FT                   /note="putative RBS for tesA; RegulonDB:STMS1H000842"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            567114..569539
FT                   /gene="ybbP"
FT                   /locus_tag="STM0508"
FT   regulatory      567114..567119
FT                   /gene="ybbA"
FT                   /locus_tag="STM0507"
FT                   /note="putative RBS for ybbP; RegulonDB:STMS1H000844"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        567125..569539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="STM0508"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli putative oxidoreductase
FT                   (AAC73598.1); Blastp hit to AAC73598.1 (804 aa), 88%
FT                   identity in aa 1 - 804"
FT                   /db_xref="EnsemblGenomes-Gn:STM0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19462"
FT                   /db_xref="GOA:Q8ZR90"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR90"
FT                   /protein_id="AAL19462.1"
FT                   /translation="MIARWFWREWRSPSLIIVWLALSLAVACVLALGSISDRMEKGLSQ
FT                   QSREFMAGDRTLQSSREVPKAWLEEARKRGLNVGEQLTFATMTFAGDTPQLASVKAVDS
FT                   VYPMYGELQTRPGGVKAQPGSVLLAPRLMALLNLKTGDTIDVGDVTLRIAGEVVQEPDS
FT                   GFNPFQMAPRLMMNMADVAKTGAIQPGSRVMWRYKFGGTPQQLAGYESWLLPQLKPEHR
FT                   WYGLEQDDGALGKSLERSQQFLLLSALLTLLLAVAAVAVAMSHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIIGQWLMVLGLSAVTGGAIGLLFENILLVLLKPVLPADLPPASLWPWLWA
FT                   LGAMTVISLLVGLRPYRLLLATQPLRVLRRDVVARVWPLKIYLPVACAVVVALLVGLMG
FT                   GSMLLWAVLAGAVILALLCGLVGWMLLNVLRGMTLTSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIASEQVAPLKAFLAEHQVIPQ
FT                   TFYPIVRARLTKINGNPTEGQQDESLNRELNLTWQDTRPAHNPLVAGHWPPKPGEVSME
FT                   EGLAKRLNVKLGDSVTFMGDTQAFSAKVTSLRQVDWESLRPNFFFIFPSGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNREFPTVSLLDIGAILKQVGQVLEQVSRALEVMVVLVTLCGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGLVAGLVAAIGAETALAI
FT                   LQINVFDFPWEPDWRLWGALPFCGALLLSVCGGWLGVRLLKGKALFRQFSG"
FT   gene            569718..570858
FT                   /locus_tag="STM0509"
FT   regulatory      569718..569723
FT                   /locus_tag="STM0509"
FT                   /note="putative RBS for STM0509; RegulonDB:STMS1H000845"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        569725..570858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0509"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19463"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q9S4Z2"
FT                   /protein_id="AAL19463.1"
FT                   /translation="MTIKITALAASIGAAVAFMPFATQAEITVLKQDPQAGNPLSRLNF
FT                   TVGGSIRPQFQNMTGNDGANGYKRNGFDGGTRFRFAADYYLFDDISWISYYELGVNIPA
FT                   VFDWDNHYAKGATDTTRRMLYTGFKSATWGTLTFGQQNSIYYDVVGVKTDIWDYDMIGQ
FT                   APGNGINGDYDGSYRTRKSLKYKKSIGNVDLYASYLFSDDYNANNGLNYKRKGGGSLGA
FT                   DYHLTDDLTWGTAWNYTRAEMRGNGNKTYDQNIVGTALSWTPENWTIAAGGGWYQNFMT
FT                   TKKVSVNDYFAGDAWGLEYFVGYAFPIGQYAVKAIQPYFMGDRIEYVNGRDYLRTDNGV
FT                   GITFQLDYGFRVDYEHVFTSSTDNLGDMNLVRLRYDF"
FT   gene            571109..571945
FT                   /gene="sfbA"
FT                   /locus_tag="STM0510"
FT   regulatory      571109..571114
FT                   /gene="sfbA"
FT                   /locus_tag="STM0510"
FT                   /note="putative RBS for sfbA; RegulonDB:STMS1H000846"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        571115..571945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfbA"
FT                   /locus_tag="STM0510"
FT                   /product="putative ABC-type transport system ATPase
FT                   component/cell division protein"
FT                   /note="similar to E. coli putative lipoprotein
FT                   (AAC73308.1); Blastp hit to AAC73308.1 (271 aa), 37%
FT                   identity in aa 14 - 258"
FT                   /db_xref="EnsemblGenomes-Gn:STM0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19464"
FT                   /db_xref="GOA:Q9S4Z1"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q9S4Z1"
FT                   /protein_id="AAL19464.1"
FT                   /translation="MGLRQSLRIAASTLLLACGLQFAHADSSPQTIVFGVAPGPYGDMV
FT                   KQAIAPTLKEKGYKVVVREFSDYVQPNMALANGSIDANLFQHTLYFDKFTADKGLKLSK
FT                   LIVVPTAGMGFYSRKINSLDALKKGDIITLSNDPTNLARGLRFLQSLGLITIKDNIDPT
FT                   KASERDIASNPKGLVFKPLEAAQLPRTLDGVTGALVNGNFAVAAGLDLSSAIKQEHLDE
FT                   NLKNIIAVRSEDADKPFAKDIVEAVKSPAYRAVIDDPKNIYSAFQKPEWMTATP"
FT   gene            571975..572998
FT                   /gene="sfbB"
FT                   /locus_tag="STM0511"
FT   regulatory      571975..571980
FT                   /gene="sfbB"
FT                   /locus_tag="STM0511"
FT                   /note="putative RBS for sfbB; RegulonDB:STMS1H000847"
FT                   /regulatory_class="ribosome_binding_site"
FT