(data stored in ACNUC1104 zone)

EMBL: AE006469

ID   AE006469; SV 1; circular; genomic DNA; STD; PRO; 1354226 BP.
XX
AC   AE006469;
XX
PR   Project:PRJNA19;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   19-NOV-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence.
XX
KW   .
XX
OS   Sinorhizobium meliloti 1021
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Sinorhizobium/Ensifer group; Sinorhizobium.
OG   Plasmid pSymA
XX
RN   [1]
RP   1-1354226
RX   DOI; 10.1073/pnas.161294798.
RX   PUBMED; 11481432.
RA   Barnett M.J., Fisher R.F., Jones T., Komp C., Abola A.P., Barloy-Hubler F.,
RA   Bowser L., Capela D., Galibert F., Gouzy J., Gurjal M., Hong A., Huizar L.,
RA   Hyman R.W., Kahn D., Kahn M.L., Kalman S., Keating D.H., Palm C.,
RA   Peck M.C., Surzycki R., Wells D.H., Yeh K.-C., Davis R.W., Federspiel N.A.,
RA   Long S.R.;
RT   "Nucleotide sequence and predicted functions of the entire Sinorhizobium
RT   meliloti pSymA megaplasmid";
RL   Proc. Natl. Acad. Sci. U.S.A. 98(17):9883-9888(2001).
XX
RN   [2]
RP   1-1354226
RA   Barnett M.J., Long S.R., Yurgel S., Schroeder B.K., Kamp P.B., Krol E.,
RA   Linke B., Goesmann A., Runte K., Capela D., Becker A.;
RT   "Reannotation of the Sinorhizobium meliloti 1021 plasmid pSymA";
RL   Unpublished.
XX
RN   [3]
RP   1-1354226
RA   Barnett M.J., Fisher R.F., Jones T., Komp C., Abola A.P., Barloy-Hubler F.,
RA   Bowser L., Capela D., Galibert F., Gouzy J., Gurjal M., Hong A., Huizar L.,
RA   Hyman R.W., Kahn D., Kahn M.L., Kalman S., Keating D.H., Palm C.,
RA   Peck M.C., Surzycki R., Wells D.H., Yeh K.-C., Davis R.W., Federspiel N.A.,
RA   Long S.R.;
RT   ;
RL   Submitted (29-MAR-2001) to the INSDC.
RL   Biological Sciences, Stanford University, 371 Serra Mall, Stanford, CA
RL   94305, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-1354226
RA   Barnett M.J.;
RT   ;
RL   Submitted (25-JUN-2008) to the INSDC.
RL   Biological Sciences, Stanford University, 371 Serra Mall, Stanford, CA
RL   94305, USA
XX
DR   MD5; cc9c8217bcf56cc94c2d19404cfe60ca.
DR   EnsemblGenomes-Gn; EBG00001178143.
DR   EnsemblGenomes-Gn; EBG00001178144.
DR   EnsemblGenomes-Gn; EBG00001178145.
DR   EnsemblGenomes-Gn; EBG00001178146.
DR   EnsemblGenomes-Gn; EBG00001178147.
DR   EnsemblGenomes-Gn; EBG00001178148.
DR   EnsemblGenomes-Gn; EBG00001178149.
DR   EnsemblGenomes-Gn; EBG00001178150.
DR   EnsemblGenomes-Gn; SMa0022.
DR   EnsemblGenomes-Gn; SMa2168.
DR   EnsemblGenomes-Tr; EBT00001756469.
DR   EnsemblGenomes-Tr; EBT00001756470.
DR   EnsemblGenomes-Tr; EBT00001756471.
DR   EnsemblGenomes-Tr; EBT00001756472.
DR   EnsemblGenomes-Tr; EBT00001756473.
DR   EnsemblGenomes-Tr; EBT00001756474.
DR   EnsemblGenomes-Tr; EBT00001756475.
DR   EnsemblGenomes-Tr; EBT00001756476.
DR   EnsemblGenomes-Tr; SMa0022-1.
DR   EnsemblGenomes-Tr; SMa2168-1.
DR   EuropePMC; PMC2266912; 18226217.
DR   EuropePMC; PMC2620714; 19011059.
DR   EuropePMC; PMC2893487; 20418433.
DR   EuropePMC; PMC3019937; 20971905.
DR   EuropePMC; PMC3622305; 23431003.
DR   EuropePMC; PMC4914127; 27190233.
DR   EuropePMC; PMC55547; 11481432.
DR   EuropePMC; PMC5739047; 29220487.
DR   EuropePMC; PMC6328680; 30643907.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   StrainInfo; 115196; 0.
XX
CC   On or before Apr 21, 2008 this sequence version replaced
CC   gi:14523055, gi:14523063, gi:14523073, gi:14523086, gi:14523103,
CC   gi:14523115, gi:14523126, gi:14523136, gi:14523147, gi:14523158,
CC   gi:14523169, gi:14523181, gi:14523192, gi:14523202, gi:14523214,
CC   gi:14523233, gi:14523243, gi:14523259, gi:14523272, gi:14523279,
CC   gi:14523291, gi:14523301, gi:14523313, gi:14523320, gi:14523330,
CC   gi:14523347, gi:14523360, gi:14523374, gi:14523386, gi:14523398,
CC   gi:14523411, gi:14523424, gi:14523438, gi:14523449, gi:14523458,
CC   gi:14523472, gi:14523488, gi:14523499, gi:14523511, gi:14523526,
CC   gi:14523537, gi:14523546, gi:14523559, gi:14523573, gi:14523581,
CC   gi:14523591, gi:14523602, gi:14523608, gi:14523619, gi:14523631,
CC   gi:14523644, gi:14523658, gi:14523674, gi:14523688, gi:14523701,
CC   gi:14523714, gi:14523722, gi:14523734, gi:14523745, gi:14523762,
CC   gi:14523776, gi:14523793, gi:14523806, gi:14523817, gi:14523832,
CC   gi:14523845, gi:14523856, gi:14523869, gi:14523880, gi:14523891,
CC   gi:14523904, gi:14523915, gi:14523928, gi:14523936, gi:14523947,
CC   gi:14523957, gi:14523972, gi:14523982, gi:14523993, gi:14524003,
CC   gi:14524019, gi:14524033, gi:14524043, gi:14524053, gi:14524063,
CC   gi:14524075, gi:14524085, gi:14524098, gi:14524107, gi:14524117,
CC   gi:14524132, gi:14524143, gi:14524154, gi:14524165, gi:14524175,
CC   gi:14524186, gi:14524199, gi:14524209, gi:14524219, gi:14524230,
CC   gi:14524243, gi:14524254, gi:14524266, gi:14524277, gi:14524289,
CC   gi:14524303, gi:14524312, gi:14524322, gi:14524332, gi:14524346,
CC   gi:14524359, gi:14524370, gi:14524380, gi:14524399, gi:14524408,
CC   gi:14524419, gi:14524427, gi:14524436, gi:14524446, gi:14524456,
CC   gi:14524466.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1354226
FT                   /organism="Sinorhizobium meliloti 1021"
FT                   /plasmid="pSymA"
FT                   /strain="1021"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266834"
FT   gene            1353..4457
FT                   /gene="fdoG"
FT                   /locus_tag="SMa0002"
FT   CDS_pept        1353..4457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:1965..1967,aa:Sec)
FT                   /gene="fdoG"
FT                   /locus_tag="SMa0002"
FT                   /product="formate dehydrogenase, major subunit (formate
FT                   dehydrogenase alpha subunit)"
FT                   /function="Uncharacterized anaerobic dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /note="Formate dehydrogenase alpha subunit precursor (FDH
FT                   alpha subunit) (Formate dehydrogenase large subunit),
FT                   Formate dehydrogenase, alpha subunit, anaerobic,
FT                   Molydopterin dinucleotide binding domain, formate-DH-alph:
FT                   formate dehydrogenase, alpha subunit, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64659"
FT                   /db_xref="GOA:Q931E0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q931E0"
FT                   /protein_id="AAK64659.1"
FT                   /translation="MEAVPMNVDLSRRSFLKLAGAGAAATSLGAMGFGEAEAAVVAHVR
FT                   PHKLTTTTETRNTCPYCSVACGVIIYSKGDLRKGEAADIIHIEGDADHPTNRGTLCPKG
FT                   AALKDFVKSPTRLQYPMHRKPGSDKFERISWEDAFDRIARLMKDDRDANFIAANAAGVP
FT                   VNRWTTVGMLAASATTNETAWATFKFAKALGIVGFDNQARVUHGPTVSSLGPTFGRGAM
FT                   TNSWTDIKNTDLVVVMGGNAAEAHPCGFKWVTEAKATRGAKLIVVDPRYTRTASVSDYY
FT                   APIRQGTDIAFLNGVMKYCIDNDKVQWDYMKAFTNASYLVKDGFGYQDGLFTGYDAEKR
FT                   DYDKSTWDYVLGDDGFVVTDPALQHPRCVWNLLKAHLAPYTPEMVERICGTPKDKFLKV
FT                   AEMISECSSPTKTMTSMYALGWTQHSSGSQNIRAMAMLQLILGNIGVRGGGMNALRGHS
FT                   NIQGLTDLGLMSHLLTGYLTMPTEKDVDFTTYMSTRQFKPLRPGQTSYWQNYRKFMVSF
FT                   QKAMWGDAARIDNDWAFNYLSKLDVPAYDVLRVFELMYAGKVNGYICQGFNPLLAFPNR
FT                   DKNTKALSNLKWLVTMDPLDTETARFWENHGDFNPVDTASIQTEVFQLPTTCFAEEEGS
FT                   LTNSGRWLQWHWAGGTPPGEAKHDTYIVAQIFLRMKEMYRNEGGAFPDPILNLSWDYAD
FT                   PNEPTPEELAKEINGRALTDLMDPANPMKVQVAAGKQILNFSQLRDDGSTMCGCWIYSG
FT                   NFNEQGNNMARRDNHDPDDTGAYLGWSFAWPLNRRTLYNRASADLQGKPWDPSRKLLEW
FT                   DGTKWAGYDVPDIAPTAKPDEIGPFIMNQEGTARLFSRGLMRDGPFPAHMEPFESPVAN
FT                   VFNPKMRGNPVSRVFQTDVAQMGLSDEFPYAATSYRLTEHFHYWTKHNRVNSALQPEFF
FT                   VEISEELAEEKNIENGGWVRVWSKRGSVKAKAVVTKRIRPLMCDGKPVHVVGIPLHWGF
FT                   TGSAKKGLGPNSLAPFVGDANIETPEYKAFLVNIEPSTAPEEATV"
FT   gene            4454..5446
FT                   /gene="fdoH"
FT                   /locus_tag="SMa0005"
FT   CDS_pept        4454..5446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdoH"
FT                   /locus_tag="SMa0005"
FT                   /product="formate dehydrogenase-O, iron-sulfur subunit"
FT                   /function="Fe-S-cluster-containing hydrogenase components
FT                   1"
FT                   /EC_number="1.2.1.2"
FT                   /note="Formate dehydrogenase-O, iron-sulfur subunit
FT                   (Formate dehydrogenase-O beta subunit) (FDH-Z beta subunit)
FT                   (Aerobic formate dehydrogenase iron-sulfur subunit),
FT                   Formate dehydrogenase, beta subunit, FDH-beta: formate
FT                   dehydrogenase, beta subunit, high confidence in function
FT                   and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64660"
FT                   /db_xref="GOA:Q931D9"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q931D9"
FT                   /protein_id="AAK64660.1"
FT                   /translation="MMDSPRTAVSNPPVQPMESNLTERDLVRRSATTELPPPERQLTPV
FT                   AKLIDVSKCIGCKACQSACVEWNDTHPGIGENVGYYTNPHDLTEDMFTLMRFTEWVNPE
FT                   TDNLEWLIRKDGCMHCADPGCLKACPAPGAIVQYTNGIVDFVHENCIGCGYCIKGCPFN
FT                   IPRISKVDHRAYKCTLCSDRVAVGQGPACAKACPTQAIVFGTKEDMKKHAEHRIADLKS
FT                   RGYTNAGLYDPPGVGGTHVMYVLHHSDKPHIYSDLPDDPKISAVVQAWKGVTKYTGLAA
FT                   MGLVAAGAILHGVFGRANRVQPEDEESAERLVDSAGAAGRTPDDKGQRS"
FT   gene            5424..6110
FT                   /gene="fdoI"
FT                   /locus_tag="SMa0007"
FT   CDS_pept        5424..6110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdoI"
FT                   /locus_tag="SMa0007"
FT                   /product="formate dehydrogenase, cytochrome B556 (FDO)
FT                   subunit"
FT                   /function="Cytochrome b subunit of formate dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /note="Formate dehydrogenase, cytochrome B556 subunit
FT                   (Formate dehydrogenase gamma subunit) (FDH gamma subunit),
FT                   Formate dehydrogenase, gamma subunit, formate- DH-gamm:
FT                   formate dehydrogenase, gamma subunit, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64661"
FT                   /db_xref="GOA:Q931D8"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q931D8"
FT                   /protein_id="AAK64661.1"
FT                   /translation="MTKASDLEPEDAIHRGPPVTVDRYGPGKRVNHWITASSLILLALS
FT                   GLAMFHPSLFFLTGLFGGGQNTRMLHPWIGVVLFFSFYIFFFQLWKANLFTRADMGWFT
FT                   GIRDVIGGHEDRLPEMGKYNAGQKVIFWAMALLIVALIITGVIIWDQYFYSYTSIETKR
FT                   FAVLAHAVAAVLIICVFIVHVYAAFWTRGTFRAMTKGSVTGGWAWRHHRKWLKELAGRG
FT                   RIDPAE"
FT   gene            6149..7069
FT                   /gene="fdhE"
FT                   /locus_tag="SMa0009"
FT   CDS_pept        6149..7069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhE"
FT                   /locus_tag="SMa0009"
FT                   /product="Formate dehydrogenase accessory protein FdhE"
FT                   /note="Formate dehydrogenase accessory protein, Protein
FT                   involved in formate dehydrogenase formation, FdhE: formate
FT                   dehydrogenase accessory protein FdhE, conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64662"
FT                   /db_xref="GOA:Q931D7"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q931D7"
FT                   /protein_id="AAK64662.1"
FT                   /translation="MSVSPVQPDPSVIGGVPKAPFVLKPNLARLFNDRASRFEALAQGS
FT                   HLAPYLNFLAGITRIQSELVSALPPPEPVPADRVERARANAMPPIDRAAMGGSPDCREV
FT                   LQQFFEKAEALEKPAAAAEALAQVRTADEEMLTWMIGNVMADDLPVESLAHHLYVAAAM
FT                   QIQAARLAAGLDGSRLVPIRVGVCPACGGRPVASMVIGFHGAEGARYASCSCCATMWNE
FT                   VRVKCLACGSTKGIGYQAVETGDEEATVKAEVCDTCNSWMKILYQNKNPSLDVVADDVA
FT                   SLGLDLLMKDTEYKRAGFDPFLMGY"
FT   gene            7074..8474
FT                   /gene="selA"
FT                   /locus_tag="SMa0011"
FT   CDS_pept        7074..8474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="SMa0011"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /function="Selenocysteine synthase [seryl-tRNASer selenium
FT                   transferase]"
FT                   /EC_number="2.9.1.1"
FT                   /note="L-seryl-tRNA(Sec) selenium transferase (Cysteinyl-
FT                   tRNA(Sec) selenium transferase) (Selenocysteine synthase)
FT                   (Selenocysteinyl-tRNA(Sec) synthase), L-seryl-tRNA selenium
FT                   transferase, L-seryl-tRNA selenium transferase, selA:
FT                   L-seryl-tRNA selenium transferase, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64663"
FT                   /db_xref="GOA:P58226"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58226"
FT                   /protein_id="AAK64663.1"
FT                   /translation="MSGPVDLRALPSVDQMLNAAAVSPLVEQHGRAVVTDELRKVLGEV
FT                   RLAVRSGGALPGKDGIVAALLSRLDDRSRSNLRPLFNLTGTVLHTNLGRALLAQEAVDA
FT                   AVDAMREAAALEFDLDSGGRGERDSHLRELLCELTGAEDATVVNNNAAAVLIALNSVGA
FT                   GRQAIVSRGELIEIGGAFRMPDIMERAGVDLVEVGTTNRTHAKDYVKAIGPETALILKV
FT                   HTSNYRIEGFTAEVPGAELAAIAHERGVVLLNDLGSGSLVDLSRYGLGREPTVREAVAE
FT                   GADLVTFSGDKLLGGPQAGFIVGRRDLIAEINRNPLKRALRVDKIRIAATAATLKLYRD
FT                   PDRLASRLPTLFMLSRVQAEVRAQAERLAPQVGAMLAPSGYAVEVCSCSSQIGSGALPV
FT                   DTIPSAGLRIVGSSGSALEALAALFRSLSRPILGRLRDGALVLDLRCLSDEAEFLKTLS
FT                   EGSGDAVA"
FT   gene            8383..9255
FT                   /locus_tag="SMa0013"
FT   CDS_pept        8383..9255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64664"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q931D6"
FT                   /protein_id="AAK64664.2"
FT                   /translation="MVRWFWTCAVCPMRRNSSKPCPRVAAMRWLERLRGNKPQTAPVAD
FT                   PMAEALARAQAGDYGSALRIWEPLARAGVARAQNNIGACFAEGLGVPENRELACKWLRL
FT                   AAEAGDPVGQRNYAALHMQGLAGTDADYGIAAEYYRRAAEKGDAPAQDMLSWLLLEGEI
FT                   MTADPLEARRWAECAAEAGIASSMTRLGMLHHNALGVERDAQKAVYWWLKAAERGDADA
FT                   QAMLGAACHMGAGTIRNGVTALVWLIRATEGGSTLAKPFMGPVRDSLSPAEIQEAERRA
FT                   QEPLSRRAP"
FT   gene            9252..11252
FT                   /gene="selB"
FT                   /locus_tag="SMa0015"
FT   CDS_pept        9252..11252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="SMa0015"
FT                   /product="Selenocysteine-specific elongation factor"
FT                   /function="GTPases - translation elongation factors"
FT                   /note="Selenocysteine-specific elongation factor (SelB
FT                   translation factor), Translation elongation factor,
FT                   selenocysteine-specific, Elongation factor Tu GTP binding
FT                   domain, selB: selenocysteine-specific translation
FT                   elongation factor, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64665"
FT                   /db_xref="GOA:Q931D5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q931D5"
FT                   /protein_id="AAK64665.1"
FT                   /translation="MIVGTAGHIDHGKTTLVKALTGVDTDRLKEEKARGITIDLGFAYA
FT                   RFAKDAVTGFVDVPGHERFIHTMLAGAGGIDYAMLVVAADDGIKPQTLEHLAILDLLGV
FT                   SRGLVAITKADLADPARLENLTDEIGAVLSSTSLRDAEILPVSVAAGQGIELLKERLAA
FT                   AECATAASAVGGRFRLAVDRSFTLSGAGTVVTGTVLSGSVGVGDQVTVSPAGRSARVRS
FT                   IHAQNQRAERGFAGQRCALNLAGEGISKDAITRGDMVVDPHLHAPSDRLDADLSVLESE
FT                   TKPIGEWFSARFHHASAETGIRIVPLEGPLLPGERRRVQLVLDRPIAAAVGDRFILRDV
FT                   SARRTIGGGRLLDLRAPARKRRSPERLSYLQAASLSHAGEALAALLDVPPFLVDLDVFA
FT                   RDRALSEAELQNAIRSASAEVIEGSAVRHALSKRQRAAFSDEVQRVLSAFHVENPDLQG
FT                   IGRERLRLQVTPRLPPPAFLVALRAEQTAGRLVLEGAFVRLPGHEVRLSEKEEELYARI
FT                   LPHLEGEERFRPPRVRDFAEALGVDEREIRRILKLCARLGRVDQIRHDHFFTRQTTAEM
FT                   VAIIRQVAANAERGEFSAGLFRDRVNNGRKVAIEILEFFDRQGVTIRHGDVRRVNPHRL
FT                   DLYEGPVPEADEGRGSSPVERPDFKFYRAGS"
FT   gene            11506..12063
FT                   /locus_tag="SMa0017"
FT   CDS_pept        11506..12063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0017"
FT                   /product="hypothetical protein"
FT                   /note="InterPro finds weak similarity to Homeodomain-like
FT                   HTH_fis: Helix-turn-helix domain fis-ty"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64666"
FT                   /db_xref="UniProtKB/TrEMBL:Q931D4"
FT                   /protein_id="AAK64666.1"
FT                   /translation="MAAADDGRNGGGLRQRKARRGLPQARRNHLSGTTRIGKRQAQILG
FT                   SGGLGPSNEPRGGCCMPLGREIPSEDGGENSRSKRSAWGRRQKTMSLTTAFIAELIRAA
FT                   NEVERLTPYEISRLLDRSVDTIRDMRRQTGIAASHRARDVVIDLQLASARARDLSAAET
FT                   RDVLLDAADIIRTLKIVLDGKE"
FT   gene            complement(12259..12546)
FT                   /locus_tag="SMa5000"
FT   CDS_pept        complement(12259..12546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5000"
FT                   /product="hypothetical protein"
FT                   /note="Has some similarity to S; meliloti SMa1907 and a
FT                   group of conserved hypothetical proteins; Possible protein
FT                   fragment created by insertion of the adjacent insertion
FT                   element, TRm2011"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5000"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07957"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLV9"
FT                   /protein_id="ACF07957.1"
FT                   /translation="MSSNVSIISPWNMEFIRSVLGEAGYNAKLLVDDPRSFETAELLVT
FT                   KLFLAGEDSRPGLAAKLECQLGKAGGYRRPPGSSLARYAIQGLPSELQFS"
FT   repeat_region   12658..13716
FT                   /rpt_family="ISRm2011-2/ISRm11"
FT                   /note="SMa3000; predicted by homology"
FT   gene            12754..13161
FT                   /locus_tag="SMa0018"
FT   CDS_pept        12754..13161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0018"
FT                   /product="TRm2011-2a transposase"
FT                   /note="Transposon-related functions, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64667"
FT                   /db_xref="GOA:Q926A8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q926A8"
FT                   /protein_id="AAK64667.1"
FT                   /translation="MARPFSNDLRERVVDAVTGEGLSCRAAAKRFGIGISTAIDWVRRF
FT                   RETGSAAPGQMGGHKPRKLSGPHRAWLLCRCRERDFTLHGLVAELSERGLKVDYRAVWT
FT                   FVHEEGLSYKKRRWSPANGSGPTSPATGHDG"
FT   gene            13227..13700
FT                   /locus_tag="SMa0020"
FT   CDS_pept        13227..13700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0020"
FT                   /product="TRm2011-2b transposase"
FT                   /note="Transposon-related functions, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64668"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q925Y4"
FT                   /protein_id="AAK64668.1"
FT                   /translation="MAPLRGWAPRGERLVGYAPFGHWNTMTFVAALRADRVSAPFILDG
FT                   PINGERFRIYVQQVLVPELKAGDIVILDNLGSHKGQEIRAAIRKAGARLFFLPKYSPDL
FT                   NPIEKLFAKIKHWLREAQARSRDAIHDELRHILQAVTPQECAAYFKEAGYERA"
FT   gene            complement(14450..15094)
FT                   /locus_tag="SMa0021"
FT   CDS_pept        complement(14450..15094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0021"
FT                   /product="hypothetical protein"
FT                   /note="Contains a partial signal receiver domain in
FT                   carboxy-terminus of predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64669"
FT                   /db_xref="GOA:Q931D3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q931D3"
FT                   /protein_id="AAK64669.1"
FT                   /translation="MYRLYNHAIARFSLDCFEGLTGDKTCRLKAQAWLIAELHQLGYRD
FT                   MPQKRCCAYRGLRHSYRKIAKEPRSEQTSSCEEADMKPATILLAEDEALLLLDYEAALA
FT                   DAGFVVVAVARGGKAIEVWRSADSEVAGVATDIRFYELPNGWSVARVAREIYPGIPIVY
FT                   GTGHGALEWRSRGVANSILLEKPFALAQLVTAVSELLNEPVLLSVAPDPNP"
FT   gene            15716..15807
FT                   /gene="selC"
FT                   /locus_tag="SMa0022"
FT   tRNA            15716..15807
FT                   /gene="selC"
FT                   /locus_tag="SMa0022"
FT                   /product="tRNA-Sec"
FT                   /anticodon="(pos:15750..15752,aa:Sec)"
FT   gene            15826..16209
FT                   /locus_tag="SMa5014"
FT   CDS_pept        15826..16209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5014"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein from XautDRAFT_0850
FT                   [Xanthobacter autotrophicus Py2]"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07958"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW0"
FT                   /protein_id="ACF07958.1"
FT                   /translation="MTAETPGTDFDDWVVSTYRDVGSFTMLFVLLRIGDTSVDLLRSAY
FT                   LHVVGDELRWPDMVQLFRGAGVEWSGAVFYRAGREGLVEDGEAKSRLASLVFKLNEDRS
FT                   LISEGDLFNADGLRLTIEEIKPH"
FT   gene            complement(16251..17318)
FT                   /locus_tag="SMa0025"
FT   CDS_pept        complement(16251..17318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0025"
FT                   /product="hypothetical protein"
FT                   /note="Miscellaneous; Hypothetical/Global homology"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64670"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q931D2"
FT                   /protein_id="AAK64670.2"
FT                   /translation="MLNRRRFLTNAATAAAATLWVSKGGMQARAEEAGNGSPWRRFEII
FT                   TKVDLQPAEGPAQLWLPVVRSAGDYQKADAPLWVSNSTDIRMEKDPSSGADILRVMWED
FT                   EPRRVIEVTQHVATRDRRVTSKIAATEAELQHELRGTPSMPVDGIVKTTAMRIVEGRDR
FT                   AEDRARAIYDWVIDNTFRDANIDGCGVGNARDMLETGYFGGKCADISSLFVSLARAAGL
FT                   PARDVFGIRVADSADFKSLGRSGDITKAQHCRAEVYLDAHGWVPVDPADVRKVVLEENL
FT                   PLDNPAVRAFREKAYGNWEMNWVGYNTARDLVLPGGELRQGFLMYPAAVTSRGELDCLN
FT                   PQTFAYSITSREITA"
FT   gene            complement(17424..17852)
FT                   /locus_tag="SMa0026"
FT   CDS_pept        complement(17424..17852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0026"
FT                   /product="hypothetical protein predicted by Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64671"
FT                   /db_xref="UniProtKB/TrEMBL:Q931D1"
FT                   /protein_id="AAK64671.1"
FT                   /translation="MEQAFPNIVGGDEKEIAMSNLAPTRPSACVLAAFCLLIALAPNPA
FT                   SAQNTNERADCAAAAGKAEPATPPDRASADGTAPGNSGSTGWTGGTGGAHIGTNPQGAT
FT                   AGSTTWQPPTARGIDLATAPEIPAPETAAPGTQTPTDC"
FT   gene            complement(17865..18914)
FT                   /gene="selD"
FT                   /locus_tag="SMa0028"
FT   CDS_pept        complement(17865..18914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="SMa0028"
FT                   /product="selenide, water dikinase"
FT                   /function="Selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="Selenide,water dikinase (Selenophosphate synthetase)
FT                   (Selenium donor protein), Selenide water dikinase, AIR
FT                   synthase related protein, N-terminal domain, selD:
FT                   selenide, water dikinase, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64672"
FT                   /db_xref="GOA:Q931D0"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q931D0"
FT                   /protein_id="AAK64672.1"
FT                   /translation="MNTLAPRLTDLAHGGGCGCKLAPSVLQQLLANQPAARPFAQLLVG
FT                   NDMADDAAVWQVDDNTCVIATTDFFMPIVDDPRDFGRIAATNAISDVYAMGGKPILALA
FT                   IVGMPINKLDSTTIAKILEGGASICAEAGIPVAGGHSIDSVEPIYGLAVIGLCHPSEVR
FT                   RNGGVKAGDALILTKGIGVGIYSAAIKKNALPPGCYEEMIGSTTLLNRIGADLAADPDV
FT                   HALTDVTGFGVLGHGLEMARASQLSLTLRLSAIPFLSQAYMLAEQGFITGASGRNWASY
FT                   GADVVLPDDLPDWQRLLLADPQTSGGLLVACAPEKAGALVEKVRLAGYPLAGIVGTAAA
FT                   GAAQIKVIS"
FT   gene            complement(19209..19436)
FT                   /locus_tag="SMa0031"
FT   CDS_pept        complement(19209..19436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to hypothetical protein NB311A_21296 from
FT                   Nitrobacter sp; Nb-311A"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64673"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C9"
FT                   /protein_id="AAK64673.1"
FT                   /translation="MSEWIDFERWPDCKRMERPGIVFEVTNGDQTLLTGCVVPLPLPSD
FT                   WVAHPLRFRAVPQPRPRHSSPLPKPAGPQQ"
FT   gene            complement(19453..21108)
FT                   /locus_tag="SMa0034"
FT   CDS_pept        complement(19453..21108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0034"
FT                   /product="Serralysin-like metalloprotease"
FT                   /function="RTX toxins and related Ca2+-binding proteins"
FT                   /EC_number="3.4.24.40"
FT                   /note="Serralysin-like metalloprotease, C-terminal, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64674"
FT                   /db_xref="GOA:Q931C8"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C8"
FT                   /protein_id="AAK64674.1"
FT                   /translation="MPAATTYATTGNAYIDGLLGDWKWGIKDFTFSFPTSASFYSAGYG
FT                   NGEPLKGFAALSGAQQAATRAALDQFSSVANVTFTEITESATKHADLRLASSDAPSTAW
FT                   AYFPSTAAEGGDAWFNKSSGHYSRPVKGNYAYVTFLHETGHALGLEHAHEGNVMPVNRD
FT                   SMEYTVMSYRSYVGASTTTGYTNETWGYAQSLMMYDIAALQHMYGADFTTHSENTTYRW
FT                   SPTSGEMFVNGMGQGAPGGNKILLTVWDGGGTDTYDFSNYTTALKVDLRPGEWTTTSAA
FT                   QLAKLHYDGSKVAIGNIANALQYQGDTRSLIENAKGGAGNDAITGNAAANALWGNGGND
FT                   RLIGGDGNDNLAGGAGADRLDGGNGTDLANYSNATAGMVADLYSPGSNTGEAAGDTYVS
FT                   IERLYGSAFNDTLRGDNRANLLNGLAGNDMLNGRDGNDTLIGGNGADRLIGGGGADTFV
FT                   FQTTAQSAPAFRDVIDDFASGVDRMDLRSIDASSKAIGDQAFLFIGSSAFHGKAGELNF
FT                   RSGIVSGDVNGDGLADFQIRVMNLSALSGSDFLL"
FT   gene            21429..23051
FT                   /locus_tag="SMa0036"
FT   CDS_pept        21429..23051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0036"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /note="ABC transporter related, ABC transporter,
FT                   specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64675"
FT                   /db_xref="GOA:Q931C7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C7"
FT                   /protein_id="AAK64675.1"
FT                   /translation="MIRIENISKSNSHRILYIEASAALNRGEKIGLVGPNGAGKTTLFR
FT                   MITGQELPDEGQVAVEKGMTIGYFDQDVGEMAGRSAVAEVMEGAGPISAVAAELHELET
FT                   AMSDPDRMDEMDAIVERYGEVQARYEELDGYALEGRAREVLAGLSFSQEMMDGDVAKLS
FT                   GGWKMRVALARILLMRPDVMLLDEPSNHLDLESLIWLENFLKGYDGALLMTSHDREFMN
FT                   RIVTKIIEIDGGALTTYSGDYGFYDEQRALNARQQQAQFERQQAMLAKEIKFIERFKAR
FT                   ASHASQVQSRVKKLEKIDRVEPPRRRQTVAFEFLPAPRSGEDVVNLKSVHKTYGSRTIY
FT                   DGLDFMVRRRERWCIMGINGAGKSTLLKLVTGTTNPDKGSVSLGASVKLGYFAQHSMDL
FT                   LDGESTILQWLEERFPKAGQAPLRALAGCFGFSGDDVEKRCRVLSGGEKARLVMAAMLF
FT                   DPPNFLVLDEPTNHLDLDTKEMLIKALSAYQGTMLFVSHDRRFLSALSNRVLELTPDGI
FT                   NQYGGGYSEYVERTGQEAPGLRG"
FT   gene            complement(23398..24297)
FT                   /locus_tag="SMa0039"
FT   CDS_pept        complement(23398..24297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0039"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64676"
FT                   /db_xref="GOA:Q931C6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C6"
FT                   /protein_id="AAK64676.2"
FT                   /translation="MDRLTSMAVFVKAVDLGSFAAAAEALGLSGPMVGKHVRSLEDRLG
FT                   VQLINRTTRRQSLTEFGYVYYERCRVVLAEAQAADALASDQLSEPRGKLRVTMPVHFGR
FT                   HCVTPVLLELARKYPALELDLSFNDRIIDLAEDGFDLSIRTGVLEDRAGLIARRVARQP
FT                   MIVCASPSYLESHGCPEAPEDLAQHAAVVYRRSGPVSPWLFPRPGQSSSEVTPLHRFRL
FT                   DDLDAIADAAARGLGLAWLPYWLVRGRIEAGTLVRLLPEQPPFLYDCHAVWLQTPHLPL
FT                   KVRVAVDALAAQLPSFMT"
FT   gene            24399..25388
FT                   /locus_tag="SMa0041"
FT   CDS_pept        24399..25388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0041"
FT                   /product="zinc dependent oxidoreductase-releated quinone
FT                   oxidoreductase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64677"
FT                   /db_xref="GOA:Q931C5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C5"
FT                   /protein_id="AAK64677.2"
FT                   /translation="MARVVRFHELGGPEVLRIEDVHVPEPGPHEVRIRVKALGLNRAEA
FT                   LLRSGAYIETATFPSGLGLEAAGFVEKVGPGVQGFIPGDPVSVLPPKSMIRWPAYGELA
FT                   IFPAALLVRHPPSLSFEEAAAVWMQYLTAYGGLVDIGGLRRGDFVAITAASSSVGLAAI
FT                   QIANMVGAIPVAVTRTSAKRQGLLEAGAAHVIASMEEDLEAQLKRVSGQHGIRVVFDPV
FT                   GGPIFEPLAAAMAWGGILVEYGGLSPEKTPFPLFAVLSKSLTLRGYLVHELLADPGRLE
FT                   RAKAFILDGLVSGALRPIIARAFPFDQIVEAHRFLESNEQFGKIVVTV"
FT   gene            complement(25417..25683)
FT                   /locus_tag="SMa0044"
FT   CDS_pept        complement(25417..25683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity to Mesorhizobium loti msr7471"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64678"
FT                   /db_xref="InterPro:IPR018735"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C4"
FT                   /protein_id="AAK64678.1"
FT                   /translation="MCRNIKPLFNFDPPATDEEVRDAALQFVRKLSGTTKPSERNEAAF
FT                   ERAVDSIAACARELLDALETSQPPRNREEVAARARERSAMRFA"
FT   gene            complement(25848..26597)
FT                   /gene="cah"
FT                   /locus_tag="SMa0045"
FT   CDS_pept        complement(25848..26597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="SMa0045"
FT                   /product="Carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="Carbonic anhydrase II (Carbonate dehydratase II)
FT                   (CA-II), Carbonic anhydrase, eukaryotic, Eukaryotic-type
FT                   carbonic anhydrase, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64679"
FT                   /db_xref="GOA:Q931C3"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C3"
FT                   /protein_id="AAK64679.1"
FT                   /translation="MERRDFLRGLALLAACPLCVKTAYAAEGVHWRYEGEEGPEHWGSL
FT                   AKENSACSAGSQQSPIDIRGAVKADIPELTADWKSGGTILNNGHTIQVNAAGGTLRRGD
FT                   KSYDLVQYHFHSPSEHFVDGKSFPMEAHFVHKNAETGTLGVLGVFLVPGAANSTFASLA
FT                   EKFPRNPGEESPLITIDPKGLLPSSLSYWTYEGSLTTPPCSEIVDWMVAMEAVEVDPGD
FT                   IKKFTALYSMNARPALAGNRRYVLSSS"
FT   gene            26906..27154
FT                   /locus_tag="SMa5015"
FT   CDS_pept        26906..27154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5015"
FT                   /product="hypothetical protein"
FT                   /note="Similar to an approximately 75 amino acid-central
FT                   region of GntR-family transcriptional regulators; Possible
FT                   ORF fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5015"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07959"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW1"
FT                   /protein_id="ACF07959.1"
FT                   /translation="MVPEVLRHLESESLVANLPNKGPIVSRLDLNEAKQIDQIRVAVGG
FT                   RATVRGAARPAIVEALEASFKGIRECYASRLRRAPAT"
FT   gene            27295..27516
FT                   /locus_tag="SMa0050"
FT   CDS_pept        27295..27516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0050"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to small region found in
FT                   dehydrogenases; Together with adjacent ORF, SMa0052, may
FT                   comprise a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64681"
FT                   /db_xref="GOA:Q931C1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C1"
FT                   /protein_id="AAK64681.1"
FT                   /translation="MQVGFYDDFAERLAAKVRKMKVDNGFEPGADTGPLISQKALARVQ
FT                   EHISDAVAKGRECGLFFEPTVLMGGRWR"
FT   gene            27507..27713
FT                   /locus_tag="SMa0052"
FT   CDS_pept        27507..27713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0052"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to small region found in
FT                   dehydrogenases; Together with adjacent ORF, SMa0050,may
FT                   comprise a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64682"
FT                   /db_xref="GOA:Q931C0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q931C0"
FT                   /protein_id="AAK64682.1"
FT                   /translation="MEMKVARGNFGPVASLFKFSTEEAVFEMANNTEFGLASYFYSKDI
FT                   SKIFRVPEALEYGMVGINAGLIH"
FT   gene            complement(28295..29428)
FT                   /locus_tag="SMa0056"
FT   CDS_pept        complement(28295..29428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0056"
FT                   /product="dehydratase/enolase"
FT                   /note="Good similarity to racemases, enolases and
FT                   dehydratases in the first 283 amino acids, but not across
FT                   the entire length of the predicted protein, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64683"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B9"
FT                   /protein_id="AAK64683.1"
FT                   /translation="MKRPRITDIRATTVTVPLEAPLRHSNGAHWGRFVRTIVEVETDVG
FT                   IVGLGEMGGGGESAEAAFRALKPYLLGHDTFELENLRFMICNPTASLYNNRTQMHAAIE
FT                   FACLDIMGKFLGVPVCDLLGGKMRDAVPFASYMFFRLPNKDTGEGETRTADQLIEQTLA
FT                   LKKKCGFTSHKLKSGVFPPDYELEVFRAWAKALGPDSVRYDPNAAFSVEEAIRFAKGIE
FT                   DLNNDYYEDPTWGLNGMRRVRENTTMPLATNTVVVNFEQLATNILNPAVDVILLDTTFW
FT                   GGSALREGGGRLRDLPTRHCGTFVGRTRHPARHHASPRRGSPEPRLPRGCALSPTHGRY
FT                   HRRRPDALRERHYQGADGAGSRGGARSRQARAVRRPP"
FT   gene            complement(29492..30688)
FT                   /locus_tag="SMa0058"
FT   CDS_pept        complement(29492..30688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0058"
FT                   /product="N-acylglucosamine 2-epimerase family protein"
FT                   /function="Highly conserved protein containing a
FT                   thioredoxin domain"
FT                   /EC_number="5.-.-.-"
FT                   /note="Glycoside transferase, six-hairpin, N-
FT                   acylglucosamine 2-epimerase (GlcNAc 2-epimerase), family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64684"
FT                   /db_xref="GOA:Q931B8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B8"
FT                   /protein_id="AAK64684.1"
FT                   /translation="MKPIPDFRSKDFLLAHMREIMDFYHPICLNEEDGGYYNEYRDDGF
FT                   ITDRKTQHLVSTTRFIFNYATAAVLFERPDFAEAAAHGVRYLDEVHRDPEHGGYYWLMR
FT                   GRDAVDATKHCYGHAFVLLAYATAMKAGIPGTGARVSQTWDLLENRFWEPDRELYKDEV
FT                   SRDWGATSPYRGQNANMHMTEAMLAAYEATGEIRYLDRAETLARRICVELAANTQDVVW
FT                   EHYRQDWSVDWDYNKDDPKHLFRPYGYQPGHMTEWTKLLLILERYRPQDWLLPKALLLY
FT                   ETALAKSADLEFGGMHYSYGPEGKLYDLDKYHWVHCETIAAAAALAGRTGRERYWQDYD
FT                   RLWRYSWRHLIDHEYGCWFRILSPDGVKQSDIKSPSGKTDYHPFGACYEILRVLGEAQ"
FT   gene            complement(30703..31488)
FT                   /locus_tag="SMa0059"
FT   CDS_pept        complement(30703..31488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0059"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64685"
FT                   /db_xref="GOA:Q931B7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B7"
FT                   /protein_id="AAK64685.1"
FT                   /translation="MSDFNGKSIVVTGGSLGMGLACAHRFAAGGGKVTIVANDKASVDE
FT                   AVTSIGDNAAGFVGDVRSKADMNAAVQAAVSRHGGVDILACCAGIQRYGTVVDTADEVW
FT                   DDVLDINLKGIFLASKFAIPEMRKRGGGAIVAISSVQAYASQTGVAAYTASKGAINALV
FT                   RAMALDHAGDNITVNAVCPASIDTPMLRWAADLWKGEGTVEATLETWGKGHPLGRVGKP
FT                   SEVAELVAFLASEKARFITGADIKIDGGVLSKLGIVIPD"
FT   gene            complement(31488..32423)
FT                   /locus_tag="SMa0060"
FT   CDS_pept        complement(31488..32423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0060"
FT                   /product="gluconolactonase/regucalcin homolog"
FT                   /note="Similar to gluconolactonases and to senescence
FT                   marker protein 30/regucalcin; May bind calcium ions; Is
FT                   similar to the carboxy-terminus of S; meliloti SMa0717,
FT                   function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64686"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B6"
FT                   /protein_id="AAK64686.1"
FT                   /translation="MSATVSLLLDAKDIVGESILWCGDEKALYWVDIVGKRIHRLEPEN
FT                   GRHDTWPTPDFVTSIGMRKDGGFIVGLSRNVCLWTPDGPFEEFAMPEPDLPENRLNEGR
FT                   VAPDGSFWVATMQSNLDAGGSPKDMDRQSGAVYRIDPTGHVSQLTPNEYGITNTMGWTR
FT                   DNRFFFADTLANEIYMFDCDLAARRIDNRRTIVAGFARGLPDGSCLDADDRLWNCRVAG
FT                   GAAVAGFDGAGRLMHLIELPASWPTSCTFGGPVLSTLYVTSARFTMTGDHLDMHPLEGG
FT                   LFAVEGVGHGVEEPKFGQAPDKFPSVSEIA"
FT   gene            32634..33323
FT                   /locus_tag="SMa0062"
FT   CDS_pept        32634..33323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0062"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /note="GntR, C-terminal, Bacterial regulatory proteins,
FT                   gntR family, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64687"
FT                   /db_xref="GOA:Q931B5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B5"
FT                   /protein_id="AAK64687.1"
FT                   /translation="MTRDIKISAAEHCYRTLSRKIIGLELKPNEPIGEHALAGLLGVSR
FT                   TPVREALSRLSAEGLVDLRSRAGVVVAPIRMDAVRTAQFVREQLELAIVAEAAQQSNRR
FT                   VLLGIRQAIEEQELAILEDNPDLFFECDERMHALYCSLAGRDGVWAFISDAKKHMDRVR
FT                   RLSIQAGQLDQLVEDHRRVLKAVGEGDATKAQEIMRLHLRRAVVDLGELSQRFSSYFAL
FT                   DAAGDAR"
FT   gene            33453..34187
FT                   /locus_tag="SMa0063"
FT   CDS_pept        33453..34187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0063"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64688"
FT                   /db_xref="GOA:Q931B4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B4"
FT                   /protein_id="AAK64688.2"
FT                   /translation="MIELKAEEQSSSGRSGAEGLLGGVMTAVKTHIRENGLQVGDSLPS
FT                   EGTFAEKLGVSRSVVREAYRSLAALTLIDIGNGRRPRVAAPKADVLALVTDHAVHTDQV
FT                   TIQQIFDVRRTVERRTVVLAAMRRTDKEAAEIVALAEAMQRDFDQPVRVMEHDIAFHEA
FT                   IGRASRNPMFALIVGSFHVVTRHTWPIGWASRGSNETRQESIDGHMTIAQAIANGDPAK
FT                   GEEAMVEHFDLTVKALLAAGVY"
FT   gene            34190..35392
FT                   /locus_tag="SMa0064"
FT   CDS_pept        34190..35392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0064"
FT                   /product="dehydratase/enolase"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64689"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B3"
FT                   /protein_id="AAK64689.2"
FT                   /translation="MKITELETVRVRDFPNILWVRIHTDEGLVGLGETFFMAQTVETYI
FT                   HEVVAPKLVGRDPLEIDRISKDLTGYLGFRSTGAEMRGNSAVDIGLWDLFGKATNLPIA
FT                   QLLGGFSRREIRTYNTCAGNTYMRDAKGQQTANYGIGGPRRDYDDLNGFLERADELAED
FT                   LLSEGITAMKIWPFDIAAEKSGGQYISGPDLRKALEPFEKIRKRVGDRIDIMVEFHSMW
FT                   QLTPAIQIARALEPYATFWHEDPIKMDSLSSLKRYAAASRAPLCASETLATRWAFRDLM
FT                   ETDAAGVVMLDLSWCGGISEAKKISTMAEAWHLPVAPHDCTGPVVLAASTHLSLNAPNA
FT                   LVQESVRAYYKTWYADLTTQLPTVTNGMITIPPGAGHGVDLAPDLDRKFEVSRRSSQIE
FT                   D"
FT   gene            35455..36147
FT                   /locus_tag="SMa0065"
FT   CDS_pept        35455..36147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0065"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64690"
FT                   /db_xref="GOA:Q931B2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B2"
FT                   /protein_id="AAK64690.1"
FT                   /translation="MQNIKPQRVLSAIEAVGPQVYRILREQIIQAELVPGARISEAEIA
FT                   RSLSISRQPVREAFIKLAEEGLVQVLPQRGTYVTRISTASVMDVRFVREAIEADIVRQV
FT                   AGEHPAAIVDELREQIARQKQVPHDDRAAFLRLDELFHHTLATAAGRAHAWSVIESVKA
FT                   QMDRVRFLSVDDLQIGRLIEQHERIVDAIAARDVGGAEQALRMHLREILKSLPEIARSR
FT                   EEFFDGTG"
FT   gene            36205..37167
FT                   /locus_tag="SMa0067"
FT   CDS_pept        36205..37167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0067"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Expression of SMa0067 is induced by ribose and
FT                   mannose, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64691"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B1"
FT                   /protein_id="AAK64691.1"
FT                   /translation="MIAGTALGLTLMAPAASAEGLSIAFISHSSASNTFWQAVKKGYDD
FT                   ACEKVGASCQLILTQTEGAVEQAVANLQAAIASRPDAIFVAIVDNNAYDNVIKEAVDAG
FT                   ILVLAVNVDDSEGAKGNARKAFIGQGFTAAGYSLAKAQSENFPKDGPLNLLVGVNAPGQ
FT                   TWSEQRAGGVTKFLEEYKAEHSDREVNITRIDSATDLALTADRIGAYLNANPDTAAYFD
FT                   TGYWHAGVAKVLKDRGIEPGKVLLGGFDLVPEVLQQMEAGYVQVQVDQQPYMQGFIPVM
FT                   QAYLWKTAGLTPSDVDTGQGIVTPKDVPTILELAKQGLR"
FT   gene            37353..38336
FT                   /locus_tag="SMa0070"
FT   CDS_pept        37353..38336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0070"
FT                   /product="ABC transporter permease"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64692"
FT                   /db_xref="GOA:Q931B0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q931B0"
FT                   /protein_id="AAK64692.1"
FT                   /translation="MKRFLKIYLDKPELAGLALLFVLVLVFQAKSNGILLSFENMRGVM
FT                   GLLPEMALVAIGVTLLMICGEFDLSVGSVFALMPMSMAVLLNSGVPFTVAVLLGLMICG
FT                   AIGFINGYVTLQFSIPSFITTLGMLFIARSLTIVISGGFPPLLPPDLPTWLFTDYIWQG
FT                   SPFRMSFLWFVVIAALVAALLSLTNFGNWIRATGGFNEAAASMGIPVKRVKIVCFMLCS
FT                   VLAGFAGLLQVLRLGSPLPSIGEGLELQAVAAAVIGGTALAGGIGTVFGAIIGTLLIRT
FT                   IDNGLVLSRVDANWFKFAIGVLTMFAVIANAWMGKMSRKIKVEAHK"
FT   gene            38333..39064
FT                   /locus_tag="SMa0072"
FT   CDS_pept        38333..39064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0072"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64693"
FT                   /db_xref="GOA:Q931A9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A9"
FT                   /protein_id="AAK64693.1"
FT                   /translation="MTTPIIECRNLQKWYSGVHALKNVDLTIHPGETVGLVGDNGAGKS
FT                   TLIKILSGVHHQDSGDVLIEGRRVALRSPKDAMRYGLETIYQYNSMVPTMSIARNLFIG
FT                   REPMKWSVFGVGIMDQKRMRVESIQAIADVDLHLRSPDALVGELSGGQRQGVAIARAMH
FT                   FKSKVLILDEPTNHLSVKETDKVIGFVRGLKAQGLTGIFISHNMQHVFQSCDRIVAMAR
FT                   GEIVFDKPTADTSIDEVHALL"
FT   gene            39072..39830
FT                   /locus_tag="SMa0074"
FT   CDS_pept        39072..39830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0074"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64694"
FT                   /db_xref="GOA:Q931A8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A8"
FT                   /protein_id="AAK64694.1"
FT                   /translation="MTELSGKTILITGALGTLGRAQAERLGRAGAGLLLLLDRPGAEAG
FT                   EGFAASLAAAHETMAIYVGEDLNNLASAEKRAATLSSEHGGIDILINNAALIINKPFEE
FT                   FSLEEYEDQVRVNSSAAFALARAVTPGMKQKRYGKIVNFCSLTLNGRWDGYVPYVASKG
FT                   AMLGLTKALARELGPHGVRVNAVSPGAVVSEAEERVFADRLQQYNDWIVENQSLKARIQ
FT                   PSDVADLVHFLVSPASDMISGQNIAIDGGW"
FT   gene            39830..40717
FT                   /locus_tag="SMa0077"
FT   CDS_pept        39830..40717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0077"
FT                   /product="conserved hypothetical protein"
FT                   /function="Galactose mutarotase and related enzymes"
FT                   /note="Weak similarity to E; coli GalM (Aldose 1-
FT                   epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64695"
FT                   /db_xref="GOA:Q931A7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A7"
FT                   /protein_id="AAK64695.1"
FT                   /translation="MPAIELSNGEARLLARPDLGAGLTAFDVLHDGVWQAIFRRVDPST
FT                   AHPFALSNILLVPFSGRVSGGGFTFDGTFHALPRNVETELYPIHGNGFSAAWDVASLSA
FT                   DLLTLTLSAEGPGPFRYDATMSYRLQGAGLLMELSLVNRARIRLPYGAGFHPWFVREPD
FT                   TTLHAPARGVWLEQSDHLPKAHDAIAAQADLDFNRPKPLPARWINNWFDGWDGKARIHW
FT                   PSRGLAVDVDASEGLRQYVVFSPAAAADFFCFEPVTHPVDAFNLPGKAEAHGLKILEPD
FT                   ESLAVSARVAADFG"
FT   gene            40959..41981
FT                   /locus_tag="SMa0078"
FT   CDS_pept        40959..41981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0078"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /function="Transcriptional regulators"
FT                   /note="Periplasmic binding protein/LacI transcriptional
FT                   regulator, Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family, ccpA: catabolite control
FT                   protein, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64696"
FT                   /db_xref="GOA:Q931A6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A6"
FT                   /protein_id="AAK64696.1"
FT                   /translation="MSSQERKKSRVTLLDVARHASVSRATASLVLRKSPLVGSETRARV
FT                   EQAMRDLGYVYNIGAARLRVERSQIIGAIVPNLTNPFFAELLSGIEEAIGATGKVVILA
FT                   NSGERVERQSMLLQRMREHGVDGVVLCPAAGTEPDLSEQLAAWGMPVVQVLRHISVDMD
FT                   YVGVDYAGGMRQAVDYLASLGHEKIAFAVHGPFHSAYRERVDGFRDAMLAKAFDPEILI
FT                   HLPAQLGEIADSTHLLFAKATQPTAVICFNHLVALGLAAGLHDCGLTIGRDLSLIGFDD
FT                   VADAEAIRPRLTSVSTGPTAIGEMAARLLVERIANPDLPPRRVVNDTTLSVRQSCGRPA
FT                   "
FT   gene            42106..42774
FT                   /locus_tag="SMa0079"
FT   CDS_pept        42106..42774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0079"
FT                   /product="ABC transporter, permease"
FT                   /function="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="Binding-protein-dependent transport systems inner
FT                   membrane component, Binding-protein-dependent transport
FT                   system inner membrane component, HEQRo_perm_3TM: amino acid
FT                   ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64697"
FT                   /db_xref="GOA:Q931A5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A5"
FT                   /protein_id="AAK64697.1"
FT                   /translation="MYEFNFAPVLASFDQLLVGAWLTVRLSCAAMLIGLVVSVFCAWGK
FT                   TAGPAILRHVIDGYIEIIRNTPFLVQIFFIFFGMPSLGLRLSPNSAALLALVVNFGAYG
FT                   TEIIRAGIESIHKGQVEAGWALGLSRPQIFRYVVMKPALRTVYPALTSQFIYLMLNTSV
FT                   VSVISADDLAAAGNDLQSATFASFEVYIAVTLIYLALSVGFSALFYALEKAAFKYPLGR
FT                   "
FT   gene            42785..43441
FT                   /locus_tag="SMa0081"
FT   CDS_pept        42785..43441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0081"
FT                   /product="ABC transporter, permease"
FT                   /function="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="[amino acid], Binding-protein-dependent transport
FT                   systems inner membrane component, Binding-protein-
FT                   dependent transport system inner membrane component,
FT                   HEQRo_perm_3TM: amino acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family,
FT                   specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64698"
FT                   /db_xref="GOA:Q931A4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A4"
FT                   /protein_id="AAK64698.1"
FT                   /translation="MIRAFGWNEFLVIVAAAQWTIALSAIAFAGGSVGGLLVALMRVSE
FT                   TRALRLFATGFIRVFQGTPLLMQLFLVFFGMNIFGFAINPWIAATIALALHASAFLGEI
FT                   WRGCIEAVPKGQREAATALGLRYFRSMRHVILPQAARIAVAPTVGFLVQLIKGTSLASI
FT                   IGFTELTRQGQIINNATFSPFLVFGTVAAVYFLLCWPLSLIARRMETRFSRATAR"
FT   gene            43471..44286
FT                   /locus_tag="SMa0082"
FT   CDS_pept        43471..44286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0082"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64699"
FT                   /db_xref="GOA:Q931A3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A3"
FT                   /protein_id="AAK64699.1"
FT                   /translation="MRREGLMNISRRIAISVLGAAIVAGLVAPAAAQTVETIKSAGTVK
FT                   VGMLVDFPPFGIMDANNQPDGYDADVAKLLAKELGVEVTIVPVTGPNRIPYLQSNQVDL
FT                   LVASLGITEERAKNVDFSQPYAGISIGVFGAADLAVTKPEDLAGKTIGVARASTQDTAT
FT                   TKIAPQDANIQRFDDDASAVQALLSGQVELIGVSNVVAAQIEAAAPGRFNQKLQLSQQV
FT                   QGIAVRKGSSEMLKFVNGFLDKVKADGQLNAIHEKWLGSPLPEFVTEAK"
FT   gene            44302..45081
FT                   /locus_tag="SMa0083"
FT   CDS_pept        44302..45081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0083"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ABC transporter, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64700"
FT                   /db_xref="GOA:Q931A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A2"
FT                   /protein_id="AAK64700.1"
FT                   /translation="MNTEREYASPPDSREALDPAVRMEGVNKWYDAFHALKNIDLTVGR
FT                   GERIVICGPSGSGKSTLIRCINQLETIHSGRIVVDGHDLTAGGRNVDLVRQETGMVFQQ
FT                   FNLFPHMTVLENCTLAPMKVRGLAKAEAEETAMKYLKRVRIPEQAVKYPAQLSGGQQQR
FT                   VAIARALCMNPKIMLFDEPTSALDPEMVKEVLDTMVDLANEGMTMLCVTHEMGFARSVA
FT                   DRVVFMDRGEVLEIAPPDAFFGAPQHERTRFFLGQIS"
FT   gene            45099..46052
FT                   /locus_tag="SMa0085"
FT   CDS_pept        45099..46052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0085"
FT                   /product="dehydrogenase"
FT                   /note="best similarity is to lactate and phosphoglycerate
FT                   dehydrogenases, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64701"
FT                   /db_xref="GOA:Q931A1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4DGS"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A1"
FT                   /protein_id="AAK64701.1"
FT                   /translation="MEFRNVKPDLLLVEPMMPFVMDELQRNYSVHRLYQAADRPALEAA
FT                   LPSIRAVATGGGAGLSNEWMEKLPSLGIIAINGVGTDKVDLARARRRNIDVTTTPGVLA
FT                   DDVADLGIALMLAVLRRVGDGDRLVREGRWAAGEQLPLGHSPKGKRIGVLGLGQIGRAL
FT                   ASRAEAFGMSVRYWNRSTLSGVDWIAHQSPVDLARDSDVLAVCVAASAATQNIVDASLL
FT                   QALGPEGIVVNVARGNVVDEDALIEALKSGTIAGAGLDVFVNEPAIRSEFHTTPNTVLM
FT                   PHQGSATVETRMAMGKLVLANLAAHFAGEKAPNTVN"
FT   gene            46069..46401
FT                   /locus_tag="SMa0087"
FT   CDS_pept        46069..46401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to SMa0518 of S; meliloti & Atu4686 of A;
FT                   tumefaciens"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64702"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q931A0"
FT                   /protein_id="AAK64702.1"
FT                   /translation="MIVRQALFEGTIRPGREQAFRGYVEEKLVPLWRAFPGVREVRVLH
FT                   AVDRDEGAPAFAMILSTTYDDREALARALASPVRYESRELTKGLLEMFEGHIHHHVFDL
FT                   DARSTA"
FT   gene            46684..47100
FT                   /locus_tag="SMa0089"
FT   CDS_pept        46684..47100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted by Pfam & InterPro to have an
FT                   Endoribonuclease L-PSP domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64703"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z9"
FT                   /protein_id="AAK64703.1"
FT                   /translation="MKRNEQMTRRDAVFPANRHALYEAHGYSAAIRSGDLLFVSGQVGS
FT                   RSDGSPEPDFGRQVQLAFDNLRATLNAAGCTFDDIVDVTTFHTDPENQFETIMAVKNQV
FT                   FGTPPYPNWTALGVNWLAGFDFEIKVIARIPEAA"
FT   gene            47225..47920
FT                   /locus_tag="SMa0091"
FT   CDS_pept        47225..47920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64704"
FT                   /db_xref="GOA:Q930Z8"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z8"
FT                   /protein_id="AAK64704.1"
FT                   /translation="MKTALAVFGGFVLSLALFLSGAVVAVLFLTGKPARQPQLDVNQSE
FT                   VWTKQPRAVDRTAQQFERLPARPAPSDVNASREPETPAMANEAEKERSPEPLDRMATAS
FT                   IQSPPAEEEPTASTVPAAHAEWCARRYRSYRPFDNTYRSFSGGRRSCNSPYMDAAWGPS
FT                   EDPSPVPRGIDAEDADDPSTQMEYSAGDGEAIRLTQEHVAYCFSRYRSYRPEDNSYQPY
FT                   SGGPRRQCR"
FT   gene            48182..49033
FT                   /locus_tag="SMa0093"
FT   CDS_pept        48182..49033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0093"
FT                   /product="Branched-chain amino acid aminotransferase"
FT                   /function="Branched-chain amino acid aminotransferase/4-
FT                   amino-4-deoxychorismate lyase"
FT                   /EC_number="2.6.1.21"
FT                   /note="D-alanine aminotransferase (D-aspartate
FT                   aminotransferase) (D-amino acid aminotransferase) (D-amino
FT                   acid transaminase) (DAAT), Aminotransferase, class IV,
FT                   Aminotransferase class IV, D_amino_aminoT: D-amino acid
FT                   aminotransferase, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64705"
FT                   /db_xref="GOA:Q930Z7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z7"
FT                   /protein_id="AAK64705.1"
FT                   /translation="MGRIVYVHGQFVPEEEARIGLFDRGFLFGDAVYEVTAVIGGRMID
FT                   NDLHLGRLERSLRELAIPLGLSRKEIAGVQAELIARNALLDGTVYLQVSRGEADRDFLY
FT                   SDALAPRLVGFTQAKTLTGTKAQQDGISVDLADDPRWHRRDIKTAMLLGQVMAKQAARA
FT                   RGFDDVWLVENGLVTEGASSTAHVITGDGRILTRAASRATLPGCTQRALALLCAAEDLA
FT                   IEERAFTPNEAQAAAEAFQTSASSLVMPVVRIGERVVGNGKPGPMTRKLQALYLEAAGV
FT                   PV"
FT   gene            49084..50121
FT                   /locus_tag="SMa0095"
FT   CDS_pept        49084..50121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0095"
FT                   /product="D-aminopeptidase"
FT                   /function="L-aminopeptidase/D-esterase"
FT                   /EC_number="3.4.11.19"
FT                   /note="Peptidase S58, DmpA, Peptidase family T4, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64706"
FT                   /db_xref="GOA:Q930Z6"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z6"
FT                   /protein_id="AAK64706.1"
FT                   /translation="MKTARELGLIPQGRLEPGPGNAITDVAGVSVGHRSLRGEGLFTGV
FT                   TAILPHAGDVFRVKPRAAVEVINGFGKSAGLMQVAEIGTIETPIVLTNTFGVAACTEAL
FT                   VRRAISANPAIGRKTSTVNALVCECNDGSINDIQALAVTPADAEAALDAARTGPVEQGA
FT                   VGAGSGMTAFGFKAGIGTASRRMRVGKRDFTLGTLVLANFGAAGDLVLPDGRRPDPRVP
FT                   AGPERGSVIVVMATDLPLADRQLQRVARRAGAGLARLGAFWGHGSGDVALCFTTADPVE
FT                   HEPATAFTTQERLADGHIDIAFRAAADTTQEAVLNALCMAPAMPARNGRIYPCLADWLM
FT                   ENPSP"
FT   gene            complement(50138..51079)
FT                   /locus_tag="SMa0097"
FT   CDS_pept        complement(50138..51079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0097"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64707"
FT                   /db_xref="GOA:Q930Z5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z5"
FT                   /protein_id="AAK64707.1"
FT                   /translation="MEIKWLEDFVTLADTSSFSRAAELRNVTQPAFSRRIKQLESWLGA
FT                   TLISRATMPAELTPAGRNFLPVAQEAIRTFYAAREVLRLPHEPGLIRFAALHTLTVTFF
FT                   PRWLKTLEAAGGSFSTSLIPDRGGIEANLDALVGDEADFFLTYAHPEVPFHLDSGQFSS
FT                   LTVAHDRLIPLVAAEIVLSGDPQPGLNLLDRAIAQPRLAIPYLSYGFNSFFGVALSRLL
FT                   LRRPPFRRRTTHENTISAGLMNMAVTGAGVCWLPESLAREEIDARRLVPASADEGWNLD
FT                   LEIRLYRHAASRNRKVEELWATAQRLLEPAPA"
FT   gene            51262..52887
FT                   /locus_tag="SMa0101"
FT   CDS_pept        51262..52887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0101"
FT                   /product="Amidohydrolase"
FT                   /function="Predicted metal-dependent hydrolase with the
FT                   TIM-barrel fold"
FT                   /note="May be involved in metabolism of lysine, ectoine,
FT                   and asparagine; Expression of SMa0101, is induced by
FT                   lysine, ectoine, and asparagine, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64708"
FT                   /db_xref="GOA:Q930Z4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z4"
FT                   /protein_id="AAK64708.1"
FT                   /translation="MAFGIKADLILINGRIWRGREEGISEALAVWQGKILATGSDTDIL
FT                   GLKGPRTEVIDLEGRFATPGLIDNHLHLIATGMAMGWVDATPASAPTLAALMGRISDRA
FT                   ATTPKGGWVRARGYDQVKLDTGRHPTRDDLDRVAPDHPVLLTRACGHVSIANSRALELA
FT                   GITEATAVPEGGVIGVTEGRLNGFLAENAQNLVKAAMPSATTEDLIDGIERAGRYLLSF
FT                   GITSCMDAAVGQVSGFAEIQAYEMAKLSGRLPVRVWLTLLGDPGVSIVEDCWRAGLLSG
FT                   AGDDMLRVGGVKVFLDGSAGGRTAWMTRPYRGEPDNIGVQMLPDAEVEAVVKACHDRGY
FT                   QMVCHAIGDGAIEQLITAYEKALAANPDPDRRHRVEHCGFSTPDQNARMKAAGILPAPQ
FT                   MAFIHDFGDSYISVLGEERGRLSYPIGTWMRMGLKPSTGSDSPVCSPDPFPNLHAMLTR
FT                   QTGKGTVMEASERLSRQEALQTYTEYGAYSQKAEGVKGRLVPGQWADIAVFDNDLLAAP
FT                   PETILSDTSCVLTLLAGRVVHDAR"
FT   gene            52944..54536
FT                   /locus_tag="SMa0104"
FT   CDS_pept        52944..54536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0104"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Likely involved in transport of lysine, ectoine, and
FT                   asparagine, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64709"
FT                   /db_xref="GOA:Q930Z3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z3"
FT                   /protein_id="AAK64709.1"
FT                   /translation="MLKRLTLAAMLSLGVAAGALAAGERHGGTLVFTAPYGSSFATLDV
FT                   QSSPNTQEEFITQAIHRALYSWDSNQNKPVLELATSEEVSEDGKVHTYHLRKNAVFHNG
FT                   KPLTADDIIYSYKRIANPENAFPGASFIAVIKGAEDYIAGKADEISGLKKIDDHTLEIT
FT                   YTGTINPGFPLMQNTTVIYPSNVEGESTFGKNPVGLGAFVFKEHVPGSQVVVEKFDKYY
FT                   EEGRPYLDRINIVLMAEDAARDVAFRNKEIDVSILGPTQYQAYQGEEGLKDHLLEVAEV
FT                   YTRNIGFNPAFEPFKDKRVRQAINHAINAPLIIERLVKNKAYPASGWLPISSPAFDKDK
FT                   APYAYDPEKAKALLAEAGYADGFEFEVTASPNESWGVPIVEAILPMLKKVGITVKPKPV
FT                   ESSTLGEAVTTNNFQAFIWSNLSGPDPLNALRCYYSKTAQSACNYTSYASPEFDKLYEA
FT                   AQQERDSAKQNDLLRQANNIVQDDAPVWFFNYNKAVMAYQPWIHGLVPNATELAIQPYD
FT                   EIWIDETAPSSRQ"
FT   gene            54624..55559
FT                   /locus_tag="SMa0105"
FT   CDS_pept        54624..55559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0105"
FT                   /product="ABC transporter, permease"
FT                   /note="Likely involved in transport of lysine, ectoine, and
FT                   asparagine, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64710"
FT                   /db_xref="GOA:Q930Z2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z2"
FT                   /protein_id="AAK64710.1"
FT                   /translation="MLRFTLRRVLQIIPTVVVVALLIFVIFSVVPGTFAASLFADGRRA
FT                   ADPQMIARLNEEFGLNKPLMERFVTYVTDLAQFDLGTSFRTRQPVIDLINDRMWASLQL
FT                   AIAAMIFALVISVPLGFVAALRPGSVLDTVTMIGAVSGLSMPQFWLGLLMMYLFALQLN
FT                   WLPSFGYGDGSFRNLILPAVTLGVTPLALLARTTRAGVLDVLNADFIRTAHSKGMSEAK
FT                   VVRWHVARNALVLIVTTVGLQFGSLIGQAVVIEKLFAWPGIGSLLVDSVASRDIPVVQG
FT                   TILVIVLWFLVINTAVDLIYAAIDPRIKQE"
FT   gene            55565..56386
FT                   /locus_tag="SMa0106"
FT   CDS_pept        55565..56386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0106"
FT                   /product="ABC transporter, permease"
FT                   /note="Likely involved in transport of lysine, ectoine, and
FT                   asparagine, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64711"
FT                   /db_xref="GOA:Q930Z1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z1"
FT                   /protein_id="AAK64711.1"
FT                   /translation="MRLGFNFWLGAGLTTLVILAGILAPWIAPFDPVLDADLMNSELPP
FT                   DATFWFGTDGQGRDVYTRILYGAQISLTVGIVSQVINSIIGVTLGMTAGYWGGWWDDLV
FT                   NGFTNVMLAIPSLIFALAVMAVLGPGLPSLLIALGLTNWSWTCRIARSSTLSLKSLGYV
FT                   QAAQTLGYGDLRIMFTQILPNMMGPILVMATLGMGSAVLSEAALSFLGLGIQPPFPSWG
FT                   SMLTDARQLIQLAPWVAIFPGLAIFLSVLGFNLLGDGLRDSLDPHMRTRNP"
FT   gene            56383..57297
FT                   /locus_tag="SMa0108"
FT   CDS_pept        56383..57297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0108"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Likely involved in transport of lysine, ectoine, and
FT                   asparagine, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64712"
FT                   /db_xref="GOA:Q930Z0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Z0"
FT                   /protein_id="AAK64712.1"
FT                   /translation="MTEPLLDIRDLHLGIAVGRSVNRPLLKGVSFQIMPGEAYGLVGES
FT                   GSGKSVTSLAVMGLLKKPLAVSGGEILFKGQNLLELPKREMRRLRGNRIAMIFQEPMTA
FT                   LNPLSTIGRQIAEMFVLHQGKSWDEAQKLAIEALASVRVPNPDRRARNYPHQMSGGLRQ
FT                   RVMIAMALACNPDLLIADEPTTALDVTVQAEVLRLIKELCAERGTAVLFISHDLGVIAS
FT                   ICQRVGVMYAGCLVEENETRALFAAPRHEYTRGLLGALPRFGSRSLHGRQRLVDIDSII
FT                   ADRSKLIETRFIAPRGAEEGGQP"
FT   gene            57294..58256
FT                   /locus_tag="SMa0110"
FT   CDS_pept        57294..58256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0110"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Likely involved in transport of lysine, ectoine, and
FT                   asparagine, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64713"
FT                   /db_xref="GOA:Q930Y9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y9"
FT                   /protein_id="AAK64713.1"
FT                   /translation="MTDPLLEVDDLHVRFSVSGGGLLGTGRRMLHAVNGIGFSLSKGEC
FT                   LSIVGESGCGKSTTALSVLGLQEPTEGTIRYRGQPLTGPGAPGRMQRAKAVQMVFQDPY
FT                   ASLNPRQSVRTSLAAPLRLHGITAASEIADRIEVMLANVGLTPEQANRYPHEFSGGQRQ
FT                   RIGIARALILEPEIVVLDEPVSALDVSIRAQIINLLLDLQEKLGLGYLMISHDLSVVEH
FT                   MSDRVLVMFFGQVVEEGGWRDIFERPAHPYTRRLIAAIPDPDAALNPGTKDHFADVPLP
FT                   DGRSFAVDGSTAPDVFSAPPPSELVEIAPGHRMRLVPAV"
FT   gene            58298..58612
FT                   /locus_tag="SMa5001"
FT   CDS_pept        58298..58612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5001"
FT                   /product="hypothetical protein"
FT                   /note="Has weak similarity to PilT-like proteins and StbB-
FT                   like plasmid stability proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5001"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07960"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW2"
FT                   /protein_id="ACF07960.1"
FT                   /translation="MRKQRVREFPRFGESELLFGIGVLPDGRRKKALTEMLDGVLELFG
FT                   DRVLPFDIGAARCYAKLAVTARAAGKEFPTRPTDILPPLPPPGDLSSRQAIPARQSLPS
FT                   "
FT   gene            complement(58803..59234)
FT                   /locus_tag="SMa0112"
FT   CDS_pept        complement(58803..59234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bll5503 of B; japonicum & to Mll1601 of
FT                   M; loti"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64714"
FT                   /db_xref="GOA:Q930Y8"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y8"
FT                   /protein_id="AAK64714.1"
FT                   /translation="MQAGGVSMTNAQCACGALRLMLNEPPQLTALCHCLACQRRTGAPF
FT                   SANAFYSIDCVEISGVSTEYIRTAESGRKVRMHFCPTCGSTLFWKADASPSWIGVAVGS
FT                   FADPAFAPPAMSVFERSKHKWVQLEGTVEHFQDLPIGQY"
FT   gene            59703..62264
FT                   /locus_tag="SMa0113"
FT   CDS_pept        59703..62264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0113"
FT                   /product="Sensor histidine kinase"
FT                   /function="FOG: PAS/PAC domain"
FT                   /note="PAS, HWE histidine kinase, sensory_box: PAS domain
FT                   S-box, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64715"
FT                   /db_xref="GOA:Q930Y7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y7"
FT                   /protein_id="AAK64715.1"
FT                   /translation="MKSRESPVYMSNVEEFPLTGRVLTEYEALITSAPTALDAIPGAVY
FT                   VCDHEGWLVGYNAEAAELWGRQPSLSAPRERFCGSQRLFLSDGSPMDHQECPMAEAIKT
FT                   GVSTRNAEVIIERPDGSRIFALVNIRPLRDHRGVIQGAINCFQDISQQKRIEAEVNCKS
FT                   KDLEDFFENSAIGLHIVSAAGIILRANKAELELLGYPADEYVGRHIAEFHADAPVIGDI
FT                   LDRLSCGEKLDRYPARLRARDGSIKHVLITSNSRFEDGKFVNTRCFTTDITSLHETENA
FT                   WRETEERLAATYQAATIGIAESDADGRLLRVNDAFCTMLGRSREQLLNMTFLDYTHEDD
FT                   RDEEARCYARQVSGETDTYAIRKRAVKADGTVIYLDVYSSTVRDRTGRFRYGVRVLLDV
FT                   TEAKRMDDRRRESEQHMRDLLEALPAAVYTTDAEGRITFFNKAAVEMAGRTPQIGDKWC
FT                   VTWRLYRPDGTYLPHDQCPMAVTLKEDRPVRGEQAVAERPDGTRVPFIPYPTPLHDVAG
FT                   KLVGAVNMLVDISDREKAAEYAERLASIVRFSDDAIVSKDTQGIIQTWNKGAERLFGYS
FT                   AEEVIGKPINILIPPDRQGEEPGILERIRRDEHIDHYETVRIRKDGSLIDVSLTVSPLK
FT                   DARGRVVGASKIARDITERRRSEEHRKLLVNELNHRVKNTLATVQSLAAQTFRGVNASE
FT                   DFGRFQSRLVALARAHDVLTRESWQGADLGEVLHATINPICVEPQQRVQASGPPLRLRP
FT                   KMALALSMAFHELCTNAAKYGALTNDGGLIKVNWHVSNIESVSHLHLQWEEIGGPSVMV
FT                   PARTGFGTRLLERALARELGGKVDLVFAPSGVRFHIEAPLT"
FT   gene            62292..62654
FT                   /locus_tag="SMa0114"
FT   CDS_pept        62292..62654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0114"
FT                   /product="two-component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Response regulator receiver, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64716"
FT                   /db_xref="GOA:Q930Y6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="PDB:2LPM"
FT                   /db_xref="PDB:2M98"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y6"
FT                   /protein_id="AAK64716.1"
FT                   /translation="MTERRLRVLVVEDESMIAMLIEDTLCELGHEVAATASRMQEALDI
FT                   ARKGQFDIAIIDVNLDGEPSYPVADILAERNVPFIFATGYGSKGLDTRYSNIPLLTKPF
FT                   LDSELEAVLVQISKEV"
FT   gene            63200..64117
FT                   /locus_tag="SMa0116"
FT   CDS_pept        63200..64117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0116"
FT                   /product="DnaJ/CbpA-type protein"
FT                   /function="DnaJ-class molecular chaperone"
FT                   /note="Chaperone protein dnaJ (Heat shock protein J)
FT                   (HSP40), Heat shock protein DnaJ, N-terminal, DnaJ C
FT                   terminal region, DnaJ_bact: chaperone protein DnaJ, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64717"
FT                   /db_xref="GOA:Q930Y5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y5"
FT                   /protein_id="AAK64717.2"
FT                   /translation="MTDDPYQILGVPRTGKPDEIRKAYRKRAKELHPDLHPGDKEVETK
FT                   FKALSAAYHLLSDPEQRARFDRGEIDASGAERPQQHFYRHYADADHARRYGSAGGTGEF
FT                   EDVSDIFADLFGQGGAGGRFKARGQDRHYHLELEFLDAVNGARRRITFPDGNTLDLAIP
FT                   AGTRDGSTLRLRGKGTPGIAGGEPGDALIEISVRSHSVFRREGNDIEIDLPITLYEAVL
FT                   GAKIEVPTISGRVSMTIPKGSNTGDILRLRGKGVKSQHGPAGDQRVTLKVVLPTATDPD
FT                   LERFMETWRRSHAYDPREALGRAT"
FT   gene            64114..64452
FT                   /locus_tag="SMa0117"
FT   CDS_pept        64114..64452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64718"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y4"
FT                   /protein_id="AAK64718.1"
FT                   /translation="MKLTERQVLEQFDIVTRKQLRQWVHSGWIVPAQGERGPSFDDVDV
FT                   ARIRLVCELRRDMNVNDDAVPIILALLDQLYGLRRELRTIATALLEQPDEVRQQLKQAL
FT                   LSPIGQQH"
FT   gene            64679..65206
FT                   /locus_tag="SMa0118"
FT   CDS_pept        64679..65206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0118"
FT                   /product="hypothetical protein"
FT                   /note="weak, partial similarity to alcohol dehydrogenase
FT                   cytochrome c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64719"
FT                   /db_xref="GOA:Q930Y3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y3"
FT                   /protein_id="AAK64719.1"
FT                   /translation="MFRLGIGFACFATSAFGLQPLGAAADDPAIARGEYLVTMGGCNDC
FT                   HTPGYFFGKPDSSRFLGGSDVGFEIPGEGVFIGRNITPDKETGIGSWTREQIVTAIQTG
FT                   QRPDGRMLAPIMPWHAFAQLTKEDAGAIAAFLQSLKPVSHQVPGPFKPGEKVSTFMFRI
FT                   LPPGETAAAAPK"
FT   gene            complement(65491..65658)
FT                   /locus_tag="SMa0121"
FT   CDS_pept        complement(65491..65658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64720"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y2"
FT                   /protein_id="AAK64720.1"
FT                   /translation="MIRFERKPDPQPSLKEAENKRTKQISEAAKEENKKSGTTGAPRRA
FT                   PQAADDDRLI"
FT   gene            complement(65729..66112)
FT                   /locus_tag="SMa0123"
FT   CDS_pept        complement(65729..66112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64721"
FT                   /db_xref="GOA:Q930Y1"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Y1"
FT                   /protein_id="AAK64721.1"
FT                   /translation="MQNSKTSITQQFGSYKPSKAILVWACVATAAATMIVGFNWGGWVT
FT                   GGTSRTAAAAAADIARGELASAICVERFNAAPDAAAKLIEFKAITDGYKKRQFVEAGGW
FT                   ATMPGETAPDSRSVQGCATALAI"
FT   gene            complement(66192..67826)
FT                   /gene="groEL3"
FT                   /locus_tag="SMa0124"
FT   CDS_pept        complement(66192..67826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL3"
FT                   /locus_tag="SMa0124"
FT                   /product="60 kDa chaperonin"
FT                   /function="Chaperonin GroEL (HSP60 family)"
FT                   /note="60 kDa chaperonin (Protein Cpn60) (groEL protein),
FT                   TCP-1/cpn60 chaperonin family, high confidence in function
FT                   and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64722"
FT                   /db_xref="GOA:Q930Y0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q930Y0"
FT                   /protein_id="AAK64722.1"
FT                   /translation="MSAKQIVFSTDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKSYG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVRAVASKTNDLAGDGTTTATVLAASIFREGA
FT                   KLVSVGMNPMDLKRGIDLGVAAVLAEIKARATKVISSSEIAQVGTIAANGDAGVGEMIA
FT                   RAMEKVGNEGVITVEEARTADTELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILI
FT                   HEKKLGSLQAMLPILEAAVQSGKPLLIISEDVEGEVLATLVVNRLRGGLKIAAVKTPGF
FT                   GDRRKAMLEDIAVLTAGQMISEDLGIKLENVTLDMLGRARRVLIEKDTTTIIDGSGDKA
FT                   SIQARVSQIKAQIEETASDYDKEKLQERLAKLAGGVAVIRVGGATELEVKEKKDRIDDA
FT                   LNATRAAVEEGIVPGGGVALLRAKSALVGLTDDNADVTAGISIVRRALEAPIRQIADNA
FT                   GVEGSIVVGKLVDGRDHNQGFDAQTETYVDMIKAGIVDPAKVVRTALRDAGSIASLLIT
FT                   AEAMIADIPERGSPQSTGNGAVDSMGY"
FT   gene            complement(67874..68191)
FT                   /gene="groES3"
FT                   /locus_tag="SMa0125"
FT   CDS_pept        complement(67874..68191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES3"
FT                   /locus_tag="SMa0125"
FT                   /product="10 kDa chaperonin"
FT                   /function="Co-chaperonin GroES (HSP10)"
FT                   /note="Chaperonin 10 Kd subunit GroES (HSP10), high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64723"
FT                   /db_xref="GOA:Q930X9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q930X9"
FT                   /protein_id="AAK64723.1"
FT                   /translation="MTFRPLLDRVVIRRAEGNTQSKGGIIIPDTAKEKPQEGEVIAVGP
FT                   GSRDESGKLIPLDVKIGDTILFGKWSGTEVKIDGEDLLIMKESDIMGIVANTVPTAANA
FT                   A"
FT   gene            68805..69014
FT                   /gene="cspA8"
FT                   /locus_tag="SMa0126"
FT   CDS_pept        68805..69014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA8"
FT                   /locus_tag="SMa0126"
FT                   /product="CspA8 Cold shock family protein"
FT                   /function="Cold shock proteins"
FT                   /note="Contains a pfam00313, CSD, 'Cold-shock' DNA-binding
FT                   domain; Also, is similar to smart00357, CSP, Cold shock
FT                   protein domain; RNA-binding domain that functions as a RNA-
FT                   chaperone in bacteria and is involved in regulating
FT                   translation in eukaryotes; Contains sub-family of RNA-
FT                   binding domains in the Rho transcription termination
FT                   factor, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64724"
FT                   /db_xref="GOA:Q930X8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X8"
FT                   /protein_id="AAK64724.1"
FT                   /translation="MTTGTVKWFNSTKGFGFIAPDDGSADVFVHISAVERAGMNSIVEG
FT                   QKLGFELERDNKSGKMSAGQLRAA"
FT   gene            69135..69515
FT                   /locus_tag="SMa0128"
FT   CDS_pept        69135..69515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64725"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X7"
FT                   /protein_id="AAK64725.1"
FT                   /translation="MRHPSDNGFAERRNAAADAKRQLLTKFASAPKPTDPEMREKLAAR
FT                   EAASRARDARRAEREALKTAENERILAEAAASAAAAEAEQRAEAEARQAEISNRVSRVV
FT                   ADEAARKAERDRRYAARKARRA"
FT   gene            69601..70668
FT                   /locus_tag="SMa0130"
FT   CDS_pept        69601..70668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0130"
FT                   /product="Fatty acid desaturase"
FT                   /EC_number="1.14.99.-"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64726"
FT                   /db_xref="GOA:Q930X6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X6"
FT                   /protein_id="AAK64726.1"
FT                   /translation="MSAHVYPPASLVEDNAGAWLKTLAKYRQPRLGRSAFELFVTLVPF
FT                   AIFWAAACFSLANGFWPGLIAILPASAFLLRLFMIQHDCGHGSFFSRRGLDDWTGRLLG
FT                   VLTLTPYDYWRRAHAAHHATAGNLDERGVGDITTLTITEYCALSPIKRLGYRLYRHPLV
FT                   MFGIGPAWLFLFKQRLPFGMMNSGALPWISTMATNFAIVTLAALMVWAVGLGTFLLIHL
FT                   PVVLLAGAAGVWLFYVQHQFEETHWSAGEDWRFPQAALHGASHYDLPPVLRWLTGNIGI
FT                   HHVHHLSSRIPYYRLPEVLRDHPQLAGIGRITLWDSLKCVRLVLWDDRRRRLVSFHDAA
FT                   GSLRRSLTEDGRKTK"
FT   gene            70668..70955
FT                   /locus_tag="SMa0132"
FT   CDS_pept        70668..70955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64727"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X5"
FT                   /protein_id="AAK64727.1"
FT                   /translation="MIELTPTQIRGLKLAKDGDVHPQAGKRWTHLNAQVTYAKQDRFKE
FT                   RPQKIKFLTTATLNELRDHRLVKALNTDVPPEESAHGITMAGKMLLLKIK"
FT   gene            complement(71066..71671)
FT                   /locus_tag="SMa0134"
FT   CDS_pept        complement(71066..71671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Smb20087 of S; meliloti pSymb & to
FT                   Atu5287, Atu5492 of Agrobacterium tumefaciens & Mll2445 of
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64728"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X4"
FT                   /protein_id="AAK64728.1"
FT                   /translation="MRTVTGLFDDYGDAREAVSDLEAAGVPSDDISIVANNIGDRYSTD
FT                   GSNAAEGAGTGAGLGAAGGGVVGLLTGLGLMAIPGVGPVVAAGWLASTAAGAAAGAIAG
FT                   GAAGGLIGALTESGVDEEDAHVYAEGVRRGGTLVTARVEDSVAPRAEAILKQRKIVDPA
FT                   ARRSIYAQEGWSRFDENADPYTLDQVDRERERYRSMMP"
FT   gene            complement(71712..72026)
FT                   /locus_tag="SMa5002"
FT   CDS_pept        complement(71712..72026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5002"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to S; meliloti SMb20086 and to Agrobacterium
FT                   tumefaciens Atu5288 & Atu5493"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07961"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW3"
FT                   /protein_id="ACF07961.1"
FT                   /translation="MKNIIIVAAALMSAATTASLAQTTPSSEGETPAVATPDSQNPTAP
FT                   VEGANSFTEAQAKERIEEAGYTDVSGLKLDDKGVWQATAMKEGKSVSVALDYQGNVTAQ
FT                   "
FT   gene            72274..74286
FT                   /locus_tag="SMa0136"
FT   CDS_pept        72274..74286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="localized similarity to membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64729"
FT                   /db_xref="GOA:Q930X3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X3"
FT                   /protein_id="AAK64729.2"
FT                   /translation="MLKFSRGIDQDRAATAGGLQQIAFARGSAAAAQPSRLPTLVATAA
FT                   AVAVLYFARDVFLPLAIAILLTFALAPLVSRLRRVGCPRSVAVIGTVTTAFLFLSAFGV
FT                   VIAMQVSEVAQNLPTYQYNIVEKVRTLKETGSESQILERIGRVIERISTEISRPEPEVR
FT                   ASPEPTPETKPLLVEIFSPQRPIETLKNIINPLLGPLATTGLVIVVVIFMLLEREELRD
FT                   RFIRLVGYGDLHRTTEALQDAGARVGRYLLMQLVVNITYGIPLAIGLSLLGIPNAVLWG
FT                   MLAIVLRFVPYIGPVIAAALPLFLAFAAAPGWSLLVWTAALFIVLELLSNNVVEPWLYG
FT                   SRTGLSPLAIIVAAIFWAWLWGPVGLVLSTPLTVCLVVLGRHVPQFEFLEILLGNEPVL
FT                   DPKERLYQRLLAGDPDEATDNAEDMLQEKYLVEFYDTVAIPALLLAERDRARGALTNTQ
FT                   AAQIAQSANTLIANLEEIAGEEEGEEETSTEAQESDDDNDDAEEYDLPPGDGKSVLCVG
FT                   GRSDLDDVTASMLAQTLWIQGADAAHATHEVLKAGNIKALQLEGRNAVVLSVLDQDFMR
FT                   HAKFTVRRLKRIAPAARVGIVLWKEDGRPGTTERDQLIESLQADFVVFGMGDAVREALS
FT                   DELPRSLKLAHPKIAPGYAMRRSKRTDTESTVKAD"
FT   gene            74378..76579
FT                   /locus_tag="SMa0137"
FT   CDS_pept        74378..76579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0137"
FT                   /product="Diguanylate cyclase/phosphodiesterase"
FT                   /function="Predicted signal transduction protein containing
FT                   a membrane domain, an EAL and a GGDEF domain"
FT                   /note="Diguanylate cyclase (GGDEF domain)/phosphodiesterase
FT                   (EAL domain), conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64730"
FT                   /db_xref="GOA:Q930X2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X2"
FT                   /protein_id="AAK64730.2"
FT                   /translation="MRFVAGKVAVFRWMLPLAIAMALMGGIYLAVRWSAQQSDAVAVKR
FT                   QQHLVELVISKMQGSIAHDQESVTVWDDAVRKVSQEWDPRWVDSNLGSWMNSYFRHDGA
FT                   FVISPDRKPLYAFLAGQTNEQEAFSEIGPEAMPLIAKLQERLAAGDEGGTSEQVLSIGE
FT                   SDLVRIGGRPAIISVKPIVSDTGDIVQEPGREYLHLAARFLDGDFLTHLGDDYGFEDLR
FT                   FSVLPELGRQRSYAPIVSSSRETIGYFSWLPFRPGADVMKATAPVLLVAGALLFALTSA
FT                   LSVVLRRRSRRLQESQAELDHLARHDPLTGLANRASFNRLLARVVATSTIDQANALLYL
FT                   DLDRFKQVNDTLGHPVGDRLMVEVAKRLKETAAGAAISRIGGDEFTIIVARTRQDEVEK
FT                   LCDALIAAIRRPFEIDGQPILIGLSIGVAVATGNDADPIEITRKADIALYHAKSAGRNR
FT                   YAVFGPHMDELIRTKRDLEQDLRAALDAGNQLEVFYQPVYSAQSHEISSLEALIRWRHP
FT                   SKGPIAPDAFVPLAETAGLIDRLGAFVLKEACSTAREFPGLDIAVNVSAVELAQRHYAA
FT                   QVLSLLRQFGIEPSRLELEITETALLDEAGVCEKNITALREFGVKFALDDFGTGFSSFG
FT                   RLQRLEVDRIKIDRSFVHAFDRPGGGVAVVQSIVGIAHAKGLRITAEGVETEEQSEILR
FT                   KLGCDELQGFHLSRPMSKNSLRQLLGADKAQGTSSSSRS"
FT   gene            complement(76655..76975)
FT                   /locus_tag="SMa0139"
FT   CDS_pept        complement(76655..76975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="pfam06983, 3-dmu-9_3-mt, 3-demethylubiquinone-9 3-
FT                   methyltransferase; This family represents a conserved
FT                   region approximately 100 residues long within a number of
FT                   bacterial and archaeal 3-demethylubiquinone-9 3-
FT                   methyltransferases ; Note that some family members contain
FT                   more than one copy of this region, and that many members
FT                   are hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64731"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X1"
FT                   /protein_id="AAK64731.1"
FT                   /translation="MLTVDFTVAGILNGGPAFKHNEAFSFQIATDDQEETDRYWNAIVG
FT                   NGGQESACGWCKDKWGISWQITPRVLAEAMAAGGDEAKRAFEAMMTMKKIDVAAIEAAR
FT                   RG"
FT   gene            complement(77422..78822)
FT                   /locus_tag="SMa0142"
FT   CDS_pept        complement(77422..78822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0142"
FT                   /product="extracellular serine protease"
FT                   /function="Subtilisin-like serine proteases"
FT                   /EC_number="3.4.21.-"
FT                   /note="Peptidase S8 and S53, subtilisin, kexin, sedolisin,
FT                   Subtilase family, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64732"
FT                   /db_xref="GOA:Q930X0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q930X0"
FT                   /protein_id="AAK64732.1"
FT                   /translation="MLTKLKLALIAPIAAIALVSGDILAPGNMIVREVIGTGLALADDD
FT                   DDDGGSGGNRGSGGSGRSGSYGAGAGWSGGKSLFPFREFLPRRSIPRRSRAAAPAAPIR
FT                   APDEIVGLGFSPTELGELTATGFEVLERNTMTSFNAEVIKLRIPRRLTLEAARQRARAA
FT                   APQAVIDFNHYFRPEQHPDAPCVTSDCLARDVIGWPSAQTGLSNCAAGVRIGLVDTAIN
FT                   PDHLAFEARNIEIVRLVEEELPESGRQHGTAVAALLVGSASSRTPGLIPGGKLIAVDAF
FT                   HRGERQDDRSAAFDLARALDLLTRRQVQVINLSLAGPPNLLLEQAVMKAGERGIIMVAA
FT                   AGNDGPKAEPVYPAAYEEVIAVTATDRRKRPYRRAGRGEHIDFAAPGVAVWTAASVSGA
FT                   RPKTGTSFAAPFVTAAVAMMKASEPDLAPEMIHSRLSGHAEDLGDPGKDAVFGWGLLNA
FT                   RAICKTKS"
FT   gene            78965..79507
FT                   /gene="rpoE6"
FT                   /locus_tag="SMa0143"
FT   CDS_pept        78965..79507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE6"
FT                   /locus_tag="SMa0143"
FT                   /product="RNA polymerase ECF sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /note="Belongs to the sigma-70 factor family;, ECF
FT                   subfamily, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64733"
FT                   /db_xref="GOA:Q930W9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W9"
FT                   /protein_id="AAK64733.2"
FT                   /translation="MSNAVKDVGERLMAFLPNLRRFAISLCGSRDVADDLVQSACERAL
FT                   ASAERFEPGTRFDAWIFRILRNLWIDQVRRQKTAGVQDDITERHDIAGSSGERETEARL
FT                   TLKTVAEAITELPDEQREVVLLVCVEELSYREAADVMGIPIGTVMSRLMRARRSLAEAA
FT                   GITQATGRSQSMKGANE"
FT   gene            79504..80289
FT                   /locus_tag="SMa0144"
FT   CDS_pept        79504..80289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0144"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64734"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W8"
FT                   /protein_id="AAK64734.1"
FT                   /translation="MTRADFSDEILMRFADGELDTGTAAEVERAMETDDALVARVALFI
FT                   ETRHAAKAAMEPLLDEPVPSELKRAVERMVMEKTSPPSVSGAGILPFPRRAANESHRSR
FT                   WLAPVAASLAAVVAGFGGYWLRGSVEAPIEGGLGVAAIGSPALDEALATVAAGEERRLP
FT                   GSDQRFRAIATFRDNAQALCREFELDSDDRSTVVSVACRAGSEWRVTFAVIAPGATGGY
FT                   APASSTETLDAYLTAIDAGAPLEAAEEARALSELQGAQR"
FT   gene            complement(80295..80819)
FT                   /locus_tag="SMa0146"
FT   CDS_pept        complement(80295..80819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0146"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64735"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W7"
FT                   /protein_id="AAK64735.1"
FT                   /translation="MSGPRSLVAPSTFPQSQRPVCHSLPGRYDRSDRFELELDERFEEE
FT                   FDELFEDELELEFEELLDEELELELLEELELELLEELELELDELLPATMISPSVRPVWA
FT                   VCVEVRSTPGNKGAYSLASAAEPTNAARPAAIALFVQFFAISSTPCENRTGSSVRRSNG
FT                   RCAPLFHDRNF"
FT   gene            complement(80960..81673)
FT                   /locus_tag="SMa0148"
FT   CDS_pept        complement(80960..81673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0148"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64736"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W6"
FT                   /protein_id="AAK64736.1"
FT                   /translation="MLSFLKKDPQVIQFVCHPEDDGVIAPPLPAKSVLPDWFRRLPAVD
FT                   KGHLSATNNGLTVKRCMPFLDAMTTGWILPIAATVRLDVKDDGRSVDAGWEFDRVMVSN
FT                   HGAHQVAGNPKEPSPPCKFHNYWSIRTPPGWSCLFLPPLNRPGQPFECVAGIVDTDSYS
FT                   AHIHFPFFATAPDGLHVVEKGTPLVQVIPFRRADAAVTAEIRAETRAEATEREAIHRNT
FT                   LAGEGWYRKSARAAR"
FT   gene            81858..82340
FT                   /locus_tag="SMa0149"
FT   CDS_pept        81858..82340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0149"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="Similarity to prokaryotic transcription elongation
FT                   factor, GreA/GreB, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64737"
FT                   /db_xref="GOA:Q930W5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W5"
FT                   /protein_id="AAK64737.1"
FT                   /translation="MSVAFIKEESAETASETLLPDRPISPHPNLVTETGLKALELHLQQ
FT                   AREAFDATSTIEDVNERRRQSAGPLRELRYFAERVRTAQLVPDPASFDVVAFGSTVTFS
FT                   RDDGRVQKYRIVGEDEADPKAGSISYVSPVARVLMGKSVGDVASVGDQELEILAIS"
FT   gene            complement(82374..83900)
FT                   /locus_tag="SMa0150"
FT   CDS_pept        complement(82374..83900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0150"
FT                   /product="fatty acid CoA ligase"
FT                   /function="Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /EC_number="6.2.1.-"
FT                   /note="AMP-dependent synthetase and ligase, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64738"
FT                   /db_xref="GOA:Q930W4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W4"
FT                   /protein_id="AAK64738.1"
FT                   /translation="MSNHLFDAIRRAARPDSAFILTADGRVWTYGDMLEHSGRIASVLD
FT                   ALGVRPGDRVAVQVEKSPEALMLYLACLRTGAVYLPLNTAYTLAELDYFFGDAEPRLIV
FT                   CAPGAKEGIAKHAADCGAEVETLDEKGGGSLIDLARGKAPDFPDADRGPDDLAAILYTS
FT                   GTTGRSKGAMLTHDNLLSNATTLREYWRFTADDRLIHALPIFHTHGLFVASNVILLAGA
FT                   SMFFLPKFDANEVLRLMPQSTSMMGVPTFYVRLVQNPGLTHEATAGMRLFVSGSAPLLA
FT                   ETHRTFAQMTGHAILERYGMTETNMNTSNPYDGERIAGTVGFPLPGVSLRVADPESGRP
FT                   LPKGETGMIEVKGPNVFKGYWRMPEKTQGEFRADGFFITGDLGRIDERGYVHIVGRGKD
FT                   LVISGGYNIYPKEVETEIDQMPGVVETAVIGLPHPDFGEGVTAVVVRKPGAAIDERAIL
FT                   DGLEGRLARYKQPKRVIFVDDLPRNTMGKVQKNVLRETYARLYAGAEARV"
FT   gene            complement(83897..86626)
FT                   /locus_tag="SMa0151"
FT   CDS_pept        complement(83897..86626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0151"
FT                   /product="hypothetical protein"
FT                   /function="TRAP-type uncharacterized transport system,
FT                   fused permease components"
FT                   /note="Transports malonic acid; Expression of SMa0151 and
FT                   SMa0151 is induced by malonic acid; TRAP-type transporter,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64739"
FT                   /db_xref="GOA:Q930W3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR007956"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR035372"
FT                   /db_xref="InterPro:IPR038351"
FT                   /db_xref="InterPro:IPR038917"
FT                   /db_xref="InterPro:IPR042303"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W3"
FT                   /protein_id="AAK64739.2"
FT                   /translation="MIVACLFVLLATGMPIAFALGLAAFAALYMQSGAGIFYVLGDTMF
FT                   SGIANLAYVSIPMFVLMGAAVASSPAGSDLYTSLDRWLNRIPGGLILSNIGACAIFSGM
FT                   TGSSPATCAAIGKMGIPEMMRRGYPASVASGSIAAGGTLGILIPPSVTLIVYGIATETS
FT                   IGRLFMAGILPGILLTIMFMTWAVIDCKRKGYEFEARLVRYSMKERLAVLPRILPFLLI
FT                   IAGTLYVLYGGIATPSEAAGAGAFLTLAVVIVAYRLFRFRPVAGIFGSAMKESVMIMMI
FT                   MAAAELFAFALSSLFITQTVAAAIADMEVNRWVLMAVINVFLLICGMFLPPVAVIVMTS
FT                   PMLFPIVTQAGFDPYWFAIVLTINMEVGLITPPIGLNLFVINAIAPQIPTKDILWGSLP
FT                   YVLVMFLAIILLCVFPDVATWLPNQMLGDRPMNTTSFFSDMLQSIAERGRRFLSLGPAR
FT                   NGDVNPVGTMEALCDTLLSSRGEASGMALAKNILDRWQGFDQDKRRDFMLALLSRFGPD
FT                   IERLERAIDAYRADPTPKALLEMSMAAEPRRQELIRRLNLAPNGIATLVRMRADLLELK
FT                   AQNPDLEAVDTDFAHLFGSWFNRGFLVLRPISWSTPADILEKIIRYEAVHHIGGWDELR
FT                   RRLAPEDRRCFAFFHPQLVDDPLIFVEVALTREMPPNIADLLKEDRAPIRATDATTAVF
FT                   YSISNCQEGLRGISFGNFLIKQVVEDLRRDLPRLDTFVTLSPVPGFADWLSRERQAETS
FT                   NALSAADRSRLAALDEPDWADQPEIAAAIQPSLTAAAAWYFLRARNRNGKTVDPVARFH
FT                   LGNGARLERINFLGDRSERAMRQAHGLMVNYLYKLDDIETNHEAFATRGEVVAAPAIRR
FT                   LIPADRSSRSLVPGPNVFPPGVRSADAPGRKGDKEFTS"
FT   gene            complement(86647..87216)
FT                   /locus_tag="SMa0155"
FT   CDS_pept        complement(86647..87216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0155"
FT                   /product="hypothetical protein"
FT                   /note="Transports malonic acid; Similar to tripartite ATP-
FT                   independent periplasmic transporter, DctQ component, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64740"
FT                   /db_xref="GOA:Q930W2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W2"
FT                   /protein_id="AAK64740.1"
FT                   /translation="MLKAYSRAVGNASRGLAAVATALLIAAMLVVCQMIMQRYVFRQAT
FT                   IWQTDFVVFSATAAMFLGAPYVLLKGGHVGIDVVEMVVGERTRYVLRIIAGLLGLLFCA
FT                   VMLIATWIQFHDAWAGNWKHSSVWAPPLWVPLAALPVSFAMLCLQYVAQILTLLTAPAV
FT                   PAAMGHGAAEPGSAPGADRHPQEIIQ"
FT   gene            complement(87283..88287)
FT                   /locus_tag="SMa0157"
FT   CDS_pept        complement(87283..88287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0157"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /function="TRAP-type C4-dicarboxylate transport system,
FT                   periplasmic component"
FT                   /note="Transports malonic acid; Expression of SMa0151 and
FT                   SMa0151 is induced by malonic acid; Bacterial extracellular
FT                   solute-binding protein, family, high confidence in function
FT                   and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64741"
FT                   /db_xref="GOA:Q930W1"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W1"
FT                   /protein_id="AAK64741.1"
FT                   /translation="MSSFRRKLTTSAVAAICSLVASTAGAQTVLKASHQFPGGKGDIRD
FT                   EMVQLIAREVAAANVGLEIQVFPGSSLYKPNDQWNAVTRGLLDMTSFPLDYASGRHPEF
FT                   SATLMPGLVGNFDRAMRLNDSEFMGDIKKVIENAGALVIADAWLSGAFASKKNCITSPD
FT                   TIKGQVIRAAGPAFEEMLVEAGASISSMPSSEIYTGMQTGVLDAANTSSASFVSYRLFE
FT                   QAKCLTAPGENALWFMYEPVLVSKRVFDGLTEEQQKAILAAGEKAEVYFNEEVRKGDQV
FT                   MIDTYKKAGVEVVEMSKEDYDAWLELAKASSYKNFAANVPGGDKLIEKALAVK"
FT   gene            88416..89090
FT                   /locus_tag="SMa0160"
FT   CDS_pept        88416..89090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0160"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /note="Contains 1 HTH gntR-type DNA-binding domain, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64742"
FT                   /db_xref="GOA:Q930W0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930W0"
FT                   /protein_id="AAK64742.1"
FT                   /translation="MSENIFYKLRDDIENGIVTGEFEPGERLDETQLAMRFGVSRTPIR
FT                   EALMQLSAIGLVEIRPRRGAVVVDPAPQRVYEMFEVMAELEGMAGALAARRHTEEDSAA
FT                   LLAAHEKCREAVLSEETDRYYYENEIFHRAIYTASHSGFLEEQCTTLHRRLRPYRRLQL
FT                   RVRNRMKVSFREHGEIVEAILSGNTDGAREGLRSHVAVQGDRFGDLVANLSNRERRSGR
FT                   LG"
FT   gene            complement(89275..89520)
FT                   /locus_tag="SMa0162"
FT   CDS_pept        complement(89275..89520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64743"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V9"
FT                   /protein_id="AAK64743.2"
FT                   /translation="MTISSNRCTALIVTVLPFATLIDREKFDEISTESPFADAGGLTPM
FT                   PVHRATTKQKNAKREPLDLVMVPVFLHDTRHNVALS"
FT   gene            89324..90724
FT                   /gene="pilQ2"
FT                   /locus_tag="SMa0163"
FT   CDS_pept        89324..90724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ2"
FT                   /locus_tag="SMa0163"
FT                   /product="PilQ2 pilus assembly protein"
FT                   /note="Similar to Flp pilus assembly protein and secretin
FT                   CpaC; Contains a BON, putative phospholipid-binding domain;
FT                   This domain is found in a family of osmotic shock
FT                   protection proteins; It is also found in some Secretins and
FT                   a group of potential haemolysins; Its likely function is
FT                   attachment to phospholipid membranes; Also contains a
FT                   secretin_C domain, found in bacterial type II and III
FT                   secretion system protein, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64744"
FT                   /db_xref="GOA:Q930V8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V8"
FT                   /protein_id="AAK64744.2"
FT                   /translation="MTRSRGSLFAFFCFVVALCTGIGVSPPASANGDSVEISSNFSRSI
FT                   KVAKGKTVTIRAVQRFDEIVIGDPEIATVTPLTDRSFYILGNELGSTSVTIFDAEKNPV
FT                   GIIDIEVTLDTKLLSSTIRQSVPGSSVKVTSANGRIVLSGSATDAVAATQAEQIASRFA
FT                   GDEEVINSIKITSSQQVQLNVRFVEINRDVGKELGTQISAAYAWSNGSVEFNSSPRATS
FT                   NTPAGSLIGSLIGEGYSVDVAIDALEDRGMARRLAEPNLIARSGETSSFLAGGEFPIPI
FT                   SEQDGTITVSYKKFGVGLDFTPTVLSDGLIALDIEPEVSAIDNTASYRVGNIAIPGFSV
FT                   RRARTSVDLKSGQSFMIAGLLQSENNLITQRVPGLGQLPILGALFSSKAYQRRETDLVI
FT                   IVTPHLVKPIDPLKKVASPSDRTKRPTEAEFFLGNIDEVEVNGRGRSASRQARVVRAPS
FT                   SGHFLELQ"
FT   gene            90721..91017
FT                   /locus_tag="SMa0164"
FT   CDS_pept        90721..91017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0164"
FT                   /product="hypothetical protein"
FT                   /note="Weak similarity to hypothetical protein from
FT                   Mesorhizobium sp; BNC1 and hypothetical protein RHE_PE00307
FT                   from Rhizobium etli CFN 42"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64745"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V7"
FT                   /protein_id="AAK64745.1"
FT                   /translation="MIRRSSRPRGFPGLLFASSILLSGCQNHELVRSETIALSAGDAIA
FT                   ANSVMQMVDPWPPRVKQTSLATPADLEQYKPQQPNAEQNGGNGETYPNDTTTQ"
FT   gene            91039..91569
FT                   /locus_tag="SMa0166"
FT   CDS_pept        91039..91569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="Partial similarity to TadD, Flp pilus assembly
FT                   protein which contains TPR repeats; Does not contain full
FT                   TPR repeat consensus sequence, TPR, Tetratricopeptide
FT                   repeat domain; typically contains 34 amino acids [WLF]-
FT                   X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-
FT                   [ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi, plants, and humans in various subcellular
FT                   locations; involved in a variety of functions including
FT                   protein-protein interactions, but common features in the
FT                   interaction partners have not been defined"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V6"
FT                   /protein_id="AAK64746.1"
FT                   /translation="MEMTTGASGRSVLGRSGGGRRPTELVMAIVATVILSSCQTSEVLS
FT                   GAEFDPTSALASSGDVSKSDLDQGKLQFMNGNYGLAEKHFRKAVELRQDNAEALMGLAA
FT                   CYDRLGRFDLADRAYNQLLKVAGRQPRIVNNMGYSQYLRGEKAKARKLLLEARAASPGD
FT                   ETIEANLALLDRS"
FT   gene            91653..92465
FT                   /locus_tag="SMa0168"
FT   CDS_pept        91653..92465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has partial similarity to COG2226, UbiE, Methylase
FT                   involved in ubiquinone/menaquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64747"
FT                   /db_xref="GOA:Q930V5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V5"
FT                   /protein_id="AAK64747.1"
FT                   /translation="MAMASDVLARSFGKEAFGLDPQNYHTARPAYPELVWDALRNRAGL
FT                   RRGISILEIGAGTGLATERLLEDRPHRLLAVEPDRRLARFLRGRLDKEELEVVETPFEK
FT                   LKVPEKSFDLVVSATAFHWIDAAPALRRIHRLLRAGGTVALFWNVFGDGVRPDPFHRAT
FT                   AHLFSGHRTSPSGGGTTKTPYGLNVGARLGELAEAGFTADEPELIDWTLALDPPAVRRL
FT                   YATYSNVTALPADERERLLSGLEKIAETEFAGVVTRNMTTSVYTGRRE"
FT   gene            92526..93311
FT                   /locus_tag="SMa0169"
FT   CDS_pept        92526..93311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0169"
FT                   /product="putative methyltransferase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64748"
FT                   /db_xref="GOA:Q930V4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V4"
FT                   /protein_id="AAK64748.1"
FT                   /translation="MALDRADFYDAELARHNRQLRVAADFGADDRVLDIGCGAGQTTRE
FT                   AARAAPQGEAIGVDISAEMLEEARRRSAAEGLRNAMFEQGDAQFHGFPTGSFDLCISRF
FT                   GVMFFADPAAAFANIGRAMRPGARLVWMVWQSRERNEWSRAIRQALAPAIAVSAGAANP
FT                   FSLGDPPVATDLLSAAGFTSIDFADVQEPVFYGSDVDAAFDALTSLYLVQDALASTNEP
FT                   PDKPLQRLRDLLEGHMTPEGVFFDSRAWIITARRAGGGG"
FT   gene            complement(93492..94256)
FT                   /locus_tag="SMa0171"
FT   CDS_pept        complement(93492..94256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="Most similar to hypothetical protein RHE_CH01073
FT                   from Rhizobium etli CFN 42"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64749"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V3"
FT                   /protein_id="AAK64749.1"
FT                   /translation="MNATKLLLILPLLAAFAYISLVSLTYLSQRALLYPGASATPAPER
FT                   ASWGQNASIQTPDGETLHGLYSRGEPGQPSVLFFLGNADRVSNYGFFAQALAARGIGLL
FT                   ALSYRGYPGSSGTPNEHGLLIDGIAAFDWLAARSGNEIVVLGQSLGSGVAVDTAGKRPA
FT                   VAVILVSAYLSVLSLAQTYYPFFPVALLTKDPFRSDLKIAGVRQPEAVYPRPARHHHPI
FT                   VFGRSSVSDRSRAQADAHLRCRPQRSVGCPHG"
FT   gene            94473..95393
FT                   /locus_tag="SMa0172"
FT   CDS_pept        94473..95393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64750"
FT                   /db_xref="GOA:Q930V2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q930V2"
FT                   /protein_id="AAK64750.1"
FT                   /translation="MSNSKDEVERIDWLEAELADTIDEDYELELSEPTLSEKIREIYRK
FT                   AHPPALPRMDYFRALLALQAELIKLQDWVVYHKQKVVVIFEGRDAAGKGGVIKRITQRL
FT                   NPRIVRTVALPAPSDREKTQWYFQRYVPHLPAGGEIVLFDRSWYNRCGVERVMGFATEE
FT                   EVEQFFDDVPEFERMLVRSGVRLVKYWFSITDEEQQLRFLTRIHDPLKQWKLSPMDLQS
FT                   RVRWEAYTKAKEETFARTNIREAPWHIVEANDKKRARLNCIDHLLKQIPYEDVPHEDIT
FT                   LPERIFNPNYERKVLPPELYVPAKY"
FT   gene            complement(95789..96871)
FT                   /locus_tag="SMa0175"
FT   CDS_pept        complement(95789..96871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains a domain pfam00924, MS_channel,
FT                   Mechanosensitive ion channel; Two members of this protein
FT                   family in M; jannaschii have been functionally
FT                   characterised; Both proteins form mechanosensitive (MS) ion
FT                   channels upon reconstitution into liposomes and functional
FT                   examination by the patch-clamp technique"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64751"
FT                   /db_xref="GOA:Q930V1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V1"
FT                   /protein_id="AAK64751.1"
FT                   /translation="MERGDKEQENLSRLEQAAQQTADPKTMQQKATKGPEEKLRFSLRK
FT                   KDVWWTVGLAAAALLLFGIQVLINWRLDWLDVPLRLRVMNYVKGGLLIFIMLTVANVIE
FT                   VFLIGRIPNRVSRFNLKRIFRLVVVVAIVFVAISVLFVNWYAAFVSLGLISLILGFALQ
FT                   MPISSFIAWIYILARAPYRVGDRIRIGDAHGDVIDVSYLDTTLWEFGGEYLWTDHPSGR
FT                   IIKFPNSTVFDTPVFNYSWPLFPYVWNEIKFQLAYESDLEFVARTMREVVEEQVGDIMS
FT                   QKVKIYKHILSNTPVDELEVKEHPVVHFRVSENTWLEAIVRYLVPPKEAGRTKTRLIKE
FT                   MLARMNAEPDRVLFPKSNLR"
FT   gene            complement(98400..99317)
FT                   /locus_tag="SMa0179"
FT   CDS_pept        complement(98400..99317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0179"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Contains a LysR substrate binding domain, but only a
FT                   partial helix-turn-helix domain, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64752"
FT                   /db_xref="GOA:Q930V0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930V0"
FT                   /protein_id="AAK64752.1"
FT                   /translation="MHRPRLPPLSALRAFEAAARLASFKAAAEELLVTPTAISHQIKQL
FT                   EAHMSLRVLDRTPRAVTLTPRGKALYEATAAGFGEIERVVTRLLAETAPTTVTLTSTIA
FT                   FLSHWLVPRMDALRQTIPNIDLRLHASNKVEELRSGGIETAIRYGRGPFAGTASMQLCS
FT                   DAMTPVCSPSLGLSQLGDLRRVTLIHIDGRSRPAPKPDWNRWCEQAGITDLDTSAGPRF
FT                   PDSMLAVQAAIAGQGVVIASRVLVADALATGLLEAPFTQSLAGDAYHFACALGLEQRTD
FT                   IAALRMWFQNCFSAAEPDPAHRLP"
FT   gene            99435..100307
FT                   /locus_tag="SMa0180"
FT   CDS_pept        99435..100307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0180"
FT                   /product="epimerase"
FT                   /note="Belongs to the family of PhzC-PhzF-like epimerases,
FT                   Phenazine biosynthesis-like protein; PhzC/PhzF is involved
FT                   in dimerisation of two 2,3-dihydro-3-oxo-anthranilic acid
FT                   molecules to create PCA by P; fluorescens, conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64753"
FT                   /db_xref="GOA:Q930U9"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U9"
FT                   /protein_id="AAK64753.1"
FT                   /translation="MVELIAGLIDVFADVPLTGNPLAVVQDADGLTDDQMRRIAGEFNQ
FT                   AETTFLMRSTRADWKLRSFTASGAEVFGAGHNALGAWLWLAENGDLGSLTAARTFQQEI
FT                   GRDVLPIELESVGGRIHGRMRQVPLRLSDPLDDVAPLADALGLDPRDILPEPPARPADT
FT                   GATHLMVRVLNVDSVDRALPVADKLLAVLEKTPAEGCYIYALDADAPDTAYARFFNPSV
FT                   GLWEDAATGTAAGPLAAYLAATGNLTNNELVIEQGTKMGRRSILRIRLAPLPELSGAGI
FT                   VVVKGVIRL"
FT   gene            complement(100505..100708)
FT                   /gene="cspA7"
FT                   /locus_tag="SMa0181"
FT   CDS_pept        complement(100505..100708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA7"
FT                   /locus_tag="SMa0181"
FT                   /product="CspA7 cold shock protein"
FT                   /note="Contains a pfam00313, CSD, 'Cold-shock' DNA-binding
FT                   domain; Also, is similar to smart00357, CSP, Cold shock
FT                   protein domain; RNA-binding domain that functions as a RNA-
FT                   chaperone in bacteria and is involved in regulating
FT                   translation in eukaryotes; Contains sub-family of RNA-
FT                   binding domains in the Rho transcription termination
FT                   factor, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64754"
FT                   /db_xref="GOA:Q930U8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U8"
FT                   /protein_id="AAK64754.1"
FT                   /translation="MPKGTVKFFNDDKGFGFITPEDGGTDVFVHVSALQHGGSLKEGDK
FT                   VSYDVGQDRKTGKSKAENVSVL"
FT   gene            100964..102508
FT                   /locus_tag="SMa0185"
FT   CDS_pept        100964..102508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to a group of conserved hypothetical
FT                   proteins; Many in this group are annotated as MFS efflux
FT                   proteins; However, the similarity of the the closest
FT                   homologs to COG2814, AraJ, Arabinose efflux permease is
FT                   weak and partial"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64755"
FT                   /db_xref="GOA:Q930U7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U7"
FT                   /protein_id="AAK64755.1"
FT                   /translation="MADNIHTPEQASRREWVGLCVLSIACLIYSMDLSVLFLAVPAIVA
FT                   DLDPSASQLLWINDIYGFMVAGFLVTMGTLGDRIGRRRVLLMGAFAFGVASAFAAFSNT
FT                   PGQLILARALLGIAGATIAPSTLSLIVNLFKNEAERNRAISIWGTAFALGGLVGPLIGG
FT                   ILLQYFHWGSVFLINIPVMLLLLAVAPFLLPEYKNNDAGRLDLLSVVLSLATVLPIIYG
FT                   FKHMAADGFQLAQIVYIGLGLLVGLLFVRRQRRLSDPLVDLALFRVPAFTASLMVNLAG
FT                   VFFVFGVFLFQNLFLQLVLGLSPLEAALWSAPSALVFAVMSFQAYRFTNRFGPVRTVLG
FT                   GLLVNAAGAAAMAIAAYAESLIGILGSSMIIGFGFVPVVLTTTGLIVGTAPPERAGSAS
FT                   AISETSAEFGGALGIAVLGSLATLIYRMAMNRADLSSLNPVQAEAVSATLAGAVETARS
FT                   MPGSTSAVWLETAKSGFSLGFAICCVVATVTLLLLAIVARRVYATAHIDESTLAPH"
FT   gene            102649..103602
FT                   /locus_tag="SMa0187"
FT   CDS_pept        102649..103602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0187"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Best similarity to FabG family, Dehydrogenases with
FT                   different specificities (related to short-chain alcohol
FT                   dehydrogenases), specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64756"
FT                   /db_xref="GOA:Q930U6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U6"
FT                   /protein_id="AAK64756.2"
FT                   /translation="MKSETGQKQRDIQKQVEGADKKEKPKTSGAMQAGARRYPEPPFPK
FT                   VHQDKPGSEADLPVAPMYDAPFYKGSDKLKDKVALITGGDSGIGRSVAVLFAREGADVA
FT                   IVHLDESQDADDTKAAVEKEGRKCLVIKGDVKDASFCRKAVEKTVMQLGRLDILINNAA
FT                   FQVHTRDIEDLTDEHFDETLKTNLYGYFYMAKAAIPHLKNGSAIINTGSVTGLTGSKEL
FT                   LDYSMTKGGIHAFTRALSGHLVPKGIRVNAVAPGPVWTPLNPSDKEAEDVEKFGSQTPM
FT                   KRAAQPEEIAPAYVFLASPQMSSYITGEILPIVGGY"
FT   gene            104028..104471
FT                   /locus_tag="SMa0189"
FT   CDS_pept        104028..104471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64757"
FT                   /db_xref="GOA:Q930U5"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U5"
FT                   /protein_id="AAK64757.1"
FT                   /translation="MRTDLVNRPQDGSAGRSALLVASAVNAVAAIYHIIGGTPEVMYPV
FT                   YSANLPPSSAGVLDILWYQMAALIVGSAVATLVAAFRSDWRWPVAWIIGGHFLVVSGIC
FT                   LFFTFVWFGNPWGLIQWAIFGPVGLIIFWAAARPAERAGAPTL"
FT   gene            104560..105189
FT                   /locus_tag="SMa0190"
FT   CDS_pept        104560..105189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0190"
FT                   /product="putative transcriptional regulator"
FT                   /note="Has weak similarity to TetR family regulators,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64758"
FT                   /db_xref="GOA:Q930U4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U4"
FT                   /protein_id="AAK64758.1"
FT                   /translation="MADKQGGPTKADWVAAGLSALTAGGIEAVRVERLAVILGVSKGPF
FT                   YWRFKNRGELLEAIIEFWKRDFTADLIEQTSHFDTPRERLEALAELAVVSTSGALDVAK
FT                   TECALRAWAAQDPLPRAAVREVDAMRTKHLTEEFKLLGAPHPLAEQLAKAIYLALLGLY
FT                   TVRQYTPELADEQSYLTAVRIALDAAQIQSHSTEASAAKSRLEPDI"
FT   gene            complement(105799..106329)
FT                   /locus_tag="SMa0191"
FT   CDS_pept        complement(105799..106329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains a domain, pfam05146, DUF704, Aha1 domain;
FT                   The function of this presumed domain is unknown; It is
FT                   found in a range of bacterial as well as eukaryotic
FT                   proteins; This domain is found in Aha1, which is found to
FT                   interact with Hsp90; It is not certain if this interaction
FT                   is mediated by this domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64759"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U3"
FT                   /protein_id="AAK64759.1"
FT                   /translation="MTADKISPDMLRFERILAAPAATVWQYLVDPELRARWFMSGPTDL
FT                   QVGGAFGLTMDHDRLSDEVVPTPDRYKPYVGHRWHERITRYEPPHLLAFTWEDGKAGEV
FT                   TFALTEIDSGTTRLVLTHTGLRGSEDALNFGGGWHAHLAVLEKRIAGISIPDFWALHAV
FT                   AEREMEIALVSEA"
FT   gene            complement(106326..106652)
FT                   /locus_tag="SMa0193"
FT   CDS_pept        complement(106326..106652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, weak similarity to
FT                   helix-turn-helix domain of ArsR family of transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64760"
FT                   /db_xref="GOA:Q930U2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U2"
FT                   /protein_id="AAK64760.2"
FT                   /translation="MVDEKLTLTFAALADPTRRGMLAALTSGEKPISELARPYQMTLAG
FT                   AAKHVAILARAGLIERRKVGRQNICRLNAGNLKEANDWLAQWQRFWNVRLDALEKALKE
FT                   ELSQ"
FT   gene            complement(106949..107863)
FT                   /locus_tag="SMa0196"
FT   CDS_pept        complement(106949..107863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0196"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="Best similarity to gluconolactonase, FUNCTION:
FT                   Hydrolyzes the gluconolactone formed by glucose-fructose
FT                   oxidoreductase, and that formed in aerobic conditions by
FT                   the glucose dehydrogenase present, CATALYTIC ACTIVITY: D-
FT                   glucono-1,5-lactone + H(2)O = D-gluconate, PATHWAY:
FT                   Sorbitol metabolism, SUBUNIT: Homodimer, SUBCELLULAR
FT                   LOCATION: Periplasmic (Probable), CAUTION: It is possible
FT                   that in some cases Met-40 is the initiator in this case the
FT                   expressed enzyme would remain cytoplasmic, specificity
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64761"
FT                   /db_xref="GOA:Q926I2"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q926I2"
FT                   /protein_id="AAK64761.1"
FT                   /translation="MAEASIYEIHDPRFRQMIVTSAGLDELYSGCRWAEGPVWFNDANQ
FT                   LLWSDIPNQRILRWTPEGGVSVYRQPSNFTNGHTRDRRGRLISCEHGTRRVTRTEVDGS
FT                   ITVLADRFEGRRLNSPNDVVVKSDGTIWFTDPTYGIMSDYEGYHADPEQPTRNVYRLDP
FT                   ETGELSAVVTDFTQPNGLAFSPDEKILYVADSSASHDDRLPRHIRAFDLTDGGRLANGR
FT                   VFCVIDKGIPDGIRTDANGNLWSSAGDGVHCFDTAGKLIGKIRVPQTVANLTFGGPRRN
FT                   RLFIAATRSLYSVYVAVTGSQVP"
FT   gene            complement(107878..108825)
FT                   /locus_tag="SMa0197"
FT   CDS_pept        complement(107878..108825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0197"
FT                   /product="ABC transporter, permease"
FT                   /note="Likely transports galactose and, to a lesser extent,
FT                   L-arabinose, glucose, D-arabinose, L-fucose and D- fucose,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64762"
FT                   /db_xref="GOA:Q930U1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U1"
FT                   /protein_id="AAK64762.2"
FT                   /translation="MNALIRQFGKPWVWSWLAAFIVWFLTIMVTGGAGTLGLSQAALTF
FT                   AAFSVIVGIGQMFVITLGPGNIDLSVPATMTLAGTVALKLMNVENGMVLPGLLLAVFIG
FT                   LGVGLCNYTLIKALRIPPIIATLSMSFVVQSGAIWTNRGLRIKPPSVLAEFTTTNTLGV
FT                   PNVAIVAVLISVLAWILLEKTIYGRWISAIGQSMPAARMAGIPVDGTRFVTYLFCAVLA
FT                   SISGYLLACFSGGAALNMGAEYLLMSIAVVVIGGTAVAGGDSNVPGIWGASLFMFLVVS
FT                   MLNTYGLGAGIRLIMTGLIIISVIMLAGGRRGMR"
FT   gene            complement(108822..109769)
FT                   /locus_tag="SMa0198"
FT   CDS_pept        complement(108822..109769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0198"
FT                   /product="ABC transporter, permease"
FT                   /note="Likely transports galactose and, to a lesser extent,
FT                   L-arabinose, glucose, D-arabinose, L-fucose and D- fucose,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64763"
FT                   /db_xref="GOA:Q930U0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q930U0"
FT                   /protein_id="AAK64763.1"
FT                   /translation="MTFRLSSDAIRLVIPALSLSLLLAAVFWLQPRAMSYIGLNLLFNL
FT                   AVPIALATIAQMLVMAVNDLDLSMGAFVSFVACVTATFLRDAPAIGILILAGAVAAYAA
FT                   IGVVIHLRNLPSIVVTLGMSFVWGGLAVLLLPAPGGQAPDWVRWLMTVKPPLAPMAIVA
FT                   SIIIAVIAHFIVKRSSLGVLIRGVGGNQRSVERAGWSIVAARATAYALAGLFAVLAGIA
FT                   LVGLTTSADANIALRYTLLSIAGVILGGGEFTGGRVSPIGAVIGALTLTLASSFLSFLR
FT                   ISPDWQIGAQGAILIIVLALRLMLNRLERREKRR"
FT   gene            complement(109766..111229)
FT                   /locus_tag="SMa0199"
FT   CDS_pept        complement(109766..111229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0199"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Likely involved in transport of galactose and, to a
FT                   lesser extent, L-arabinose, glucose, D-arabinose, L-fucose
FT                   and D-fucose, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64764"
FT                   /db_xref="GOA:Q930T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T9"
FT                   /protein_id="AAK64764.1"
FT                   /translation="MMASSMDDVAKAIIAVDGAKVSFGAVKALDGVTLRVMPGECVGLV
FT                   GHNGAGKSTIVSVINGGLTPHHGIVTSDGERQERYGINAARDRGVRCVFQELSLCPNLS
FT                   IVENTRLVHRTLGGFGWRLRAAKIIEKSLDAVFPGHGIDSGRTVGDLSIAERQMVEIAL
FT                   AFSDAGTPARLVILDEPTSSLDASLARQMLDHVRRFIAAGGSVIFISHILHEILETADR
FT                   IVVMKDGRVVAERPAHRFDHHGLVEAMGSVAKAETRQRPVCDQPAAPVILSHEAAGIPF
FT                   TARTGEIIGLAGLAGHGQTELLLALHAARSGNWLPQGNPLVTFVAGDRRLNGVFELWSI
FT                   LRNFSIASLGDMSRRGLVLEAGEKTRGTAWKERIEIRTPDLNNRILSLSGGNQQKVLFA
FT                   RALATRAPIVLMDDPMRGVDVGTKQEVYAIIREEAAAGRTFIWYSTEMDEVCLCDRVYV
FT                   FREGRITAELGGDAVDEANIISASFEGTA"
FT   gene            complement(111288..112304)
FT                   /locus_tag="SMa0203"
FT   CDS_pept        complement(111288..112304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0203"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Likely transports galactose and, to a lesser extent,
FT                   L-arabinose, glucose, D-arabinose, L-fucose and D- fucose,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64765"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T8"
FT                   /protein_id="AAK64765.2"
FT                   /translation="MTIRKMLLASAAITCAAMPASAFADTSAKKIALSNNYAGNSWRQA
FT                   MLTSWEKVTGEAVKAGIVASADAFTTAENQATEQAAQIQNMILQGYDAIVLNAASPTAL
FT                   NGAVKEACDAGITVVSFDGIVTEPCAWRIAVDFKEMGRSQVEYLSNKLPDGGNLLEIRG
FT                   LAGVFVDDEISAGIHEGVKQFPQFKIAGSVHGDWAQDVAQKAVAGILPSLPDIVGVVTQ
FT                   GGDGYGAAQAIAATDRKMPIIVMGNREDELKWWKEQKDANGYETMSVSIAPGVSTLAFW
FT                   VAQQILDGKEVKKDLVVPFLRIDQDNLEANLANTQAGGVANVEYTQEDAIKVIESAK"
FT   gene            112578..113825
FT                   /locus_tag="SMa0204"
FT   CDS_pept        112578..113825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0204"
FT                   /product="sensor histidine kinase"
FT                   /note="Best similarity to COG4585, Signal transduction
FT                   histidine kinase, mostly in carboxy terminus; Strong
FT                   similarity across entire length to proteins in
FT                   Agrobacterium tumefaciens and Rhizobium etli; Amino
FT                   terminus is not so well conserved in other histidine
FT                   kinases and has weak similarity to COG2203, FhlA, FOG: GAF
FT                   domain, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64766"
FT                   /db_xref="GOA:Q930T7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T7"
FT                   /protein_id="AAK64766.1"
FT                   /translation="MLHSAPAAMFDHYLGISRLLAGQLDFRSAIRSVAAEVAHIIPHDH
FT                   LDVCVLLEDGNYHTAYETGIETAWGDLAGAPVVNSPIRSLLWGEVDFLLADDAMTDPRF
FT                   HFDGAFKRPIVEQSLRSRLHVPMKVQGAIIAALSCSSQEAGAYTMEDVERARIIADLLT
FT                   PYFFALRAAEQAQRSAIVEAEARAREEGLRLGALKLTEALEQERQRIGMDLHDQTLADL
FT                   TRLARRIDRLSRNGEVAPEALEPVSRSLQHCMQDLRQIIEQAKPSVLQLFGLTQAIEHH
FT                   LDRSTRDTGSIIEWGLADETNGALERLEPTVIVALFRIAQEAINNAVRHAAPLAVKVRL
FT                   DADDDRLSIEISDDGTGLAKTRGRIGEGIDNMKTRARLISARFTIGPGHNNRGTVVRVV
FT                   LPLAPHDSGSIEERAE"
FT   gene            113822..114544
FT                   /locus_tag="SMa0206"
FT   CDS_pept        113822..114544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0206"
FT                   /product="Response regulator"
FT                   /note="Contains cd00156, REC, Signal receiver domain;
FT                   originally thought to be unique to bacteria (CheY, OmpR,
FT                   NtrC, and PhoB), now recently identified in eukaroytes ETR1
FT                   Arabidopsis thaliana; this domain receives the signal from
FT                   the sensor partner in a two-component systems; contains a
FT                   phosphoacceptor site that is phosphorylated by histidine
FT                   kinase homologs; usually found N-terminal to a DNA binding
FT                   effector domain; forms homodimers, Very similar to proteins
FT                   in Agrobacterium tumefaciens and Rhizobium etli,
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64767"
FT                   /db_xref="GOA:Q930T6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T6"
FT                   /protein_id="AAK64767.1"
FT                   /translation="MKVLIVEDDPLHRSYLHEAVNAALPECDTVIEAENGTVGEKLARE
FT                   HKSAHIVMDLQMASRNGIEAARTIWKERPETRILFWSNYSDEAYVRGVSRIVPDGAAYG
FT                   YVLKSASDERLKLALRSIFIESQCVIDREVRGLQQKSLGQTNGFNDSEYEILVDIALGL
FT                   TDRAIARRRGLSLRSVQNRLQQLYDKLDVYQAASDDNDDGRFNLRARAITIAFLRKLLN
FT                   YSALERAEAELQEWLDGK"
FT   gene            114669..115757
FT                   /locus_tag="SMa0209"
FT   CDS_pept        114669..115757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="Very similar to proteins in Agrobacterium
FT                   tumefaciens and Rhizobium etli"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64768"
FT                   /db_xref="InterPro:IPR022550"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T5"
FT                   /protein_id="AAK64768.1"
FT                   /translation="MLKSIDLMYQAMLAELRQRSLDAAWSADFPSDGRFTPLTVKQRRY
FT                   WYFDRPDGKGGRTRDYVGPASDPEIAKRVEEFKAQKDDLQARRRMVSTLTREGGMVAPD
FT                   RMSGDVIEALASGGLFRLRGILIGTIAFHTYAGVLSVRLPGHSIMTGDADVAQDFAVSR
FT                   EVGDSMPPILQLLQSVDPTFRPVPHRSGQAAFSSFQNKNSYKVEFLTNRSSDDYMDQPA
FT                   RMPALGGASADPLRFLDFLIRDPVRTVVLHKSGIPVTVPDPSRYAVHNLIVASRRHNDG
FT                   QSAVKRDKDIRQAGILFEAILQTRRSSDLALVYNEAWQRGDAWRAGIRAGAAMLPDEGR
FT                   KHLKACLRTGAVEIDEDVSLPF"
FT   gene            complement(115852..116118)
FT                   /locus_tag="SMa0210"
FT   CDS_pept        complement(115852..116118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0210"
FT                   /product="hypothetical protein"
FT                   /note="similar to S; meliloti hypothetical protein
FT                   SMc04866"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64769"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T4"
FT                   /protein_id="AAK64769.2"
FT                   /translation="MDVQKAGMARLLLAAPDVRDSAWMIHDLTFLKLCEVYEHACLRRD
FT                   VLRCAASIDDAALLKSEEECKSLEAAAIAYIRERQKFSGLGSH"
FT   gene            complement(116261..116455)
FT                   /locus_tag="SMa0211"
FT   CDS_pept        complement(116261..116455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0211"
FT                   /product="hypothetical protein"
FT                   /note="Similar to short regions found in S; meliloti
FT                   hypothetical proteins SMb20517, SMb20545 and SMb21395"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64770"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T3"
FT                   /protein_id="AAK64770.1"
FT                   /translation="MLGDWDMDDRDTNHNGEKNSASDLLEIAAQLAALAEDIKTLAAMP
FT                   IEQISTLIEPGDRPEASSE"
FT   gene            complement(116673..117515)
FT                   /gene="kduI"
FT                   /locus_tag="SMa0214"
FT   CDS_pept        complement(116673..117515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduI"
FT                   /locus_tag="SMa0214"
FT                   /product="putative KduI DKI isomerase"
FT                   /note="4-deoxy-L-threo-5-hexosulose-uronate-ketol-
FT                   isomerase,function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64771"
FT                   /db_xref="GOA:Q930T2"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q930T2"
FT                   /protein_id="AAK64771.2"
FT                   /translation="MTISVSVRQVVGPEDAARRNTQGLRDGFVIEALFQPGRANLTYSH
FT                   LDRMIVGGVVPAADRLVIDRVAETGTQRFLDRREAAIINIGGSGTVSVGDKDHVLGFQE
FT                   ALYVGMGGGALGFASDDANAPALFYVLSAPAHRSCPTVHITRDMAKKLSLGSAEESNAR
FT                   TINQYVHPDVCESCQLLVGLTMFEPGSVWNTMPAHVHDRRMEVYLYFGMQEATRIFHFM
FT                   GEPGETRHVVLKNHEAVLSPGWSIHSGAGTGRYAFIWAMAGDNMSFTDMDKVPMEALR"
FT   gene            complement(117547..118287)
FT                   /locus_tag="SMa0216"
FT   CDS_pept        complement(117547..118287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0216"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Has similarity to cd03216, ABC_MOS_Domain1, The
FT                   domain I of carbohydrate uptake proteins that transport
FT                   only monosaccharides (MOS); The MOS family systems are
FT                   involved in the uptake of monosaccharides (pentose and
FT                   hexoses) like arabinose, D-allose, galactose, ribose and
FT                   xylose; The typical organization of these systems includes
FT                   Binding Protein (BP), Integral Membrane (IM) and ABC
FT                   subunits; The ABC subunit is made up of two homologous
FT                   halves, suggesting that a primordial gene duplication and
FT                   subsequent fusion event occurred in the generation of the
FT                   ancestral MOS system, Also similar to LivG, ABC-type
FT                   branched-chain amino acid transport systems, ATPase
FT                   component, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64772"
FT                   /db_xref="GOA:Q930T1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T1"
FT                   /protein_id="AAK64772.1"
FT                   /translation="MMSTPNLLELHNISKSFGALTALRNLSFHIGEGEVVGLLGDNGAG
FT                   KSTTVNLISGIHKPTDGYLSVDGKKTTFSCRSDSADAGIETIYQHTALVDSLSITRNIF
FT                   MGRELTDRFGFLRQREMRDIAMEVLQNAVHISGIDSPDTLVGNLSGGQKQAVAIARAVY
FT                   FKKRVLLLDEPTSALSVRETEALLNQVLKLKAENVSSVLVTHNLYHAYQVCDRFVIMSH
FT                   GTKVFDVQKADTTISQLTEYVVLT"
FT   gene            complement(118284..119363)
FT                   /locus_tag="SMa0217"
FT   CDS_pept        complement(118284..119363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0217"
FT                   /product="ABC transporter, permease"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64773"
FT                   /db_xref="GOA:Q930T0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q930T0"
FT                   /protein_id="AAK64773.2"
FT                   /translation="MGARRRARPVPRSPTIECQTVTPVLAESAAPRSRTQRQSILKQIM
FT                   GMPAGAIFLVFMTLQIVCIAGALLYPDEFRYLSPQNLTILMKAIPVLGCLALGAGVLMI
FT                   AGEFDLSIGSVYTFTAVLMASLVNAGLSAFIAAPIAILTGLLIGSLNGHITLRFGLPSF
FT                   IVTLGGLLFWRGAVLLYNGAVQVRFDPEPVFTSLFSGTLFGVNAAFIWIVLFVTGFHLL
FT                   LHRHRFGNHVFATGGNRGAAEAIGINTSRVKLIAFAIAGGMAAVAGILATARVGSVQPG
FT                   QGAGLELQAIAACVIGGLSLRGGRGSIIGIFLGVLLIHTITDVLLLLRAPGFYLDMFIA
FT                   TLIVLAAIFNHLIERRGLA"
FT   gene            complement(119373..120323)
FT                   /locus_tag="SMa0218"
FT   CDS_pept        complement(119373..120323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0218"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64774"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S9"
FT                   /protein_id="AAK64774.2"
FT                   /translation="MKLTRLRTAALAAGLATLLTSTALAADVKATMIIYLDPSVQFFNP
FT                   VVKGAQDAAAQFGVDLDVQYANNDPVRQNDLIESATASGVDGIAVAISSSDAFDESICA
FT                   AVKAGIIVIGFNNDDLDGAKGNCRQAYVGMDELASGYELGNRMIKEFGLKSGDVVFNPR
FT                   EIPEASFAVARGGGIEKAMTENGIKVETVRAGLDPAEAQNIIAQFLIANPNVKALFGTG
FT                   SVTSTVGAGAIKDAGVDIPFGGFDLAVEIVNAVESGAMYATMDQQPYLQGYYPIAQIAL
FT                   AKKYGLTPTDIDTGQGAFLDKTRIGSVKPLIGSYR"
FT   gene            complement(120444..121958)
FT                   /locus_tag="SMa0220"
FT   CDS_pept        complement(120444..121958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0220"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /note="CATALYTIC ACTIVITY: An aldehyde + NAD(+) + H(2)O =
FT                   an acid + NADH, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64775"
FT                   /db_xref="GOA:Q930S8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="PDB:3U4J"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S8"
FT                   /protein_id="AAK64775.1"
FT                   /translation="MLSNFIAPDSNDPRLRIKSRYQMLVDGKSVDAASGSTIDRVSPGH
FT                   AGEVVGTWPEASADDVRKAVAAARKAFDAGPWPRMSGAERSRLMFKVADLILARQEELA
FT                   LIESLEVGKPIAQARGEIGFCADLWSYAAGQARALEGQTHNNIGDDRLGLVLREPVGVV
FT                   GIITPWNFPFIIASERVPWAIGSGCTVVLKPSEFTSGTSIRLAELAREAGIPDGVFNVV
FT                   TGYGDPAGQVLAEDPNVDMVAFTGSVRVGTKLGEIAARTVKRVGLELGGKGPQIVFADA
FT                   DLDAAADGIAYGVYHNAGQCCISGSRLLVQEGIRDALMERLLDISRKVAFGDPLNERTK
FT                   IGAMISEAHAEKVHSYVTAGITSGAELLLGGERIGREAGLYYAPTVFAGVTPDMSIARE
FT                   EIFGPVLSTLTFKTADEAVALANATEFGLSASVWSTNLETALQTIRRIRAGRCWINSVI
FT                   DGTPELPIGGYKKSGLGRELGRYGFDEYSQFKGVHVTLGRPAPWFT"
FT   gene            122050..122778
FT                   /locus_tag="SMa0222"
FT   CDS_pept        122050..122778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0222"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /note="GntR, C-terminal, Bacterial regulatory proteins,
FT                   gntR family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64776"
FT                   /db_xref="GOA:Q930S7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S7"
FT                   /protein_id="AAK64776.1"
FT                   /translation="MVVQIGCQRMTAAKDMNLESLKIDTGETAAAQVERDLRESIIRLE
FT                   LAPGMRLSEQEIATRMGVSRQPVREALIALGKSKLVDIRPNRGTVVVRISARQMMEARF
FT                   VREAIEVAVARRASETFDSWTRRKIDTILARQKAANEAHDHNAFRREDEQFHIAIAEGA
FT                   GCGLAWNAVSDIKAHMDRVCNLQLRHPDSMKKLIAEHEAIITAIDARDADAAAAAMRSH
FT                   LNGILADLPQIEADNPDLFE"
FT   gene            complement(122852..123637)
FT                   /locus_tag="SMa0223"
FT   CDS_pept        complement(122852..123637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0223"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64777"
FT                   /db_xref="GOA:Q930S6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S6"
FT                   /protein_id="AAK64777.2"
FT                   /translation="MRCDRRCGGVKYRSWAQILCERHAKACRFGRRREAGGWLRLKASS
FT                   YILQVSYFWYIVMSSRPNKTQPPAKRVRLSREQRRRQLLDLAWHLVREEGSDALTLPRL
FT                   SQEAAVAKPVVYDHFGTRNGLLIALYRDFDARQTEMIDAALAGSGPTLEDRARVIATSY
FT                   VDCVLAQGREMPGVLAALAGSPELEAVKRDYQLAFIEKCRRALAAFVGRRGIEPAGFWA
FT                   MLGAANALSDAASTGEITAEQAQDELFETIVAMIERSHP"
FT   gene            123589..125061
FT                   /locus_tag="SMa0224"
FT   CDS_pept        123589..125061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0224"
FT                   /product="Permease, MFS"
FT                   /note="SUBCELLULAR LOCATION: Integral membrane protein
FT                   (Potential), SIMILARITY: Belongs to the major facilitator
FT                   superfamily; EmrB family, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64778"
FT                   /db_xref="GOA:Q930S5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S5"
FT                   /protein_id="AAK64778.2"
FT                   /translation="MPMTDTSLPRTVDRTAWLGLIAILPLVLLVAMDGSILYLAMPHVT
FT                   SALMPTADQALWILDIYGFVVGSLLIAFGNIGDRYGRLKLIITGAAVFGAGSLGAAYSQ
FT                   TPEQLIASRALMGLGGATLLPSGLAIVSALFPDPRLRAQAIGIFAATFAAGFAIGPLIG
FT                   GMLLRQFAWGAVFLINVPVVIGFMIGAPILLREVRSTVGGSIDLASLVLSFAGILLFTY
FT                   SLKNAAAYGFTPTQIVAGAAGIFALALFARRQTKLEYPLLDLGLFRDRIFSIAILTGLL
FT                   SLVVWSAAGYLSGVYLQSVLGIDVFAAALLTLPGAIVLTATCVATARIVERIGRKTALV
FT                   ATHLLIGAGVFLLLFTTTETGIAVFIASTMIAGIGYGLSFSLVADIAVSAVPANRAGAA
FT                   GSIAETSNELGNALGISLLGSLATLSFRLFGPGVAGTLDETLDQPGLAHQSLIQAQEAF
FT                   LTGMHVAIGTGGLLTLAVGMVAWLWLPSKLPE"
FT   gene            125261..126253
FT                   /locus_tag="SMa0226"
FT   CDS_pept        125261..126253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0226"
FT                   /product="dehydrogenase"
FT                   /note="SIMILARITY: To A.liquefaciens L-sorbosone
FT                   dehydrogenase, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64779"
FT                   /db_xref="GOA:Q930S4"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S4"
FT                   /protein_id="AAK64779.2"
FT                   /translation="MSVSFPRAGFLALVMVVALAFGVPFDAARGELLARVPAAREMAVC
FT                   GDTLFVGTKGSSVYAVSLPGGRARRVASGFSNANGVACSRGRLFVASRSSITAFEIGRG
FT                   GTLSGRRDIRRDLPNSGAHSFRYIALGPDARLYVSLGSPCNICVPGGLQGTIVSMNQDG
FT                   SDLRRVAWGVRNSVGFDWRGGRMFFTDNGADRMGDDVPPDELNALRPGGFYGFPYFGGQ
FT                   VPLTGFEDAMPPARQIPPVFNFQAHVAALGIHFFRSLGGDALVAQHGSWNRSVPVGYQV
FT                   VRVRFRGGRPVSAATFLRNVGRPVDVKEAPDGAILVSDDAGGAIHIFRR"
FT   gene            126420..127766
FT                   /gene="gdhA"
FT                   /locus_tag="SMa0228"
FT   CDS_pept        126420..127766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="SMa0228"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /function="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="CATALYTIC ACTIVITY: L-glutamate + H(2)O + NADP(+) =
FT                   2-oxoglutarate + NH(3) + NADPH, SUBUNIT: Homohexamer,
FT                   SIMILARITY: Belongs to the Glu/Leu/Phe/Val dehydrogenases
FT                   family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64780"
FT                   /db_xref="GOA:Q930S3"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S3"
FT                   /protein_id="AAK64780.1"
FT                   /translation="MNVDEKLEPILAEVLRRNGGEHEFHQAVREVLESLGRVIAKHPRY
FT                   AENALIERICEPERQIIFRVPWVDDKGQVQINRGFRVQFNSALGPYKGGIRFHPSVNIG
FT                   IIKFLGFEQTFKNALTGMPIGGGKGGSDFNPRGRSDGEIMRFCQSLMTELHRHLGEYTD
FT                   VPAGDIGVGGREIGYMFGQYKRLTNRYEAGVLTGKALFYGGSRARKEATGYGATYFVQR
FT                   MIATKGLDFEGKRVTVSGSGNVAIYTMEKVIEFGGKIVACSDSNGYVVDEDGIDLELVK
FT                   EIKEVRRERISEYARLKGAGTHYIEAGSVWDVPCDVAMPSATQNELTGKDARTLVKNGV
FT                   LAVGEGANMPCTPEAVRIFQEAGVLFAPGKAANAGGVATSALEMQQNASRDSWTFEQTE
FT                   ARLATIMQAIHDRCAETAEEYGTPGDYVLGANIAGFVRVAEAMDALGVI"
FT   gene            128085..128507
FT                   /locus_tag="SMa0229"
FT   CDS_pept        128085..128507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weak similarity to the GreB family of transcription
FT                   elongation factors, FUNCTION: Necessary for efficient RNA
FT                   polymerase transcription elongation past template-encoded
FT                   arresting sites; The arresting sites in DNA have the
FT                   property of trapping a certain fraction of elongating RNA
FT                   polymerases that pass through, resulting in locked ternary
FT                   complexes; Cleavage of the nascent transcript by cleavage
FT                   factors such as greA or greB allows the resumption of
FT                   elongation from the new 3'terminus; GreA releases sequences
FT                   of 2 to 3 nucleotides (By similarity), SIMILARITY: Belongs
FT                   to the greA/greB family, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64781"
FT                   /db_xref="GOA:Q930S2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S2"
FT                   /protein_id="AAK64781.1"
FT                   /translation="MSSIMVSSNLPLPFIGATDYRLLSRLAYQALSRDFDIAAELIEKL
FT                   ERPCVLPDDQVPPDVVKIGSIVTCEVEDGPCRTFSLVYPDDVDAEKGRISVLTPVGVAL
FT                   LGLRPGQAVEWFSRDGQRNHLIVVRVEDDVKDELAL"
FT   gene            128727..129278
FT                   /locus_tag="SMa0232"
FT   CDS_pept        128727..129278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="weak similarity to GreA family of transcriptional
FT                   elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64782"
FT                   /db_xref="GOA:Q930S1"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S1"
FT                   /protein_id="AAK64782.2"
FT                   /translation="MTRRKLERCAMSREAFCQLTAGDLNILMSMLDETGHTESFTILLR
FT                   EKLNYASVFFREDIPENVVTLDTQVGYTVNGVRTGPHLLVRNAAGRPANSAISVRTMRG
FT                   LALLGLAVGERTEILGEDGWPETLAVERIVFQPESEARLKQTSTEPVQLIDHAPQVVNF
FT                   RPRPRKAAIPHDDDPGPSAA"
FT   gene            complement(129300..130691)
FT                   /gene="otsA"
FT                   /locus_tag="SMa0233"
FT   CDS_pept        complement(129300..130691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="SMa0233"
FT                   /product="OtsA trehalose-6-phosphate synthase"
FT                   /EC_number="2.4.1.15"
FT                   /note="FUNCTION: Appears to play a role in controlling and
FT                   restricting the influx of sugar into glycolysis, probably
FT                   at the level of hexokinase; Necessary for trehalose-6-
FT                   phosphate synthase and phosphatase activities, CATALYTIC
FT                   ACTIVITY: UDP-glucose + D-glucose 6-phosphate = UDP +
FT                   alpha,alpha-trehalose 6-phosphate, SUBUNIT: Trehalose
FT                   synthase/phosphatase complex contains three or four
FT                   polypeptides of 56 kDa (TPS1), 102 kDa (TPS2), 115 kDa
FT                   (TPS3) and 123 kDa (TSL1), SIMILARITY: Belongs to the
FT                   glycosyltransferase 20 family, high confidence in function
FT                   and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64783"
FT                   /db_xref="GOA:Q930S0"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:Q930S0"
FT                   /protein_id="AAK64783.1"
FT                   /translation="MSRLVIVSNRVPVPDKGGIAPAGGLAVALKVALEEHGGIWMGWSG
FT                   RSSGENEPEPLAQLHQGNITYALTDLTDTDVGEYYHGFANRVLWPICHYRLDLAEYGRK
FT                   EMAGYFRVNRFFAHRLAPLVRPDDVIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPP
FT                   ADVLFTMPVHEEIMRGLSHYDVVGFQTDHDLENFAGCLRREGIGDELGGGRFSAYGRVF
FT                   KGGIYAIGIETAAFAEFAKKALTNKTVRKARESIEHRSLIIGVDRLDYSKGITQRIDAF
FT                   ERFILANPAQQGRVTYLQITPKSRSEVPEYEAMQRTVAEQAGRVNGALGAVDWVPIRYI
FT                   NRSVGRHILAGLYRLGKVGLVTPLRDGMNLVAKEYVAAQDPDDPGVLVLSRFAGAARDL
FT                   KGALLVNPYDIEGTANAMARALSMPLEERKDRWKTMMDHLLEHDVSRWCRDFLNDLATS
FT                   PDPSG"
FT   gene            complement(131106..132884)
FT                   /locus_tag="SMa0235"
FT   CDS_pept        complement(131106..132884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0235"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="Similar to dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64784"
FT                   /db_xref="GOA:Q930R9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R9"
FT                   /protein_id="AAK64784.1"
FT                   /translation="MTDKPQRRLRSQDWFDNPDHIDLTALYLERFMNYGVTPEELRCGK
FT                   PIIGIAQSGSDLTPCNRVHMDLAKRVRDGIRDAGGIPIEFPTHPIFENCKRPTAALDRN
FT                   LAYLGLVEILYGYPLDGVVLTTGCDKTTPSALMAASTVDIPAIVLSGGPMLDGWHEGDL
FT                   VGSGTVIWRMRRKLAAGEIDREEFMQAALDSAPSVGHCNTMGTASTMNAMAEALGMSLT
FT                   GCGAIPAAYRERGQMAYRTGRRAVELVFEDLKPSDILTREAFLNAIRVNSAIGGSTNAQ
FT                   PHLAAMAKHAGVELYPDDWQVHGFDIPLLANIQPAGAYLGERYHRAGGTPAIMWELLKA
FT                   GKLDGGCRTVTGRTVAENLEGREPTDREVIRPFDEPLKEKAGFLVLKGNLFDFAIMKMS
FT                   VVSDDFRKRYLQEPGREGVFEGKAVVFDGSEDYHKRINDPELDIDENTILVIRGAGPLG
FT                   WPGSAEVVNMQPPDHLLKRGIRSLPTIGDGRQSGTADSPSILNASPESAAGGGLAWLRS
FT                   GDVIRIDFNLGRCDMLVSDEDIERRKADGIPAVPADATPWQRIYRKSVTQLSDGAVLEG
FT                   AADFRQIAKNMPRHNH"
FT   gene            complement(132893..133774)
FT                   /locus_tag="SMa0237"
FT   CDS_pept        complement(132893..133774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0237"
FT                   /product="dehydrogenase"
FT                   /note="best similarity to 3-hydroxyisobutyrate
FT                   dehydrogenases, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64785"
FT                   /db_xref="GOA:Q930R8"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R8"
FT                   /protein_id="AAK64785.1"
FT                   /translation="MSGKTKIAFLGTGLMGAPMARRLLGAGFSVTVWNRDAAKAEPLAA
FT                   DGADIAASPADAVAGAAIVFTMLTNGQAVSEVLFERGVADSLAEGRIVVDCSSIAPQIA
FT                   REHARRLAEKGIRHLDAPVSGGVVGAAAGTLAIMAGGDGAAVESLKEVFAVLGRVTHVG
FT                   PSGAGQVCKLANQQIVAVTIGAVAEAMVLVEAGGASRAAFRDAIRGGFAESRILELHGA
FT                   RMVERNFAPGGASNNQLKDLNAVMAMADELSLELPLTRQVRQEFADFVESGGGEQDHSG
FT                   LLLQLEKLNPRN"
FT   gene            complement(133771..134754)
FT                   /locus_tag="SMa0241"
FT   CDS_pept        complement(133771..134754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0241"
FT                   /product="epimerase"
FT                   /note="pfam01370, Epimerase, NAD dependent
FT                   epimerase/dehydratase family; This family of proteins
FT                   utilise NAD as a cofactor; The proteins in this family use
FT                   nucleotide-sugar substrates for a variety of chemical
FT                   reactions; Similar to SMb20663 of S; meliloti pSymB, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64786"
FT                   /db_xref="GOA:Q930R7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R7"
FT                   /protein_id="AAK64786.1"
FT                   /translation="MHILIIGAAGMVGRKLTQRLVKDGTLGANSVEKLTLVDVVAPERP
FT                   QGFAGTVVAREGDLSASGEAEKLVEGRPDVIFHLAAIVSGEAELDFDKGYRINLDGTRY
FT                   LFDAIRLAHDQDGYKPRLVFTSSIAVVGAPLPFPIPDDYHLTPLTSYGTQKAICELLLS
FT                   DYSRRGFFDGIGIRLPTICIRPGKPNKAASGFFSNILREPLVGQEAVLPVSEDVRHWHT
FT                   SPRSAVGFLIHGATINLEKVGPRRNLSMPGLSATVGEQIEALRRVAGEKAVQLIRREPD
FT                   EMIMKMVAGWAPGFEAKRATELGFTAEKSFDEIIRVHIEDELGGKL"
FT   gene            134949..136394
FT                   /locus_tag="SMa0244"
FT   CDS_pept        134949..136394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0244"
FT                   /product="Dehydrogenase, FAD-dependent"
FT                   /note="Contains pfam01565, FAD_binding_4, FAD binding
FT                   domain; This family consists of various enzymes that use
FT                   FAD as a co-factor, most of the enzymes are similar to
FT                   oxygen oxidoreductase; One of the enzymes Vanillyl-alcohol
FT                   oxidase (VAO) has a solved structure, the alignment
FT                   includes the FAD binding site, called the PP-loop, between
FT                   residues 99-110; The FAD molecule is covalently bound in
FT                   the known structure, however the residue that links to the
FT                   FAD is not in the alignment; VAO catalyses the oxidation of
FT                   a wide variety of substrates, ranging form aromatic amines
FT                   to 4-alkylphenols; Other members of this family include
FT                   D-lactate dehydrogenase, this enzyme catalyses the
FT                   conversion of D-lactate to pyruvate using FAD as a co-
FT                   factor; mitomycin radical oxidase, this enzyme oxidises the
FT                   reduced form of mitomycins and is involved in mitomycin
FT                   resistance; This family includes MurB an UDP-N-
FT                   acetylenolpyruvoylglucosamine reductase enzyme
FT                   EC:1.1.1.158; This enzyme is involved in the biosynthesis
FT                   of peptidoglycan, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64787"
FT                   /db_xref="GOA:Q930R6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R6"
FT                   /protein_id="AAK64787.1"
FT                   /translation="MTSAGTIEDAKGPAELRLALRQMLGEDIVLSETEEMLRFCRDWHG
FT                   DVTTGTVAVIRPRSTQQVAAAVKACRELGLSIVPQGGNTGLVLGAIPDAPERQVVLSLS
FT                   RMNRIRKIDPADFSAVVESGCILSELKDAIAKMGMFFPLALGAQGSCQIGGNVSTNAGG
FT                   VNVLRYGMTRELVLGLEVVLPDGSILEGLSTLRKDNRGIDLKQLFIGAEGTLGIITAVS
FT                   ITLTPYPDHVATALLGLASLEDAIRLYRRARRDCCDLMSAFEFMPPLAFTLAQEAMPDL
FT                   PIPISAEYPAYVLMEISGSGLVDVDDLMQRFLEGAMEEGLVLDGTIAASQTQARNLWLI
FT                   REGMNEGQAKRGTHMRTDISVPLSQLASFVEEAEKAVSEALPGAVSVSYGHVGDGNVHL
FT                   NVLPPAGSTPEERIQLIYKAKTVVNEVLDRYTGSISAEHGIGRLKRPDFDARLPATRRK
FT                   LLTALKHAVDPEMIMNPGCQLRF"
FT   gene            136409..137119
FT                   /locus_tag="SMa0246"
FT   CDS_pept        136409..137119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0246"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /note="Belongs to the FadR subfamily of GntR regulators;
FT                   pfam00392, GntR, Bacterial regulatory proteins, gntR
FT                   family; This domain comprises the N-terminal HTH-
FT                   containing region of GntR-like bacterial transcription
FT                   factors; At the C terminus there is usually an effector-
FT                   binding/oligomerisation domain; The GntR-like proteins can
FT                   be divided into six sub-families: MocR, YtrR, FadR, AraR,
FT                   HutC and PlmA, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64788"
FT                   /db_xref="GOA:Q930R5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R5"
FT                   /protein_id="AAK64788.2"
FT                   /translation="MAAMDFGQISRSEHLPARIAAKIGREITEGRIAPGEKLPTEHLLA
FT                   TTFGVSRSVVREAIAQLRNEGLVETRQGVGAFATEIERRQSLRIEQGDLANRGSFRDLF
FT                   QLRIPLEVEAARLAAIHHTPQDLGKIDEALQQMTGAEKWTEQGIVADLAFHRAIAAATH
FT                   NEYFLLFIGFIAERISLAINAARAAAILEEIVEVTIAEHVSIRNGVSARDPVQAEEAMR
FT                   HHLNGAAARLDLTI"
FT   gene            137290..138486
FT                   /locus_tag="SMa0247"
FT   CDS_pept        137290..138486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has weak, perhaps spurious, similarity to members of
FT                   the fumarylacetoacetate (FAA)hydrolase family; This family
FT                   consists of fumarylacetoacetate (FAA) hydrolase, or
FT                   fumarylacetoacetate hydrolase (FAH) and it also includes
FT                   HHDD isomerase/OPET decarboxylase from E; coli strain W;
FT                   FAA is the last enzyme in the tyrosine catabolic pathway,
FT                   it hydrolyses fumarylacetoacetate into fumarate and
FT                   acetoacetate which then join the citric acid cycle"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64789"
FT                   /db_xref="GOA:Q930R4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R4"
FT                   /protein_id="AAK64789.1"
FT                   /translation="MSGGFLVSFEQALSAESIQPADASSAMLVGRVWSKTAGGPCPVLI
FT                   SEGEVFDLTPLAATISALLEIDGLVDALRDPSRFASLGSLDAFLRGEAGDLLAPADLQA
FT                   VKAAGVTFADSMLERVIEEQAKGDPLRAQEIRGRLAPVLGDNLKGLVAGSDKAAEVKKL
FT                   LQELGLWSQYLEVGIGPDAEIFTKAQPMSSVGCGAYIGIHPKSDWNNPEPEVVLAVTSK
FT                   GKIVGATLGNDVNLRDFEGRSALLLSKAKDNNASCSIGPFIRLFDGAFTIEDVKQAEVS
FT                   LVVDGKEGFKMTGISPMSAISRSPEDLVSQLLNDNHQYPDGVVFFLGTMFAPVKDRRGT
FT                   GLGFTHEIGDRVEISTPRLGRLVNWVDHSDRCPKWSFGLGALMKNLAERGLLQAKREG"
FT   gene            138487..139020
FT                   /locus_tag="SMa0249"
FT   CDS_pept        138487..139020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0249"
FT                   /product="TRAP-type small permease component"
FT                   /note="May transport L-arabinose, lactose and raffinose
FT                   based on induction pattern of the upstream gene, SMa0247,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64790"
FT                   /db_xref="GOA:Q930R3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R3"
FT                   /protein_id="AAK64790.1"
FT                   /translation="MQKAIDTFYKLLELLLIVLLAGMAVMVFLNVVLRYGFNSGINVSD
FT                   EMSRYFFVWLTFIGAVVTFRENSHVGVETLVSLFGRKGRIICMILSNIVVIAVSAIFFW
FT                   GTWKQSPINASMAAPVTGISMLWVYGIGYFTGAGVVLIALERLVRLLTGRVTEEEIAAF
FT                   AGENMTLEQLAERT"
FT   gene            139020..140297
FT                   /locus_tag="SMa0250"
FT   CDS_pept        139020..140297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0250"
FT                   /product="TRAP-type large permease component"
FT                   /note="May transport L-arabinose, lactose and raffinose
FT                   based on induction pattern of the upstream gene, SMa0247,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64791"
FT                   /db_xref="GOA:Q930R2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R2"
FT                   /protein_id="AAK64791.1"
FT                   /translation="MTLVVFIVSLLGAMAIGVPVAFSLMFCGVVLMWYMGMFNTQIIAQ
FT                   NMIAGADTFTLLAIPFFILAGELMNAGGLSRRIIDFAIACVGHIRGGLGIVAIMAAVIM
FT                   ASISGSAAADTAALAAILIPMMAKAGYNVPRSAGLIAAGGVIAPVIPPSMAFIVFGVAA
FT                   NVSITQLFMAGIVPGLIMGIALVATWLLVVRKDDIQPLPRTPMKERVGATGRALWALGM
FT                   PVIILGGIKAGVVTPTEAAVVAAVYALFVGMVIYRELKPRDLPGVILQAAKTTAVIMFL
FT                   VCAALVSSWLITAANIPSEITGFISPLIDRPTLLMFVIMLVVLVVGTALDLTPTILILT
FT                   PVLMPIIKQAGIDPVYFGVLFIMNTCIGLLTPPVGVVLNVVSGVGRVPLGKVIVGVTPF
FT                   LVAQILVLFLLVLFPDIVIVPARWLH"
FT   gene            140349..141353
FT                   /locus_tag="SMa0252"
FT   CDS_pept        140349..141353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0252"
FT                   /product="TRAP-type periplasmic solute-binding protein"
FT                   /note="May transport L-arabinose, lactose and raffinose
FT                   based on induction pattern of the upstream gene, SMa0247,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64792"
FT                   /db_xref="GOA:Q930R1"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R1"
FT                   /protein_id="AAK64792.1"
FT                   /translation="MRKLLLATTAIAFGLSAAAPAFAEFNDRNIRVSNGINEDHPVGNG
FT                   IKAMQACLDQKSGGKLKLTAFWGGALGGDLQATQALRSGVQEAVVTSSSPLVGIIPALG
FT                   VFDLPFLFANAQEAYTVLDGDFGDMMNEKLEAAGLVNLAYWENGFRNLSNSVRPVTKWE
FT                   DFEGMKVRVMQNNIFLDTFQNLGANATPMAFGEVFSALETKAIDAQENPYVTIDTSKFF
FT                   EVQKYVTETNHAYTPFLFLFSKPIFDSYTPEEQAALRECAVVGRDEERKVIQDLNKKSL
FT                   EKIKEAGLEVNTLSAEEQARIREKSMVVYEKHKAEIGAEVVDAILAKLEEIRK"
FT   gene            141517..142197
FT                   /locus_tag="SMa0254"
FT   CDS_pept        141517..142197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5482, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64793"
FT                   /db_xref="InterPro:IPR018679"
FT                   /db_xref="UniProtKB/TrEMBL:Q930R0"
FT                   /protein_id="AAK64793.1"
FT                   /translation="METSLYLPVKGFLEKAGYVVKGEVDGCDLVGLSDDDPPVVVICEL
FT                   KLRFNLELILQAVDRAAVADEVWIAARVSAKGKGREADKRYRDLCRRLGVGMLGISDAG
FT                   DVSVIVGSVTPMPRTNPKRRSKLMREHRRRRGDPAIGGSTRAPVMTAYRQQALGCALAL
FT                   TSGPLRVREIRSSVPDAGKILLANVYGWFERLDRGVYGLTAAGREALQRWPQQDMQAKT
FT                   AVPA"
FT   gene            142327..143304
FT                   /locus_tag="SMa0255"
FT   CDS_pept        142327..143304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="weak similarity to domain of DNA polymerase III,
FT                   epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64794"
FT                   /db_xref="GOA:Q930Q9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q9"
FT                   /protein_id="AAK64794.1"
FT                   /translation="MTSQLDMFARDVRPAAARAEASRARRQTSTSFSETEMLAALKATG
FT                   RYRILRKLEARTVASEVRPGFPLRGVILDTETTGLDARKCEIIEIGLVSFTYNEEGEIG
FT                   DVVAVYGGLQQPTIAIPPDITRLTGITDAMVAGQSIDIAAVQAIVGPADLIIAHNAGFD
FT                   RPFCEAFSDVFVRKAWACSVSEIDWSGRGFEGTKLGYLIGQSGYFHDGHRAVDDCFALL
FT                   GVLEQSSGGAALPPFAELYKASQRSRVRIFAENAPFDLKDVLKARGYRWSDGSDGRPKS
FT                   WWIEVAEEELEAELGFLRKEIYRWDEADPPTQRLTAFDRYRARR"
FT   gene            complement(143473..145566)
FT                   /locus_tag="SMa0257"
FT   CDS_pept        complement(143473..145566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0257"
FT                   /product="oxidoreductase"
FT                   /note="NADH:flavin oxidoreductase / NADH oxidase family,
FT                   (has a small NADH binding domain within a larger FAD
FT                   domain), some similarity to trimethylamine dehydrogenases
FT                   and StcD stachydrine utilization protein (N-methyl proline
FT                   demethylase, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64795"
FT                   /db_xref="GOA:Q930Q8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037348"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q8"
FT                   /protein_id="AAK64795.1"
FT                   /translation="MSRDSRFDILFEPVKIGPVTARNRFYQVPHCSGMGYRYPNAEAHL
FT                   RGMKAEGGWAVVSTQEAEIHPTSDLTPANEARLWDDGDLPALSAVTERVHAHGSLAAIQ
FT                   LVHNGLHVANRFSRMIPLAPSHAVSDSLDPVQARAMDKADITDMRRWYRNAALRAKKAG
FT                   FDIVYLYAGHDMSVLQHFLSRRHNDRSDEYGGSFENRLRLFREILDDVREAIGDTCALA
FT                   VRLAVDELMGPSGITCEGEGKDIISALGELPDLWDVNLSDWSNDSQTARFSEEGYQEPY
FT                   IRFVKSVTTKPVVGVGRYTSPDSMVRVVKQGILDFIGAARPSIADPFLPKKIEEGRIDD
FT                   IRECIGCNICTSGDNTNVPMRCTQNPTVGEEWRKGWHPETIARSEAPEPALIIGGGPAG
FT                   LEAARALAQRGVDVMLAEGGGEWGGRVARECRLPGLATWGRVRDWRIGQLSTRVNAELY
FT                   LHSPLSAADILQYGIPHVAIATGASWRTDGVGRTHRMALDFLSEGILVSPDAILSEGAE
FT                   AVPSDGPVVVFDDDCFYMGSVLAELLARRGRTVTFVTPESQVSPWSRNTLEQARIQKRL
FT                   IGLGVEIVTAMALAGRTKDQLELSCVYSGRSRPVDCATLVPVTARLPDETLWLELKARE
FT                   AEWADAGIKTITRLGDCLAPGLIAAAVYSGHQYARTYQEQVDKDRVPFMREDIARLYGL
FT                   RSG"
FT   gene            complement(145822..146667)
FT                   /locus_tag="SMa0259"
FT   CDS_pept        complement(145822..146667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="protein has a very weak, partial match to an
FT                   esterase/lipase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64796"
FT                   /db_xref="GOA:Q930Q7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q7"
FT                   /protein_id="AAK64796.1"
FT                   /translation="MTAQDLYRIRDFVPDFDTIAAEFAERSWAVSARADVRADIRYGSG
FT                   VREVIDLILPERVQAGAPLHVFVHGGYWRSGEKINYRFVAAPVLAAGGIAALVEYDLMP
FT                   GKRLDVLVDQVRRSVLWLQAHAGDFGADPARLTVSGHSAGAHLASFLAATGPEEAYPPS
FT                   LPTLQGLLLLSGIYDLSGIPDSFLRHEAEMTPMEAAAWSPLTSSQLPCPLRIIAYGADE
FT                   TAPFQNQAAGLCELLRAQDKSAELLPVPDLNHMSIVLDLADTDGVLGRQLHDLVAQPTR
FT                   "
FT   gene            complement(146683..148146)
FT                   /gene="gabD3"
FT                   /locus_tag="SMa0260"
FT   CDS_pept        complement(146683..148146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD3"
FT                   /locus_tag="SMa0260"
FT                   /product="GabD3 succinate-semialdehyde dehdyrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="Belongs to the aldehyde dehydrogenase family
FT                   (pfam00171); This family of dehydrogenases act on aldehyde
FT                   substrates; Members use NAD(P) as a cofactor, specificity
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64797"
FT                   /db_xref="GOA:Q930Q6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q6"
FT                   /protein_id="AAK64797.1"
FT                   /translation="MTFHAKFSGYADPALHAAGLYIGGKWQSGSGITVLDPSTGNLLAE
FT                   VADASIEDAQRAVDAADAAAAGWRATPARQRSEILRRWYQLMTQHAEELATLIALENGK
FT                   ALADARGEVAYAAEFFRWYAEEATRIPGEFRHTPSGSHNILVDHEPIGIAVLITPWNFP
FT                   AAMATRKIGPALAAGCTVILKPASETPLTAYAMARLGEEAGVPPGVVNVLTTSNPGGIT
FT                   NAMLADPRVRKLSFTGSTGVGRVLLAEAAKSVVSCSMELGGNAPFIVFDDADLEVALDG
FT                   AMIAKMRNAGEACTAANRFYVQAGIHDAFVAGLTARMKSLKLGPGYDPETQCGPMITQN
FT                   AVRKIDRLVSEALAAGARATTGGKPLTENGYFYPPTVLENVPVNASIAREEIFGPVAPV
FT                   YKFESDDEAIRLANNTEYGLAAYIYSRDLKRAMKVGKRIETGMLGINRGLMSDPAAPFG
FT                   GVKQSGLGREGGVTGILEFMEPKYFAVDY"
FT   gene            complement(148163..149362)
FT                   /locus_tag="SMa0263"
FT   CDS_pept        complement(148163..149362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0263"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Belongs to the iron-containing alcohol dehydrogenase
FT                   family (Class IV), Primarily NADH-dependent, although some
FT                   NADPH- dependent activity was observed, Similarity to
FT                   Agrobacterium tumefaciens AttL, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64798"
FT                   /db_xref="GOA:Q930Q5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q5"
FT                   /protein_id="AAK64798.1"
FT                   /translation="MNLFGTLRAPRELLFGAGQRHALGGIAAKLGHRALIVTDTRLAVD
FT                   ADLLALVRRLEEAGLEVMVDSSTLPDVPVESAIVSAAAASGFAPDLVIGIGGGSCLDMA
FT                   KCVTLLLTHGGRPQDYYGEYAVPGPVMPLIAIPTTAGTGSEVTPVAVLSDAERSLKVGI
FT                   SSPHLIPAVSICDPELTLSCPPGLTAIAGADALTHAIEAFTAIRREPVPGIAQQRVFVG
FT                   KNELSDHFALSAITLLWQGLERACKDGADAGARETVMLGATLAGLAFGVAGTAAAHAIQ
FT                   YPVGALTHTAHGLGVACLMPYVMTWNAPLIRDELAQIAHAAGLGGPDEVIPALVSLFER
FT                   IGIPATLRDLGLEEDRIDWVAEQSSGIARLIQNNPRPLNPHEMRNLVAAAHCGDRSRLN
FT                   "
FT   gene            complement(149384..150388)
FT                   /locus_tag="SMa0265"
FT   CDS_pept        complement(149384..150388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0265"
FT                   /product="dehydrogenase"
FT                   /note="SUBCELLULAR LOCATION: Cytoplasmic (Potential),
FT                   SIMILARITY: Belongs to the LDH2/MDH2 oxidoreductase family,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64799"
FT                   /db_xref="GOA:Q930Q4"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="PDB:3UOE"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q4"
FT                   /protein_id="AAK64799.1"
FT                   /translation="MRLPPARLRNLSVALLEKRGVPADSARLQANLLLEAELRGLPSHG
FT                   LQRLPLLLSRLDKGLANPTTRGNGTWRRASFLSVDGERGLGPVVMMDAMRVTRRILKET
FT                   GLAIAAIRNANHMGMLAYYAEAAARDGLIGIVMSTSEALVHPFGGTQALIGTNPVAIGI
FT                   PAAGHPFVLDLATSIVSMGKINNHAMRGLAIPPGWAVDRDGRATTDPHAAQAGAIAPFG
FT                   DAKGYGLGLAIELLVAALAGSNLAPDVNGTLDDIHPANKGDLLILIDPSAGAGSIPALA
FT                   AYLDRLRLSRPLDPTQPVAIPGDGARARRAAAAKTGIELPQPLFDHLTALEAA"
FT   gene            150483..151175
FT                   /locus_tag="SMa0267"
FT   CDS_pept        150483..151175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0267"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64800"
FT                   /db_xref="GOA:Q930Q3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q3"
FT                   /protein_id="AAK64800.1"
FT                   /translation="MVVAIAAERASRGAGIRPTSVVEGVYDSIYHRLMSLDIAPGARIP
FT                   IDVLARELGVSQTPIREALSRLEREGLVRKEHLIGYSAAPQWTRKQFEDLYAFRLLIEP
FT                   EAARLAAANMTPEALQQLENSAADMGHGEAPVDRNTRYSRFARADAQFHDEILKIAGND
FT                   VIRSTLSNQHVHLHIFRLMFHIRVTQEALEEHESLLAAFRARDPQAAYDAMRVHIERSR
FT                   DRLLSAFE"
FT   gene            151172..152764
FT                   /locus_tag="SMa0270"
FT   CDS_pept        151172..152764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0270"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Has two domains similar to those of carbohydrate
FT                   uptake proteins that transport only monosaccharides (MOS);
FT                   The MOS family systems are involved in the uptake of
FT                   monosaccharides (pentose and hexoses) like arabinose, D-
FT                   allose, galactose, ribose and xylose; The typical
FT                   organization of these systems includes Binding Protein
FT                   (BP), Integral Membrane (IM) and ABC subunits; The ABC
FT                   subunit is made up of two homologous halves, suggesting
FT                   that a primordial gene duplication and subsequent fusion
FT                   event occurred in the generation of the ancestral MOS
FT                   system, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64801"
FT                   /db_xref="GOA:Q930Q2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q2"
FT                   /protein_id="AAK64801.1"
FT                   /translation="MNAALPSNAVAPPPNRAVAALAAEGLGKAYGPITVLSDVTLEVHA
FT                   GEVHAIIGENGAGKSTLMKLLSGHVVPTAGHLLLEGKSVEFRNAVEAENAGIVLVHQEI
FT                   LLASDLTVAENLYLGREVGRGLLVNDKAMNSRAAELLARVGSAARPRDRVGELPLAQRQ
FT                   LVQIARALLDERKVIIFDEPTAVLANDEVAALLDIVRSLRDHGVAVLYISHRLDEVQAL
FT                   ADRITVLRDGRMIGTWPAAGLGQREMAELMVGRELDMLYPHKRSATTAAPILSVTNLAI
FT                   DHGSQTVSFSVSPGEVLGIGGMVGAGRTELIEGLMGLRPSEAESIVLNGREIGSRSVRT
FT                   LMDAGLVYLTEDRKGKGLLLEEKLGPNLTLQALDTINPGVFLDKQGELSRLRKAVADYD
FT                   IRVRSMRLEASQLSGGNQQKLLLAKVMMADPSVIIIDEPTRGIDIGNKSQIYDFIDGMV
FT                   RAGKACIVISSEMPELVGLADRVLVMRAGRIVAELRGDEINEENVVYAATTGGCADVGE
FT                   EKHDRSDSNTRTN"
FT   gene            152730..153725
FT                   /locus_tag="SMa0271"
FT   CDS_pept        152730..153725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0271"
FT                   /product="ABC transporter, permease"
FT                   /note="best similarity to branched amino acid, galactose,
FT                   ribose transport systems, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64802"
FT                   /db_xref="GOA:Q930Q1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q1"
FT                   /protein_id="AAK64802.1"
FT                   /translation="MTVATATLAPTNEGARIRWADLAPFIALAVIVLFGALVNPNFVSS
FT                   ANLINVITRSAFIAIIAVGATFVISSGGLDLSVGSMMAFVTGIMIMAMNHLAPAFGAWA
FT                   IPMGAGVALLVGALCGLFNGLIVTVGRIEPFIVTLGTMGIFRAFITFMTDGGSLPIDRS
FT                   LREAYRPVYFGSFFGIPYPVLITFVVVMAGAFLLYKTKYGRRLKSAGSNVEVARFSGVN
FT                   VAGVRTGAYVIQGFCVAVAAICYVPRLGAATPTTGQLWELQVITAVVIGGTLLRGGRGR
FT                   IGGTVAGALILEVIANVMVLSDLVSEYLVAAVQGAIIIIAMLAHRFTANR"
FT   gene            153755..154720
FT                   /locus_tag="SMa0273"
FT   CDS_pept        153755..154720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0273"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Most similar to the RbsB, ABC-type sugar transport
FT                   system, periplasmic component, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64803"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q930Q0"
FT                   /protein_id="AAK64803.1"
FT                   /translation="MKSIIRKAGLLLSTATLVLAQPLGTAQAQEKRIVAVSIPAATHGW
FT                   TGGVVYHAEQAEKEVEAAFPNVDVVLSTASSATAQVSALEDLSATRKLDALVILPFTSE
FT                   ELTGPVEQIKKNGTFISVVDRGLTDPTIQDLYVAGDNIAVGANTARWLSDKLGGQGEIV
FT                   VLRGIPTVIDDERIKGFSDVIDKTNIKILDIQYANWNQDEAFKLMQDYLAKYPKIDAVW
FT                   ANDDDMLLGVIEAVDRAGRKDIKYALGGNGMKQVIEMVKEGNERTPVSTPYPPSMIKSA
FT                   IYMTAAQFAGQAPMRGSFLLGAPLITPENADQFYFPDSPF"
FT   gene            154841..155428
FT                   /locus_tag="SMa0275"
FT   CDS_pept        154841..155428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains a domain similar to cd03169,
FT                   GATase1_PfpI_1, Type 1 glutamine amidotransferase
FT                   (GATase1)-like domain found in a subgroup of proteins
FT                   similar to PfpI from Pyrococcus furiosus; PfpI is an ATP-
FT                   independent intracellular proteases which may hydrolyze
FT                   small peptides to provide a nutritional source; Only Cys of
FT                   the catalytic triad typical of GATase1 domains is conserved
FT                   in this group; This Cys residue is found in the sharp turn
FT                   between a beta strand and an alpha helix termed the
FT                   nucleophile elbow"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64804"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P9"
FT                   /protein_id="AAK64804.1"
FT                   /translation="MSGKKILMLTGEFTEEYEIYVFQKGMEAVGHTVHVVCPDKKAGDR
FT                   IKTSLHDFEGDQTYTEKLGHYADINKTFSEVRPEEYDAVYAAGGRGPEYIRTDKRVQDM
FT                   VRHFHDTGKPIFTICHGVQILMAVPGVLKGRKVAGLGACEPEVTAVGGTYIDVEPTGAY
FT                   VDGNMVSAKGWTGLAAFMRECLNVLGTKITHT"
FT   gene            complement(155598..155948)
FT                   /locus_tag="SMa0277"
FT   CDS_pept        complement(155598..155948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4898, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64805"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P8"
FT                   /protein_id="AAK64805.1"
FT                   /translation="MEKHRIYSVSVASVYPHYVAKAEKKGRTKAEVDEIICWLTGYGPQ
FT                   ALDDQLAKNTSLENFFAQAPRMNPSRSLITGVICGVRVEEIQDTTMREIRYLDKLIDEL
FT                   AKGKAMDKILRK"
FT   gene            complement(156190..156489)
FT                   /locus_tag="SMa5016"
FT   CDS_pept        complement(156190..156489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5016"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to a short region in the carboxy-
FT                   termini of proteins annotated as aldehyde dehydrogenases;
FT                   Possible ORF fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5016"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07962"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW4"
FT                   /protein_id="ACF07962.1"
FT                   /translation="MVGFNGAKMSGYGAKGGLAHLATYLYTKSATFNARSHDFRSSGPG
FT                   GTQDFRSGYDDLHRPLASLARPGGIPSGTGVVGRARPDSRSIRLDRIIDLDDMQ"
FT   gene            complement(156800..157411)
FT                   /locus_tag="SMa0279"
FT   CDS_pept        complement(156800..157411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="weak, partial similarity to the ubiE/COQ5 family of
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64807"
FT                   /db_xref="GOA:Q930P6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P6"
FT                   /protein_id="AAK64807.1"
FT                   /translation="MGIYRDVILPRLCDLSMRNERLRPYRERVIGAAQGRVLEIGVGSG
FT                   LNLPFYGPVVGEVLALEPSAGLVAMAREAPRSDLPVSFIDASAEAIPLDDKSVDTVVTT
FT                   WTLCTIPDAAAALTEMRRVLRPGGKLLFVEHGLAPDRGVRWWQDTLTPVWRRISGGCHL
FT                   NRPIRSMIECGGFRMERVETGYMQGPKPMTFMYEGSARPE"
FT   gene            complement(157557..158345)
FT                   /locus_tag="SMa0280"
FT   CDS_pept        complement(157557..158345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="very weak, partial similarity to domain of MauE,
FT                   methylamine utilization protein, weak similarity to
FT                   glutaredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64808"
FT                   /db_xref="GOA:Q930P5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P5"
FT                   /protein_id="AAK64808.1"
FT                   /translation="MLDRTIPHNLARKAVLYRMVMPGHTCPYGLKTKDLLQRSGYEVDD
FT                   HHLTTREETDAFKAQHGVPTTPQVFIDGQRVGGYDDLRRFLGKPVADPKATTYRPVIVL
FT                   FTLTALTAMAASHAVNGTPFTLRAAEWFIAFSMVVLAMMKLQNVESFATMFLNYDLLAM
FT                   RWIPYSYIYPYAEGLAGVLMVAGALNWLSVPVAMFIGTVGAVSVFKAVYIDKRELKCAC
FT                   VGGSSNVPLGFISLTENLMMIAMAVWMAAGSIGLIATHAM"
FT   gene            158400..158804
FT                   /locus_tag="SMa0281"
FT   CDS_pept        158400..158804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0281"
FT                   /product="Transcriptional regulator, MerR/CueR family"
FT                   /note="The CueR-like proteins have been shown to activate
FT                   metal ion efflux and resistance regulons in many
FT                   eubacterial species; Besides transcriptional regulator of
FT                   the copper efflux operon, CueR from Escherichia coli, the
FT                   family includes Pseudomonas aeruginosa CadR, E; coli MerR,
FT                   Ralstonia metallidurans PbrR, Rhizobium leguminosarum ActP
FT                   and E; coli ZntR that regulate expression of the cadmium,
FT                   mercury, lead, copper and zinc resistance operons,
FT                   respectively; These proteins are comprised of two distinct
FT                   domains that harbor the regulatory (effector-binding) site
FT                   and the active (DNA-binding) site; Their conserved N-
FT                   terminal domains contain predicted HTH (helix-turn-helix)
FT                   motives that mediate DNA binding, while the dissimilar C-
FT                   terminal domains bind specific metal ions; These proteins
FT                   share the N-terminal DNA binding domain with other
FT                   transcription regulators of the MERR superfamily that
FT                   promote transcription by reconfiguring the spacer between
FT                   the -35 and -10 promoter elements, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64809"
FT                   /db_xref="GOA:Q930P4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P4"
FT                   /protein_id="AAK64809.1"
FT                   /translation="MVQSQDLQELTIGKLAAAGGVGVETIRFYQRKGLLATPKRLEGVR
FT                   RYGGEDVRRLRFIKQAQAAGFTLEEIGQLLALDAGHNRSAARELAKKKLEQLDARIGEL
FT                   NRAREALRKLVSECAEDKTGPCPILASFGV"
FT   gene            complement(159165..159389)
FT                   /locus_tag="SMa0285"
FT   CDS_pept        complement(159165..159389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="Miscellaneous; Hypothetical/Global homology"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64810"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P3"
FT                   /protein_id="AAK64810.2"
FT                   /translation="MSASAQLAKMAIEKGHGETSHIVWMKMGGLKDWELKPNILEGDWT
FT                   FVTKNSVDFQGPNTSPAPRDNIPKRCSSR"
FT   gene            complement(159590..160051)
FT                   /locus_tag="SMa0286"
FT   CDS_pept        complement(159590..160051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0286"
FT                   /product="hypothetical protein"
FT                   /note="Has short stretch of similarity in carboxy terminus
FT                   to Y4eO of Rhizobium sp; NGR234"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64811"
FT                   /db_xref="GOA:Q930P2"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P2"
FT                   /protein_id="AAK64811.1"
FT                   /translation="MSLFCGSGGRRRAVIHLFSRDLAQGKVPAGHTSCQTPSFRSTMAA
FT                   TSWRGPVHSSPSILRARAASRPRSDCLPSAPQGPTGNSAHTPLGGPVARGLDGSHEFLA
FT                   IDLVPVMRDASERLDLAAAREIVTASPDVLGGTPVIRGTPVPVYDVAAS"
FT   gene            complement(160062..160508)
FT                   /locus_tag="SMa0287"
FT   CDS_pept        complement(160062..160508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64812"
FT                   /db_xref="GOA:Q930P1"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P1"
FT                   /protein_id="AAK64812.1"
FT                   /translation="MNKGSTKAKRQENSRCENEEPTRKPGTSIAEWIVAGVSCLALLAV
FT                   LGYLILDGLSGRNGAADIIVLPAEVTAMNDGYVVEFAANNRAGKSVAAVEIKGELRGGE
FT                   EVVEESGVTIDYIPQKSERKGALIFRSDPEGYELRIFASGYSEP"
FT   gene            complement(160505..161341)
FT                   /locus_tag="SMa0288"
FT   CDS_pept        complement(160505..161341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64813"
FT                   /db_xref="GOA:Q930P0"
FT                   /db_xref="InterPro:IPR013416"
FT                   /db_xref="InterPro:IPR024464"
FT                   /db_xref="UniProtKB/TrEMBL:Q930P0"
FT                   /protein_id="AAK64813.1"
FT                   /translation="MTPAEGVVGPTPREFWIGLGRAFAGALIFAVPVLMTMEAWALGFH
FT                   LHPLRLALLLVATVPTLVLLHKYGGFRKSVGLRDRIADAFVALLVAAIAASAILFSFGI
FT                   VDADMPLREIVGKVAVQIVPGSLGASLARAQLGPSPLEGDAVPEPAYAGELFLMVVGAL
FT                   FLSVNIAPTEEVVLIAYKMNPWHEIALALGTLGLMHVFVYELEFRGTHNPEPGAGFVNI
FT                   FFRYTIVGYCLVMLVNFYILWTFGRTDGVGFSETLSAVVVLSFPGALGAAVARLIL"
FT   gene            161616..161984
FT                   /locus_tag="SMa0291"
FT   CDS_pept        161616..161984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity in central region of protein to Atu5467
FT                   of Agrobacterium tumefaciens"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64814"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N9"
FT                   /protein_id="AAK64814.1"
FT                   /translation="MVLFCSDPHISPETNPENAVSEFISYLFAILVVGPLQAEISERLR
FT                   GVPSTEIVQAGRACVAAEAPRLLQRAQEDWGWAAANAVGVSVGLIDPASLLAGQNADCD
FT                   RLVQVLSQSSGGNGDDEA"
FT   gene            complement(162273..162668)
FT                   /locus_tag="SMa0293"
FT   CDS_pept        complement(162273..162668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="weak, partial similarity to receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64816"
FT                   /db_xref="GOA:Q930N7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N7"
FT                   /protein_id="AAK64816.2"
FT                   /translation="MESVTILLAEDETLLLLDFEDALKEAGFMVLAVTSGKKAVEHLKA
FT                   AESSIAGIVTDIRFAESPSGWDVTRIAREIDPEMPVVYISGDSAPDWASQGVPKSIMIE
FT                   KPFVMSQMIVAISQLLNDRRAGAAALE"
FT   gene            complement(163041..164855)
FT                   /locus_tag="SMa0298"
FT   CDS_pept        complement(163041..164855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0298"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Belongs to the family of ABC_NikE_OppD_transporters,
FT                   The ABC transporter subfamily specific for the transport of
FT                   dipeptides, oligopeptides (OppD) and nickel (NikE);
FT                   Oligopeptides constitute an important sources of nutrients
FT                   and several systems are also involved in cell-to-cell
FT                   communication; Members of this family are found in all
FT                   prokaryotes and are characterized by two ABC subunits,
FT                   encoded by different genes; Nickel is an essential cofactor
FT                   for a number of enzymatic reactions; The Nik system of E;
FT                   coli provides Ni2+ ions for the anaerobic biosynthesis of
FT                   hydrogenases and is similar not only in subunit composition
FT                   but also in the primary amino acid sequence of the
FT                   components, to the oligopeptide ABC transporters, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64817"
FT                   /db_xref="GOA:Q930N6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N6"
FT                   /protein_id="AAK64817.1"
FT                   /translation="MKNLIEVRNLNIAYGGPSGWTNVVQDVSFEIAPGEAFGLVGESGC
FT                   GKSTVAYRLLGYGTINSLVQTGEVLFDGTDLLKLDAASLMRLRGNRIAFVPQNPTTSLS
FT                   PGMRVGSQICEMIATHKALPDGMTMERRIVELFTLVGLPDVGHRYPHELSGGQQQRVTI
FT                   AMAVACNPDLLVLDEPTTGLDVTTQRQIIQLLADLRSRIGMAMLYVTHDLALLAQIADR
FT                   VGVMYAGQLVEVAPCDKLLSAPAHPYSRGLIASIPTNDGTDRQARSLRGMLRRDEMSTG
FT                   CKFEPRCDFATGACRATPQLLELIEDARSVACMRWREATAPLAPSVTAKAVARTAVRSE
FT                   SLLSVTELSLSYQQPGLFNRLLGRTSPAVVREINLNLAAGEVVALVGGSGSGKSTIARA
FT                   ISARLPPRAGIIRLDGTALAPSLKDRSVEELRQIQYIFQNPDASLNPRGLRLFERTQEL
FT                   DDPCLYRNVERREDLVADQKLRIDEKCAGCYSKPPLDSKRTITSHARPPFRGRRPYRAS
FT                   AVPSPAAVRARSAIHAPKTGHPSRSRLPASSAAISLPKHWYATPPRQITTARRSRSDQC
FT                   RDLARDRAQASRRSALRRSAADRTANSC"
FT   gene            complement(164858..165745)
FT                   /locus_tag="SMa0299"
FT   CDS_pept        complement(164858..165745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0299"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to DppC, ABC-type
FT                   dipeptide/oligopeptide/nickel transport systems, permease
FT                   components, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64818"
FT                   /db_xref="GOA:Q930N5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N5"
FT                   /protein_id="AAK64818.1"
FT                   /translation="MSVITTIPARRFSRFNAERWRATPGPFKVGAVILVAHALFAILGV
FT                   FWTPYGFAEMGAGLPLSGASWQHPMGLDQIGRDVFSRFMHGAHIVLMLSFAGTMLGMVA
FT                   GTTLGLLSGYIGGWFDEVTQRIVEAMISIPFLALALVMIIAAGPALAGKPVLIVFVVGL
FT                   VYAPRIVRIARAAAMDIATREYVAVAELRGEGTWSIVFREILPNAANVLLVEFSLRLSY
FT                   APILIGALGFLGFGIRPPTPEWGLMISENRNLLIASPVTVFGPGLGLASLVIGFNLFTD
FT                   GLSRMLGQRPVAGA"
FT   gene            complement(165742..166695)
FT                   /locus_tag="SMa0300"
FT   CDS_pept        complement(165742..166695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0300"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to DppB, ABC-type
FT                   dipeptide/oligopeptide/nickel transport systems, permease
FT                   components, hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64819"
FT                   /db_xref="GOA:Q930N4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N4"
FT                   /protein_id="AAK64819.1"
FT                   /translation="MSVLRLLASRILFSVLTLLLVSVLIFLILEALPGDVATRILGRDA
FT                   TAKALELLRSQLDLDQPALVRYFQWLGDFLRGDLGVSIATGRPITDVLGPRIVNTLLLS
FT                   LFAFAIYLVLALVPAIIQATNRGKAVDNIISVITLVLLSLPDFLLATILLFLFAVAVPI
FT                   LPALATISEASTWQETLRAMVLPAVTLAIMMAVYAIRVLRDSLIEVLRSDYVRLAELKG
FT                   LRPTAVLFRHALPNAIVPALNVTALNFGFLIGGVVIVERVFSYPGFGTLLIDALQLRDI
FT                   PLIKATVMISAVVYVAANLVADVLAVLLQPRLRTSR"
FT   gene            complement(166692..167360)
FT                   /locus_tag="SMa0301"
FT   CDS_pept        complement(166692..167360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0301"
FT                   /product="hypothetical protein"
FT                   /note="local similarity to other hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64820"
FT                   /db_xref="GOA:Q930N3"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR031723"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N3"
FT                   /protein_id="AAK64820.1"
FT                   /translation="MTVFALTTFLNSFADALDRDARTVSRSHAARLRRLADQLPPMNDV
FT                   PQGRVPIQAACEAELAAHDQSAIARALATLLPFVHITRSKSYLANPPSSDFGENYGYGV
FT                   ICGPSSGPPALIKDPDIALGLMFLGPKTHYPLHHHPADELYYTVTGPSFWRAGEADWTR
FT                   RGIDEIIHHPPWLPHATLSAEGPLVLLYIWEGDLETDAAFIPDTVTADAALSSMGLDAT
FT                   "
FT   gene            complement(167430..168956)
FT                   /locus_tag="SMa0302"
FT   CDS_pept        complement(167430..168956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0302"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Similar to pfam00496, SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5 and DdpA,
FT                   ABC-type dipeptide transport system, periplasmic component,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64821"
FT                   /db_xref="GOA:Q930N2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N2"
FT                   /protein_id="AAK64821.1"
FT                   /translation="MKRHLLKGTALAVTMAACSFGATVAFAQEGCVRVLGYESDGEKQT
FT                   MDPAALIGTDSVYHIRAVYEPLVDRSNTMQPVPALAESWESNADATEWTFHLRKGVKFH
FT                   DGSDFDAKDVVYSYRRLLDPAVSPGGFSTLAFLDADGITAIDDHTVRFKVKEPVVELPM
FT                   LIATKYALMVPEGAKSEDLRVKGNGTGPFMQETFTINGAVRVMRRNPTYWRAGLPKSEC
FT                   LEITTSLEPTSRLSALLSGTVDLSLTVDPASLITLKDNPAVELAATPGATSLYIAVWTD
FT                   TPPFDSVKVREAMKLVMDRQKILDTVLLGYGEVGADTPIPPSSPFGLGTPAKTADIEKA
FT                   TALLAEAGHPDGIDFDLYTSDSYPGMMLLAQVYAQMAAPAGIRVNVITSPAEGYWDTIW
FT                   LKKPAVISYTSARPPAEALTLSLNSKSEWNETHWTRDDFDALVVKAGQTADEKQRNDLY
FT                   RDAQRIVADEGGMILPVFSSVVAGLRKGCSGYEPNVDVNRIDYAELTCAD"
FT   gene            169064..169942
FT                   /locus_tag="SMa0303"
FT   CDS_pept        169064..169942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0303"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Contains a LysR-type HTH and substrate binding
FT                   domain, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64822"
FT                   /db_xref="GOA:Q930N1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N1"
FT                   /protein_id="AAK64822.1"
FT                   /translation="MVRRNLPPLTTLRAFEAAARLMSFKAAAEELRVTQSAVSHQVASL
FT                   ERNLGTPLFVRLPGRVELSQEGTVYFPVVQDALDKIALTTDLIRKTNTSASLTVQVYVT
FT                   VAVRWLIPRLQAFKEASPEIAVNLDASLLDWEFNPDRADVGFIYTRAPNRPNLTYTLLR
FT                   RERLVGVCSPAIARAIKTAEDLRHFSFLSVSGTTDDAETWAASVGVAGLSQKSSPLFDS
FT                   NLLAIEAAANGQGVVVVPQFLVEGDIANGNLVAPLASDVMQPGGWYLVHLQRRGNEKAI
FT                   RKFLQWIQSQT"
FT   gene            complement(170035..171675)
FT                   /locus_tag="SMa0306"
FT   CDS_pept        complement(170035..171675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0306"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="Belongs to the phenylalanine ammonia-lyase (PAL) and
FT                   histidine ammonia-lyase (HAL) family; PAL and HAL are
FT                   members of the Lyase class I_like superfamily of enzymes
FT                   that, catalyze similar beta-elimination reactions and are
FT                   active as homotetramers; The four active sites of the
FT                   homotetrameric enzyme are each formed by residues from
FT                   three different subunits; PAL, present in plants and fungi,
FT                   catalyzes the conversion of L-phenylalanine to E- cinnamic
FT                   acid; HAL, found in several bacteria and animals, catalyzes
FT                   the conversion of L-histidine to E-urocanic acid ; Both PAL
FT                   and HAL contain the cofactor 3, 5-dihydro-5-
FT                   methylidene-4H-imidazol-4-one (MIO) which is formed by
FT                   autocatalytic excision/cyclization of the internal
FT                   tripeptide, Ala-Ser-Gly, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64823"
FT                   /db_xref="GOA:Q930N0"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q930N0"
FT                   /protein_id="AAK64823.1"
FT                   /translation="MRIDSLFHSVVGACLLFSSPVMADVLLNGRNATPEMIVRVAKGEA
FT                   VTVDGESLDKVERAYAVLLQGAKEGQEIYGLTVGVGWNKDRKMVDATGELTPELMEASR
FT                   EFNEGLLRAHSVGVGPDAAVPVVRAAMAVRLNNILTGGPGVQPHVAEMLLAFLNKGITP
FT                   TMPSRGSVGQADMTLLSHIGLAMLGEGDVDYQGRRMSAAEALKAAGIEPLKPFGKDGLA
FT                   ILSSNAYAAGLAALAIHDAEQLLSTSRLVYALSLEGLNGNVSPLLEDVAALRPFPSHLS
FT                   STTELRALLEGSYLWQADDKRILQDPLSFRTAPYLLGSFADSLARTKALVQIQINSSDD
FT                   NPGIVVGVEPKSDLFQARRGYVEGGAVLPTANFEPLPWIIAFEELGIVLAHHTTASSER
FT                   VLKLNNPTHTKLARYLGTENTHHAFLVVEAPLMALATENRALAQPTSFDSRPIAGGVED
FT                   VGTNAPLVVERIRAQIDNSFTILSMEMLHAAQAADLRLKGHPERKLSTATTSFHDAFRQ
FT                   RVPFLDRDRSMTPDIAAGTAFLKEYALTN"
FT   gene            complement(172016..173002)
FT                   /locus_tag="SMa0307"
FT   CDS_pept        complement(172016..173002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0307"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Contains LysR-type HTH and substrate binding
FT                   domains, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64824"
FT                   /db_xref="GOA:Q930M9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M9"
FT                   /protein_id="AAK64824.1"
FT                   /translation="MSRSAIKSISIMQVIDHFNLRSFDLNLLVAFDAMMEEMSVTRAAQ
FT                   RLKIQQPAMSHNISTLRTLFQDELFIRVGQVMKPTARALNLSGPVRQALRQAQAAVLMA
FT                   DVFDPATEQRTFRLGLSSEVELLLLPDLTARLRDIAPGIRILARGGDAAEVDAMLDAGV
FT                   IDLSVGCSYLPDSRHHCEPLYQSSVLCCFNPQLLEISNPVSLDAYMAAQHAVISQTDSL
FT                   HGCVKDALEHAGAELEVVAAAPDFMSILATARSSAVIATVSSRIAARYGPLLGLQVSPV
FT                   PLALSFPPVAMVWPLHMDSDLGCAWLRQQIREAMLRTTETNVADIAA"
FT   gene            173063..174022
FT                   /locus_tag="SMa0308"
FT   CDS_pept        173063..174022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="Beta-lactamase-like, Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64825"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M8"
FT                   /protein_id="AAK64825.1"
FT                   /translation="MPSRRSILKSALTGLIVAPFVAPSVTFAKAPFAVVQAPGYYRLKI
FT                   GSVEVTALSDGTVALPLAKLYTNTSEHDAQNALKDAFLPDMVPTSVNAFLVNTGERLVL
FT                   IDAGTGGYLGASLGKLVSNIEASGYKVGDIDDVILTHIHTDHSGGLMSNGKRTFPNATL
FT                   RVNEREAKFWLSSANAMTATGTVKQHFGEADQCVTPYVKAGKFETFADNAAPVPGLGSI
FT                   LYAGHTPGHSAITLESESQKIVFWGDITHGDILQFDEPGVAIEFDIDQKAAVAARNTAF
FT                   KQAVEGKYLVAGAHIAFPGIGHVREDSKNYDWLPINYA"
FT   gene            complement(174273..175004)
FT                   /locus_tag="SMa0310"
FT   CDS_pept        complement(174273..175004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0310"
FT                   /product="hypothetical protein"
FT                   /note="Contains a LysR-type substrate binding domain, but
FT                   is lacking a helix-turn-helix DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64826"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M7"
FT                   /protein_id="AAK64826.1"
FT                   /translation="MRLTEAGNRLHETLSQPMAEVRSAFENVAGDARPSGLLRIAVTSI
FT                   AEQFLSGPLIASFAETHPGITIDVTVTDDVFDIVAAGFDAGVRLGEVIEQDMVAVPLTK
FT                   EEREVVVATPRYFELHGTPRHPRELVRHRCVGWRPSPSAAPYRWEFEEDGIPFDVAVEP
FT                   QITTNDLHLMIRTALAGGGITFALEETFRPYIVRGELITALDDYLPPFPGFFLYFPNRR
FT                   NMAPKLRALIDHVRAYRPTPS"
FT   gene            175343..175876
FT                   /locus_tag="SMa0312"
FT   CDS_pept        175343..175876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64827"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M6"
FT                   /protein_id="AAK64827.1"
FT                   /translation="MAFGICAAPVAAQDSSCPREGADAPLALHADWIMKGWERHEGDGK
FT                   FEFSQKLNRYYDLENTKGVFYDNFAPGSTQLFDNSARYGANWEALQNAARSVRHGLTGG
FT                   HDVIVSDTVASTTLGFVGRIDRLDGAVVAFDGRSQLGWTCTGGEWKIRHELNYAWVVEP
FT                   ETIQSFLGKTEPAQ"
FT   gene            175873..176124
FT                   /locus_tag="SMa0314"
FT   CDS_pept        175873..176124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64828"
FT                   /db_xref="InterPro:IPR020955"
FT                   /db_xref="InterPro:IPR038646"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M5"
FT                   /protein_id="AAK64828.1"
FT                   /translation="MTSQTLSHPYVGMWETTDGRIRHQLLPNGRYDEARGSRESAYRGR
FT                   YEVSGNHIEYWDDTGFTADGDFVDDVLHHAGMVLYRKQ"
FT   gene            176207..177469
FT                   /locus_tag="SMa0316"
FT   CDS_pept        176207..177469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="has 2 complete domains and 1 partial domain similar
FT                   to those found in carboxymuconolactone decarboxylase family
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64829"
FT                   /db_xref="GOA:Q930M4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M4"
FT                   /protein_id="AAK64829.1"
FT                   /translation="MTMTHIEQQLENLASPGDRQKHLRGLAVLKQIGGENFGGPVSQLA
FT                   SFSEDLARFTIQYPYGDVLSRDGLDLRTRQILTAATLLAHGSAQSQLSFHLYGLLNAGG
FT                   TRADVVDLLFISAGLLGFPTAINAVPIVRDILADRDETKNVAGAQTSPAVPDMPSDRFA
FT                   VLDRIAPDFVNWREHTLGEEIFGAVHLEPRLAHLASAAMLAARGKVGASFDAHIVSALA
FT                   AGATDSDIVEMVIQLSVYSGFPAALNAAGRARNVLAAPERPQASTQKGVDTTKDDEKRF
FT                   MRGVATLAETSGGSGADVVDSFKDVAPGLGRLIVAHCYGDIFCRPALDPKVRELGAISA
FT                   LAAQGTVAAEKPLGVHIDAALNLGATPEEIVETLFNIIPYAGYPLIEKALLIAHDRISL
FT                   FDEKQVDGSPSDHRTLDMCSG"
FT   gene            177973..178974
FT                   /locus_tag="SMa0319"
FT   CDS_pept        177973..178974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0319"
FT                   /product="Transcriptional regulator, AraC family"
FT                   /note="Contains an AraC-type DNA-binding HTH domain, but is
FT                   lacking the amidase domain, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64830"
FT                   /db_xref="GOA:Q930M3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M3"
FT                   /protein_id="AAK64830.1"
FT                   /translation="MANIEASRQNVSPPIPAVAGNPIYPAVLVPELNEVIARPDRTSPL
FT                   GLEQYIAGRTLVSGDTPAWSDMFVQVYSRLNKQEPFLVPAVAEPLIVWVMSGEAVVEER
FT                   DLDGDWVANTVTVGDFFLTRSPTPYEMRWRSVDAAPFQVMHLYLSVPLFERVAYDVLGC
FT                   AAPPALRDISGGRDTQLSHLLALVHQELTAEGKGSQLFIQGLAQSLAVHLIRNYAANEA
FT                   DDRQNALTGFKLRRAVAHLEEHLAEPFNLAQLAETVGMSEFHFSRLFKKATGLSPSRYF
FT                   IRQRVARAQLLLQETDTSIIEIGMSVGYSSPSHFAQVFRRETGLPPSHYRRG"
FT   gene            179119..179868
FT                   /locus_tag="SMa0320"
FT   CDS_pept        179119..179868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0320"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Belongs to the short-chain dehydrogenases/reductases
FT                   (SDR) family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64831"
FT                   /db_xref="GOA:Q930M2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M2"
FT                   /protein_id="AAK64831.1"
FT                   /translation="MTSLNGKIALVTGASSGIGAATAAKLAEAGAKVGIAARRTDKLED
FT                   LKKKIEAKGGEALVIEMDVVDTTSVEAGVKKLVDAYGSIDILVNNAGLMPLSDIDQFKV
FT                   DEWQRMVDVNVKGLLNTTAAVLPQMIKQHSGHVFNMSSIAGRKVFKGLSVYCATKHAVT
FT                   AFSDGLRMEVGQKHGIRVTCIQPGAVATELYDHITDPGYRQQMDELATQMTFLQGEDIG
FT                   DTIVFAAQAPAHVDVAELFVLPVEQGW"
FT   gene            179926..180474
FT                   /locus_tag="SMa0322"
FT   CDS_pept        179926..180474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has weak similarity to a flavin reductase like
FT                   domain; This is a flavin reductase family consisting of
FT                   enzymes known to be flavin reductases as well as various
FT                   oxidoreductase an"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64832"
FT                   /db_xref="GOA:Q930M1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M1"
FT                   /protein_id="AAK64832.1"
FT                   /translation="MKELPASQAYRVLEPGPIVMVSTSDNGKPNVMTMGFHTMIQHDPP
FT                   LIGCVIGPWDHSYQALRKTGECVIAVPGLDLAETVVDVGNCSGDRVDKLQRYGLMTQPA
FT                   RDVSAPLLRDCLANIECRVVDTRLLDPYNLFILEATRIWINENRKERRMMHHRGDGTFT
FT                   VDGGTLDLKDRMVRWRHLP"
FT   gene            180525..180809
FT                   /locus_tag="SMa0323"
FT   CDS_pept        180525..180809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="pfam07045, DUF1330, Protein of unknown function
FT                   (DUF1330); This family consists of several hypothetical
FT                   bacterial proteins of around 90 residues in length; The
FT                   function of this family is unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64833"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q930M0"
FT                   /protein_id="AAK64833.1"
FT                   /translation="MSAYLIVDLDIHDMKSIEDYRSKALPLVAKAGGKLIAIDESPLEL
FT                   EGWIATNMLIIEFPDKDAIRQLFASPEYAPLAAQRQAAAASRIIAINGV"
FT   gene            180910..181212
FT                   /locus_tag="SMa0325"
FT   CDS_pept        180910..181212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="Function unknown but has weak similarity to a domain
FT                   found in monooxygenases involved in the biosynthesis of
FT                   several antibiotics by Streptomyces species"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64834"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L9"
FT                   /protein_id="AAK64834.1"
FT                   /translation="MADLTNVAYFTAKPGRSGELGDELLQLVTPSRNEEGCLRYEIHQS
FT                   NDVPDVWMVLEDWRHASDFKLHMNTPYVQAFMAKVPDLCVEDVEICGYQQRSPQV"
FT   gene            181233..182072
FT                   /locus_tag="SMa0326"
FT   CDS_pept        181233..182072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0326"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Belongs to the short-chain dehydrogenases/reductases
FT                   (SDR) family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64835"
FT                   /db_xref="GOA:Q930L8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L8"
FT                   /protein_id="AAK64835.1"
FT                   /translation="MSTQNPKVWLVTGCSTGFGRYIAEHLLEVGEKVVVTARKADKIAD
FT                   LEQKGDALILPLDVIDRDQCQKVVDAAEAHFGRIDVLINNAGIGFFGAIEETDESNARR
FT                   LFDVNFFGTANTIHSVLPHMRARRSGTIVNLTSIGGLVGYTGVGYYCATKFAVEGLSDT
FT                   LRNEVAPLGINVMTVEPSAFRTEWAGSSNEVSASIEDYEATAGEARRAYHTSVGKQAGD
FT                   PARAAKAIREAVLAQQPPHHLPLGNDAADAALKKAEDLKANVLAWEALSRSADFPAN"
FT   gene            182145..182906
FT                   /locus_tag="SMa0329"
FT   CDS_pept        182145..182906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0329"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Belongs to the short-chain dehydrogenases/reductases
FT                   (SDR) family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64836"
FT                   /db_xref="GOA:Q930L7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L7"
FT                   /protein_id="AAK64836.1"
FT                   /translation="MSKRFDGKVAIVTGGGSGIGAAIANRLLEEGASVMMSGRTEKRLS
FT                   DVASKMPADRSGIFVANVSSRPDCDALVAATVERFGRIDTVVNAAGMNFVGTIQETSDQ
FT                   DWDECIASDLSGVFYMSRAAVPHLKETKGSIVNIGSVSSLGGGWSHAAYNAAKGGVANL
FT                   TRSAACDLGKFGVRANTVAPGLTVTGMVEAIMDDDALLEKAWDRIPLRRAGQPASAVAF
FT                   LASDEAAWITGIVLPVDGGQTCTDGGPEWGK"
FT   gene            complement(182962..183186)
FT                   /locus_tag="SMa5017"
FT   CDS_pept        complement(182962..183186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5017"
FT                   /product="hypothetical protein"
FT                   /note="Predicted membrane protein; Has similarity to the
FT                   carboxy-terminal half of DoxX family proteins; Together
FT                   with the adjacent gene, SMa0333, may comprise a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5017"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07963"
FT                   /db_xref="GOA:B3KLW5"
FT                   /db_xref="InterPro:IPR002995"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW5"
FT                   /protein_id="ACF07963.1"
FT                   /translation="MTEIVGSIALILGFQTRIVALILALFSVATALTFHNNLSDLNQFI
FT                   HFFKNIAMAGGLLQVVAFGAGRYSLDARR"
FT   gene            complement(183183..183395)
FT                   /locus_tag="SMa0333"
FT   CDS_pept        complement(183183..183395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to S; meliloti SMb20597 and has local
FT                   similarity to a group of DoxX proteins; Together with
FT                   adjacent ORF, SMa5017, may comprise a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64837"
FT                   /db_xref="GOA:Q930L6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L6"
FT                   /protein_id="AAK64837.1"
FT                   /translation="MSYSDTIAQRVETLSHSALINGVAPLAGRVLLAAIFLLSGISKIS
FT                   DPAGTIGYINMVGLPFPPLSYGAPY"
FT   gene            complement(183576..184352)
FT                   /locus_tag="SMa0335"
FT   CDS_pept        complement(183576..184352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0335"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Belongs to the short-chain dehydrogenases/reductases
FT                   (SDR) family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64838"
FT                   /db_xref="GOA:Q930L5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L5"
FT                   /protein_id="AAK64838.1"
FT                   /translation="MSTSNILDGKVVIVTGASSGIGRAIAIRAAEHGAKAVIVSDVVEA
FT                   PREGGEPTASEIRKLGAESVFVKADVSRKVDNDALVAAAEEFGGVDVMVANAGITLKTD
FT                   GAEVPEDDYRRLMSVNLDGPLFGAQAAARQMKALNKQGSIVLMASMGGISGAGITVAYS
FT                   TSKGGVVLMAKSLADALGPDGIRVNAVAPGTIDTELLRTSPGIAQASEGFRQRTPLRRL
FT                   GKPAEVGDAVAFLGSDLSSYVSGTALLVDGGLLAVI"
FT   gene            complement(184339..184821)
FT                   /locus_tag="SMa0337"
FT   CDS_pept        complement(184339..184821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0337"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity in its amino-terminus to various
FT                   hypothetical proteins; Very weak, probably spurious match
FT                   to part of COG5485, predicted ester cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64839"
FT                   /db_xref="GOA:Q930L4"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L4"
FT                   /protein_id="AAK64839.1"
FT                   /translation="MSDHHEASYEALKAVVRRNTLEVQSGGNFELFDELFADDFLDHTP
FT                   QPGGTPDKEGARRLYHALREAFPDFHAEIHWQAVDGDIVTTFKTYHGTHQGVVLGSRQR
FT                   AARSSSKPSTPCAFATARSSNTGGSPTSTIFCSNSTRCPPRPPKCRNIKDHHDEHQ"
FT   gene            complement(184847..185620)
FT                   /locus_tag="SMa0339"
FT   CDS_pept        complement(184847..185620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0339"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Belongs to the short-chain dehydrogenases/reductases
FT                   (SDR) family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64840"
FT                   /db_xref="GOA:Q930L3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L3"
FT                   /protein_id="AAK64840.1"
FT                   /translation="MSSLFSNKVVTVTGAGSGIGRAIALGLARDGATVHLADRDADGLT
FT                   QTAELIRAEDGRAFTTELDVASELQVVGWIEQIGSTSGRLDAAFNNAGITGPAKRIEDY
FT                   PLEDFQRVIAVNLQSVFLGMKYQIPLIKRNGGGSIVNTASIAALTGPGGMSAYAASKHG
FT                   VQGLTRVVAMENAAHGIRVNAIAPGWTETPMVAANSQQNPAFAALAQNAIPAKRGGKPE
FT                   EIAAAAIWLASDAASYVTGHMLTVDGGMTIGGFEL"
FT   gene            complement(185692..186300)
FT                   /gene="wrbA2"
FT                   /locus_tag="SMa0340"
FT   CDS_pept        complement(185692..186300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA2"
FT                   /locus_tag="SMa0340"
FT                   /product="WrbA2 flavoprotein"
FT                   /note="Belongs to the WrbA family of flavoproteins; These
FT                   proteins are found in all three domains of life and contain
FT                   flavodoxin-like domains; This family contains documented
FT                   NAD(P)H:quinine oxidoreductases from the Fungi and
FT                   Viridiplantae; Possibly forms a dimer or tetramer with one
FT                   flavin mononucleotide bound per monomer, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64841"
FT                   /db_xref="GOA:Q930L2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q930L2"
FT                   /protein_id="AAK64841.1"
FT                   /translation="MTRVLVLYYSSYGHIETMAGAVAEGARSTGAEVTIKRVPETVPIE
FT                   VADKAHFKLNQAAPVATVAELADYDAIIVGTGTRFGRMSSQMAVFLDQAGGLWARGALN
FT                   GKVGGAFVSTGTQHGGQETTLFSIITNLMHFGMVIVGLPYSHQGQMSVDEIVGGAPYGA
FT                   TTVAGGDGSRQPSQIDLAGAFHQGEIVARTAAALVAARN"
FT   gene            186524..186718
FT                   /locus_tag="SMa0341"
FT   CDS_pept        186524..186718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64842"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L1"
FT                   /protein_id="AAK64842.1"
FT                   /translation="MAKGLLGGGEMKFYPQDALTQAGGRFSQSDAPFSAHVVTDRELIT
FT                   GQNPASAPAVAQELLKRLK"
FT   gene            complement(186903..187337)
FT                   /locus_tag="SMa0343"
FT   CDS_pept        complement(186903..187337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Atu2189 of Agrobacterium tumefaciens"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64843"
FT                   /db_xref="GOA:Q930L0"
FT                   /db_xref="UniProtKB/TrEMBL:Q930L0"
FT                   /protein_id="AAK64843.1"
FT                   /translation="MEKTPDTFVDLGRGTPAWFTFAARILPVGILGQLLSAGLALFRDS
FT                   SLWGLHAALGGALSFPAVSLVAGALFVSRLRGFGWWAGLTFLLYLLQVILAAGGMPLLL
FT                   SFHPVNGAFLLAASLVLLANVERRRSQSLAEDNATAKPGK"
FT   gene            complement(187341..187958)
FT                   /locus_tag="SMa0346"
FT   CDS_pept        complement(187341..187958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0346"
FT                   /product="NAD(P)H dehydrogenase"
FT                   /note="Belongs to the NAD(P)H dehydrogenase family;
FT                   Contains a flavodoxin-like fold, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64844"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K9"
FT                   /protein_id="AAK64844.1"
FT                   /translation="MRRNLLLVATQETTVTKTLILLFHPDLKRSKANAALAGAAAKLDG
FT                   VEVADMQAAYPDSMDMFRDGEREARRLLAADRIVLQFPIQWYSTPPLMKAWQDGVLTRM
FT                   FYVTYETEGRALEGTPLMLAATAGNVPESYRPGGRNMFTMEALLAPLRATAHRCGLSCT
FT                   APFIIYQADKLEAEELEAAASNYAATLKNWIAGPLVTRQEAV"
FT   gene            188006..188893
FT                   /locus_tag="SMa0347"
FT   CDS_pept        188006..188893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0347"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64845"
FT                   /db_xref="GOA:Q930K8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K8"
FT                   /protein_id="AAK64845.1"
FT                   /translation="MNLRSLDLNLLVVLDALLDEAHVSRAADRLGLSQPAASAALQRCR
FT                   HLFRDELLERGRGTMRLTSRAEALRAPLKSLLASMMELIGPPEIPLTEIRQVLRITMAD
FT                   YPALFVIAQLQRELQPSAPGIDLVIQSWHGGDAARSALVDGTADLAVSVFTAPDDDLHR
FT                   EELLTEHYVVVMRAGHPAAEAFDLNAWLSYPHILVSGRGDTTTPLDAELSRFGLSRRVG
FT                   LVVPNFQMVPSLLQDSDMIAMLPSRATPSGGSLVSFLPPIPVPGFQLHMAWHRRRAKDA
FT                   ALQHVARILGALLR"
FT   gene            complement(189202..189798)
FT                   /locus_tag="SMa0349"
FT   CDS_pept        complement(189202..189798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted to bind dinucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64846"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4HUJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K7"
FT                   /protein_id="AAK64846.1"
FT                   /translation="MTTYAIIGAGAIGSALAERFTAAQIPAIIANSRGPASLSSVTDRF
FT                   GASVKAVELKDALQADVVILAVPYDSIADIVTQVSDWGGQIVVDASNAIDFPAFKPRDL
FT                   GGRLSTEIVSELVPGAKVVKAFNTLPAAVLAADPDKGTGSRVLFLSGNHSDANRQVAEL
FT                   ISSLGFAPVDLGTLAASGPIQQFGRPLVALNLLKD"
FT   gene            complement(189834..190730)
FT                   /locus_tag="SMa0352"
FT   CDS_pept        complement(189834..190730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains pirin-like N-terminal and C-terminal
FT                   domains, This family consists of Pirin proteins from both
FT                   eukaryotes and prokaryotes; The function of Pirin is
FT                   unknown but the gene coding for this protein is known to be
FT                   expressed in all tissues in the human body although it is
FT                   expressed most strongly in the liver and heart; Pirin is
FT                   known to be a nuclear protein, exclusively localised within
FT                   the nucleoplasma and predominantly concentrated within
FT                   dot-like subnuclear structures; A tomato homologue of human
FT                   Pirin has been found to be induced during programmed cell
FT                   death; Human Pirin interacts with Bcl-3 and NFI and hence
FT                   is probably involved in the regulation of DNA transcription
FT                   and replication; It appears to be an Fe(II)-containing
FT                   member of the Cupin superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64847"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K6"
FT                   /protein_id="AAK64847.1"
FT                   /translation="MSHISTADIEQVILPSSRDLGGFSVRRALPAPMRQMVGPFIFLDS
FT                   FGPVRFGEGEGIDTRPHPHIGLSTLTYLLEGELTHRDSERYVQAIRPGEVNVMVAGAGI
FT                   VHSERTPEHQRATGGKLAGLQSWIALPKKSEETAPLFQHLDAGSLPTVSGEGIGMKLLA
FT                   GNLHGRQSPATVFSDLFAAEVHLEAGARYRIDGEHVERAIFVVAGALEIVGQDGNFGQD
FT                   RLLVFKPGSEIVVKATGPARFLAFGGEPLPEKRFIRWNFVATDQERIRHAADLWRERGF
FT                   PGVPDDDEFIPLPENFR"
FT   gene            190833..191747
FT                   /locus_tag="SMa0353"
FT   CDS_pept        190833..191747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0353"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Contains LysR-type HTH and substrate-binding domain,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64848"
FT                   /db_xref="GOA:Q930K5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K5"
FT                   /protein_id="AAK64848.1"
FT                   /translation="MSDPGQPTLDQLRVFIAVVETGSFAAAARKLNRATSVISYTIANL
FT                   EAQLGVTLFDRLSTKKPQLTLEGRTVLAEARSVSNGIDNLRAKVKSMLRGIEPEVHLAL
FT                   DVMLPASRVMDALKAFRKEFPSVSLRLYVEALGAVTQIVLNRTATVGISGPLDVDVLGL
FT                   ERIGVGFVQLVPVAAPDHPLAGGSHAPGAARSHIQLVLTDRSPLTQGHEFAVVGTHTWR
FT                   LADLGAKHMLLKEGIGWGNMPEPMVRDDLADGRLVQLDLPDCKGGPYRLQAIYRTDTPP
FT                   GPAGRFLIEHFQAQDAKTPTTAW"
FT   gene            191922..192416
FT                   /locus_tag="SMa0355"
FT   CDS_pept        191922..192416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0355"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Bacterial regulatory helix-turn-helix protein, lysR
FT                   family, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64849"
FT                   /db_xref="GOA:Q930K4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K4"
FT                   /protein_id="AAK64849.2"
FT                   /translation="MKGPGTPTFDQLKVFLTVVDVGSFAGAARKLNRATSVVSYTIANL
FT                   EAQLGFALFDRDSTRRPCLTEAGRIVLSETRSVANGVNRLRAKAQGLLQGLEPSLSIAL
FT                   DAMLPASRVLDALKGFRSEFPTIPLQIRTEQFRALSMLVRQGDIVIRHEYGRRCNGGPL
FT                   A"
FT   gene            complement(193272..193553)
FT                   /locus_tag="SMa0357"
FT   CDS_pept        complement(193272..193553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has partial similarity to acetyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64851"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K2"
FT                   /protein_id="AAK64851.1"
FT                   /translation="MVDARPVGDYPNLRQLAFLHVSHDWRGKKLALRLYQLCKDTVVGS
FT                   GAEGFYISSTPTRRTVEFYLRQGAKLMARPDTTLVSIEPDDIHLAHWF"
FT   gene            complement(193562..193807)
FT                   /locus_tag="SMa0359"
FT   CDS_pept        complement(193562..193807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has partial similarity to acetyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64852"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K1"
FT                   /protein_id="AAK64852.1"
FT                   /translation="MTMGTIIRPLQRAEVELVWQIERREVVQEIYEVADGRLHLRPQFY
FT                   DTREWPDGEPEIYTPILFDCFDHDGVFLGALLEKNL"
FT   gene            complement(193804..194493)
FT                   /locus_tag="SMa0360"
FT   CDS_pept        complement(193804..194493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0360"
FT                   /product="putative transposase"
FT                   /note="Transposon-related functions, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64853"
FT                   /db_xref="GOA:Q930K0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q930K0"
FT                   /protein_id="AAK64853.2"
FT                   /translation="MSDPFPDEVDEALWDEACRRAEAVREFLKHRPGKMTAADVALLAT
FT                   EVETSRATAYRLIKLFRAGGTVMSLVDRKRGRPEGHRVLDDKREEIIRTTINRHYLTRN
FT                   RPTVSQLVRDVQTNCISAGLKRPHRRTIKARLEEIEPQRRAKRRGETEIVKQTQAVPGV
FT                   FAASRPLQVVQVDHTKADIFVVDEETRQPIGRPWLTLAMDVCSRMVTGFYLTMDAPSRL
FT                   STRGVAP"
FT   gene            195082..196866
FT                   /locus_tag="SMa0364"
FT   CDS_pept        195082..196866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0364"
FT                   /product="hypothetical protein"
FT                   /note="Contains weak similarity in amino terminus to a
FT                   small domain pfam02563, found in polysaccharide
FT                   biosynthesis/export proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64854"
FT                   /db_xref="GOA:Q930J9"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:Q930J9"
FT                   /protein_id="AAK64854.1"
FT                   /translation="MDHATKSEATRGSSALPYSDGRSTAAPFHRVRHGLFTAAFSIIPF
FT                   SFIVLFAASAGGQSAAVNGLAPQDAVEIHLPGWHTLFGDAAKAALPNGTFTIGSAGALE
FT                   LPGIGRVPAAGLHASELAKLIADRLQARSGSHDSPVTIVEPRRPALEGQRVSPPAKQPA
FT                   MVEREAMQALGGERSSVEALLRDLAAARKEAEAAREEERAAHQAARDASILHRRHLAAE
FT                   RQRAAKLTQELTAARVDLETMKTQLKQETNAAHDWKAAVAMIKAAREAAARERSERAAL
FT                   EEELRAARREIEAARNGAQMVASEREEPLRHDMVPATGALDTMGVAADGAGAQARKAAD
FT                   TMAERESALEQQRQRAEGLARDLTVLRRDMDSLQAKVAGAIRSKAAALRARRAGEAALV
FT                   DAKRALVEERQKIGVYARDLALALQSAAALESRAKLAAAEQAAAAQARKIAEAAAKRAG
FT                   EALALELEAGKSLARELDTARRERDAAKEELTQVLAQHTSLKGERAWANGRELSAARQQ
FT                   HDGKKARTERRVEDVDEPKTRAGNHASERAKTARATGTRSVRELGARKGRTLETRKPLK
FT                   IALPNALLPKRWLAPGLW"
FT   gene            196912..197808
FT                   /locus_tag="SMa0367"
FT   CDS_pept        196912..197808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to mll2007 from Mesorhizobium loti
FT                   MAFF303099; This predicted protein is fairly glycine- rich"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64855"
FT                   /db_xref="UniProtKB/TrEMBL:Q930J8"
FT                   /protein_id="AAK64855.1"
FT                   /translation="MVMRKYLTVALLITVAIGPASALDIGVGVSVGGTGVSAGVRTGKN
FT                   GTSAGVSTSVGGIGGAKAGTAAGKSGGSSIGASGNLGGIGVGAGVGVGKNGTSAGIGAG
FT                   IGGAKAGASVGTSGGSSIRASGNVGRASGGVSTGSVPGAGLSGTGPGNAPSGLAARSGS
FT                   PATGTASRILGAAPEKGVRPSIALPRILWPLKSRRRHERGEWSYPLRFPAPIAAITGTP
FT                   RAVVRVCRQAIAQAASALGGVRVRAVSAGPLHRGRRGTLTAPLDVRIDYAGQGGREVRQ
FT                   ARIRCRLDTSGRVIAVI"
FT   gene            197906..198172
FT                   /locus_tag="SMa0369"
FT   CDS_pept        197906..198172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0369"
FT                   /product="hypothetical protein"
FT                   /note="very weak match to a partial EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64856"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q930J7"
FT                   /protein_id="AAK64856.1"
FT                   /translation="MYPEMPRAISRSTMDVETDDKSQTIVRGILALAHGLGMRVTAEGV
FT                   ETADQANWLRNQGCDRLQGNLFSAPIPAGSMEKFLRQSSMASQ"
FT   gene            complement(199105..200004)
FT                   /locus_tag="SMa0372"
FT   CDS_pept        complement(199105..200004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0372"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Contains LysR-type HTH and substrate-binding
FT                   domains, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64858"
FT                   /db_xref="GOA:Q930J5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930J5"
FT                   /protein_id="AAK64858.1"
FT                   /translation="MNDYKALRTFLLAAEKRNFAQVARELDMTPAAVTRAIAALEAELG
FT                   VQLFVRTTRQVSLTTDGAIFAAQLQPAVKTIEDARREVMNAHKADEGRLRISAPTWFGK
FT                   AVLPPILSAFKERYPKMSFEISLSDGLVNIVDDDYDLAIRISSQPSDKFTIWRKIRVVP
FT                   RILVAAPGSRFVDMQHPNELTPDDCLAYSGDSRRENWVLSDGGSSITISAGRAFSANNG
FT                   EVLADIAADGAGVAMLPGFHIFEHLRTGRLVHVFKGWAPPDLWLTLYYPPYQALPPRIA
FT                   SFSKFFEEQVPAHMVMLD"
FT   gene            200116..201048
FT                   /locus_tag="SMa0374"
FT   CDS_pept        200116..201048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0374"
FT                   /product="dioxygenase/lyase"
FT                   /note="Weak similarity to pfam00903, Glyoxalase,
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64859"
FT                   /db_xref="GOA:Q930J4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q930J4"
FT                   /protein_id="AAK64859.1"
FT                   /translation="MIKDIKGLHHVTSMASDARQNNRFFTDTLGLRRVKQTVNFDDPSV
FT                   YHLYYGDETGSAGTVMTYFPFPNMMLGRPGVGEVGETQFSVPKGSLKFWQDRFTTQGVD
FT                   GLERDTVFGADRLRFMGPDGDSFALIESADDKRAPWLADGIPDDAAIRGFAGARFSLHD
FT                   SAATEELLGFMGYERAEKEGDVVRFIISNGNGADTIDLLALPKTPFARQGAGSVHHIAF
FT                   AVDNREKQLEVRKALMDTGYQVTPVIDRDYFWAIYFRTPGGILFEVATNEPGFNRDEDT
FT                   AHLGEALKLPVRYEEYRGQIQANLVPLAA"
FT   gene            201366..202055
FT                   /locus_tag="SMa0376"
FT   CDS_pept        201366..202055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0376"
FT                   /product="hydrolase"
FT                   /note="Similar to YcaC related amidohydrolases; E.coli YcaC
FT                   is an homooctameric hydrolase with unknown specificity;
FT                   Despite its weak sequence similarity, it is structurally
FT                   related to other amidohydrolases and shares conserved
FT                   active site residues with them; Multimerisation interface
FT                   seems not to be conserved in all members, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64860"
FT                   /db_xref="GOA:Q930J3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q930J3"
FT                   /protein_id="AAK64860.1"
FT                   /translation="MSKLEVLTPANSQLIFIDQQPQMAFGVQSIDRQTLKNNVVGLAKA
FT                   AKIFNVPTTITTVETQSFSGNTFPELLAVFPENDLLERTSMNSWDDQNVRDALAKNAAN
FT                   GRKKIVVSGLWTEVCNTTFALSALHDVPEYEIYMVADASGGTSSDAHKYAMDRMVQAGV
FT                   IPVTWQQVLLEWQRDWARKETYDAVTTLVKEHSGAYGMGIDYAYTMVHGAEERVKHGKR
FT                   IGPNPAK"
FT   gene            202120..202407
FT                   /locus_tag="SMa5018"
FT   CDS_pept        202120..202407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5018"
FT                   /product="Conserved hypothetical protein"
FT                   /note="pfam07235, DUF1427, Protein of unknown function
FT                   (DUF1427); This family consists of several bacterial
FT                   proteins of around 100 residues in length; The function of
FT                   this family is unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5018"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07964"
FT                   /db_xref="GOA:B3KLW6"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW6"
FT                   /protein_id="ACF07964.1"
FT                   /translation="MKVYLLSLGAGLLVGIVYSLLNVRSPAPPVIALVGLLGILVGEQI
FT                   IPFAKTLWRSEPAAISWLHQIKPHMFGHLPKGSDRIEIAHQAKARVEERS"
FT   gene            202407..204389
FT                   /locus_tag="SMa0380"
FT   CDS_pept        202407..204389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0380"
FT                   /product="hydrolase"
FT                   /note="Metal-dependent hydrolase with TIM-barrel fold;
FT                   Similar to YtcJ_like metal dependent amidohydrolases; YtcJ
FT                   is a Bacillus subtilis ORF of unknown function; The
FT                   Arabidopsis homolog LAF3 has been identified as a factor
FT                   required for photochrome A signalling; Very similar to S;
FT                   meliloti SMa1819, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64861"
FT                   /db_xref="GOA:Q930J2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q930J2"
FT                   /protein_id="AAK64861.1"
FT                   /translation="MATRRSFLGGASSLAFANFFSPAKAADPNQTGVDTMHPDLILHNG
FT                   RVTTLDRTNPNATAIAIKDGLFLEVGSDSEVMALAGSGTKIVDLKGKGVLPGLIDNHTH
FT                   VVRGGLNYNMELRWDGVRSLADAMDMLKRQVAITPAPQWVRVVGGFTEHQFAEKRLPTI
FT                   EEINAVAPDTPVFLLHLYDRALLNGAALRAVGYTRDTPNPPGGEITRDANGNPTGLLLA
FT                   KPNAGILYSTLAKGPKLPLDYQVNSTRHFMRELNRLGVTGVIDAGGGFQNYPDDYEVIQ
FT                   KLSDENQMTVRLAYNLFTQKPKEEKQDFLNWTQSVKYKQGNDYFRHNGAGEMLVFSAAD
FT                   FEDFRQPRPEMAPEMEGELEEVLRVLAENRWPWRLHATYDETISRALDVFEKVNKDIPL
FT                   EGLNWFFDHAETISDRSIDRIAALGGGIATQHRMAYQGEYFAERYGHGVAEATPPIRRM
FT                   LDKGVNVSAGTDATRVASYNPWVSLSWMVTGKTVGGMQLYPRANCLDRETALRMWTEKV
FT                   TWFSNEEGKKGRIEKGQFADLVVPDKDFFSCAEDEISFIVSELTMVGGKIVYGAGDFKT
FT                   LDENEIPPAMPDWSPVRKFGGYAAWGEPERAGARSLRRTAISTCGCASDCGVHGHDHAG
FT                   AWTSKLPIADLKGFFGALGCSCWAV"
FT   gene            204550..204993
FT                   /locus_tag="SMa5019"
FT   CDS_pept        204550..204993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted membrane protein; Similar to S; meliloti
FT                   SMa1817"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5019"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07965"
FT                   /db_xref="GOA:B3KLW7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW7"
FT                   /protein_id="ACF07965.1"
FT                   /translation="MTYHSQLSNPIRSGVARVVGSPVVRTVSLLALCAAYIQGPLTKIF
FT                   DFNGALAEMDHFGLHPAPFFAVAVIVFELTASAMVISGLLRWAGALALAGFTLLATFIA
FT                   LRFWEMAPGMDRMMATNAFFEHLGLAGAFVFVAAFDLTKGAGK"
FT   gene            204990..206588
FT                   /locus_tag="SMa0383"
FT   CDS_pept        204990..206588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="Bacterial protein of unknown function (DUF894),
FT                   transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64862"
FT                   /db_xref="GOA:Q930J1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q930J1"
FT                   /protein_id="AAK64862.1"
FT                   /translation="MSAAKSSGGTFAPLAQPVFAVLWTATVLGNTGSFMRDVASAWLMT
FT                   DLSASPAAVAMVQAAGTLPIFLLAIPAGVLTDILDRRKFLIAVQLLLASVSISLMVLSQ
FT                   TGMLSVSSLIGLTFLGGIGAALMGPTWQAIVPELVKREDVKSAVALNSLGINIARSIGP
FT                   AAGGLLLAAFGAGITYGADVASYIVVIAALVWWPRAKNANDALQENFFGAFRAGLRYTR
FT                   SSTPLHVVLLRAAIFFAFASAVWALLPLVARQLLGGDAGFYGILLGAVGAGAIGGALVM
FT                   PKLRERLSSDGLLLGAALITAAVMGVLALAPPKVVAIIVLLFLGGAWITALTTLNGTAQ
FT                   SVLPNWVRGRGLAVYLTVFNGAMTAGSLGWGAVGEAVGIQSTLIIGAIGLLIAGLIMHR
FT                   VKLPAGDADLVPSNHWPEPLVAEPIAHDRGPVLILIEYKVEKQHRTAFLHAIDHLSRER
FT                   RRDGAYGWGVTEDSADPEKIVEWFMVESWAEHLRQHKRVSNADADLQGKVLAYHVGPDK
FT                   PVVRHFMTINRPGAA"
FT   repeat_region   complement(207549..208846)
FT                   /rpt_family="ISRm3"
FT                   /note="SMa3002; predicted by homology"
FT   gene            complement(207586..208788)
FT                   /locus_tag="SMa0384"
FT   CDS_pept        complement(207586..208788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0384"
FT                   /product="TRm3 transposase"
FT                   /note="Elements of external origin; Transposon-related
FT                   functions, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64863"
FT                   /db_xref="GOA:P80011"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80011"
FT                   /protein_id="AAK64863.1"
FT                   /translation="MAIEKELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELDD
FT                   HLDVERLEGGPANRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDFDD
FT                   KIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYPLVF
FT                   FDAIRVKIRDEGFVRNKAVYVALAVLADGSKEILGLWIEQTEGAKFWLRVMNELKNRGC
FT                   QDILIAVVDGLKGFPEAITAVFPQTIVQTCIVHLIRHSLEFVSYKDRRTVVPALRAIYR
FT                   ARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEA
FT                   LNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIFGERFF
FT                   N"
FT   gene            complement(209020..210132)
FT                   /gene="hisC3"
FT                   /locus_tag="SMa0387"
FT   CDS_pept        complement(209020..210132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC3"
FT                   /locus_tag="SMa0387"
FT                   /product="HisC3 histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="Also known as imidazole acetol-phosphate
FT                   transaminase 1Similar to HisC, Histidinol-
FT                   phosphate/aromatic aminotransferase and cobyric acid
FT                   decarboxylase, pfam00155, Aminotransferase class I and II,
FT                   specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64864"
FT                   /db_xref="GOA:Q930J0"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q930J0"
FT                   /protein_id="AAK64864.1"
FT                   /translation="MAIPSRPIREEIRSIAPYNAGLTLEEVRAKYHVDEVAKLSSNENP
FT                   LGPSPALRRLFPDIGELARLYPDPQGRALCARLAASFDVENNQVILGNGSEDLIAVICR
FT                   SVVRAGDTVVTLYPSFPLHEDYTTLMGGKVDRVTVTPDLSVDMDALLAAIARKPRMLMF
FT                   SNPMNPVGSWLTPLQLAKVVAALDPETLIVVDEAYAEYAAGDDYPSAAEVLKVTGLNWV
FT                   VLRTFSKAYGLAGLRIGYGIVSDGSLCDFFNRARTPFNTNAIAQVSALAAFDDTYHLNR
FT                   SVELALVERERMKKELATMGYRIAPSKCNFLFFDARTEATPVAEALLRRGVIVKPWKQP
FT                   RFETYIRVSIGSPVENDHFIHALKEVEAVG"
FT   gene            210263..211030
FT                   /locus_tag="SMa0389"
FT   CDS_pept        210263..211030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0389"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Belongs to the short-chain dehydrogenases/reductases
FT                   (SDR) family, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64865"
FT                   /db_xref="GOA:Q930I9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4J2H"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I9"
FT                   /protein_id="AAK64865.2"
FT                   /translation="MTSPIFDLSGRRALVTGASRGIGQSIAVALAEAGAHVAVTARTVE
FT                   GLAETRALIEKTGRRAVALAQDVRDVEACASVTRAAAEGLGGLDILVNNAGFENVRPSF
FT                   DVDEALWDTIVSTNLKGAFFCAQAAGRIMADANGGAIVNLCSLTSYVGIPTAVPYGASK
FT                   SGLLGVTRALATEWAAHNIRVNAIAPGYFRTAMTAGFYEDEDWQSRMLEKIPQRRFGKE
FT                   SDIGGVAVFLCSDAAAYITGHCIPADGGYLASI"
FT   gene            211336..212469
FT                   /locus_tag="SMa0391"
FT   CDS_pept        211336..212469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0391"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64866"
FT                   /db_xref="GOA:Q930I8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I8"
FT                   /protein_id="AAK64866.1"
FT                   /translation="MGAVAAGLRPTGSVNPGAVSVKDVGMAFGDVHAVRNASFDLPKGR
FT                   FLTILGPSGSGKTTLLRMIAGFDRPTHGEIFINGRPVSAVPPHKRAIGMVFQKLALFPH
FT                   MTAAENVAFPLKMRRHDARTIPEKVERYLDLVRLGGYGDRRINELSGGQQQRVAIARAL
FT                   VFEPDLLLLDEPLAALDRKLREEMQLEFRRIQKELGVTTINVTHDQREALVVSDEIIIM
FT                   NGGAIQQKARPVDAYRAPSNAFVANFIGVTNFLEGRIVELTSTQAVFETNGVRLVGIAA
FT                   DAALAPGLSCSGALRAEQIRIAPMGGRLDELETLVDGQVVDCIFEGDRVVYEIRVPDLA
FT                   GVLMRVFDHDPESHLQFGPGDEVRLGWNARDMHVFQK"
FT   gene            212503..213618
FT                   /locus_tag="SMa0392"
FT   CDS_pept        212503..213618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0392"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Most similar to PotD, Spermidine/putrescine-binding
FT                   periplasmic protein, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64867"
FT                   /db_xref="GOA:Q930I7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I7"
FT                   /protein_id="AAK64867.1"
FT                   /translation="MSHEKFLSAQIGRRTLLASMAAAGASAGLSTLGVSRAFAQEPEKP
FT                   AEIIVRAWGGSWVDALKAGVSDSFTKMTGIAVRHDLTEDNEIQPKVWAAVAQKRVPPIH
FT                   INWDTTTNATKSALRGVTEDLSDLPNLKNATDLAKPVGLDGYPIVNTYGYVYVLAYRPS
FT                   AFPNGAPKSWKDLLDPKLKGRIALYNDGIGFHFPAQVAGGGKLEDIPANMQPAWDFISK
FT                   IKEQQPLLGEDPDFTTWFQKGEIDAACTISTNAREAKKNGIEIAWVVPEEGAKFDTDGL
FT                   WIPKGLPENELYWAKQYINHALTKEAQQIWLDGLGLPGVIPGITPPADLVGDPSYPTTE
FT                   EDFKQLIRISAKVQVENESQWFAKFKEIMQG"
FT   gene            213683..214627
FT                   /locus_tag="SMa0394"
FT   CDS_pept        213683..214627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0394"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to PotB, ABC-type spermidine/putrescine
FT                   transport system, permease component I, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64868"
FT                   /db_xref="GOA:Q930I6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I6"
FT                   /protein_id="AAK64868.1"
FT                   /translation="MRAPRAAYPLTWRVMDVLERLAAIVWPSSFQRGLPYLMLMPALVL
FT                   VGLLVLGLVQIGDTSLRTLDTNTFLMSESYTLANYQRVLTESFFATVAGRSLVGSVIVT
FT                   VITLLLAFPYAYLMVRTPSSALRKFLLVALFLPFFIGQVVRAYGWLIILGNQGMVNEAL
FT                   GLVGVPPIRLLYNYPAVLFGLVQYMLPFAVLMLAPALTAIPSELEAAAASLGAGWTRTF
FT                   RHIVLPLSRPGLVGAGLVVLTLSLTDFAIPAILGGGTQDFIANAIYDQFFRTSDQGMGA
FT                   TLSLMLVAVGSMLVGVVFMLFGAGTLAMTGDRK"
FT   gene            214624..215424
FT                   /locus_tag="SMa0396"
FT   CDS_pept        214624..215424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0396"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to PotC, ABC-type spermidine/putrescine
FT                   transport system, permease component II, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64869"
FT                   /db_xref="GOA:Q930I5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I5"
FT                   /protein_id="AAK64869.1"
FT                   /translation="MTGSKSKSFVLWAFVTTALLMLSAPTVVVLGASFTAGNIITFPPD
FT                   GLSLKWYGAIAQASDLRQAFVRSLIVATICTLVSIPVGTLAGIALAKYRVRFARSIQIY
FT                   LLLPFTIPLIGSGIGMMLVLGNMGVLGKLWPVGIACAVINLPFMIWAVTASASNLSPDL
FT                   ELAAANCGAPPLQRFLYITLPAVLPGVITGSLLMFILALNEFLVSLLLVDARSVTLPVQ
FT                   IYNSIRSIITPDLAAISVVFIACAGLAIALLDRLVGLDIFLKSK"
FT   gene            215421..216791
FT                   /gene="hisD2"
FT                   /locus_tag="SMa0398"
FT   CDS_pept        215421..216791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD2"
FT                   /locus_tag="SMa0398"
FT                   /product="HisD2 histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="FUNCTION: Catalyzes the sequential NAD-dependent
FT                   oxidations of L- histidinol to L-histidinaldehyde and then
FT                   to L-histidine (By similarity), CATALYTIC ACTIVITY: L-
FT                   histidinol phosphate + 2-oxoglutarate = 3- (imidazol-4-yl)-
FT                   2-oxopropyl phosphate + L-glutamate, CATALYTIC ACTIVITY:
FT                   L-histidinol + 2 NAD(+) = L-histidine + 2 NADH, COFACTOR:
FT                   Pyridoxal phosphate (By similarity); Binds 1 zinc ion per
FT                   subunit (By similarity), PATHWAY: Histidine biosynthesis;
FT                   seventh step, PATHWAY: Histidine biosynthesis; ninth (last)
FT                   step, SUBUNIT: Homodimer (By similarity), SIMILARITY: In
FT                   the N-terminal section; belongs to the histidinol
FT                   dehydrogenase family, SIMILARITY: In the C- terminal
FT                   section; belongs to the class-II pyridoxal-
FT                   phosphate-dependent aminotransferase family; Histidinol-
FT                   phosphate aminotransferase subfamily, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64870"
FT                   /db_xref="GOA:Q930I4"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q930I4"
FT                   /protein_id="AAK64870.1"
FT                   /translation="MTLRPQLARYKDKTMTSVSFYEYSKLNAEEKAALLRRSETDISGF
FT                   IEKVAPILEAVRTEGDKALARFGRELDKADVTEANLKVTAAEFDAAFKLVDASVLESVQ
FT                   FGIDNIRKFHEEQKPEAMWLKEIRPGAFAGDRFTPIQSVALYVPRGKGSFPSVTMMTSV
FT                   PAVVAGVPNLAIVTPPAPDGSVDAATLVAARLAGVETVYKAGGAQAVAAVAYGTETVKP
FT                   ALKIVGPGSPWVVAAKRSLSGVIDTGLPAGPSEVMILADDTVHGGLAALDLLIEAEHGP
FT                   DSSAYLVTHSGRVAEEALAALPEHWARMTEQRTAFSKTVLSGKTGGIVLTSSIEESYEF
FT                   VNAYAPEHLELLSEQPFIHLGHITEASEILMGTHTPVSIANFSLGPNAVLPTSRWARTF
FT                   GPLSVTDFVKRSSIGYVTAPAYPEFARHSHNLAIYEGFSSHALAVSPVRDAYLKKGA"
FT   gene            216795..217808
FT                   /locus_tag="SMa0400"
FT   CDS_pept        216795..217808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0400"
FT                   /product="Dehydrogenase, Zn-dependent"
FT                   /note="COG1063: Threonine dehydrogenase and related Zn-
FT                   dependent dehydrogenases, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64871"
FT                   /db_xref="GOA:Q930I3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I3"
FT                   /protein_id="AAK64871.1"
FT                   /translation="MKAVRLYDIRDLRVEEVAELAAPPPGFVNLEVRAAGICGSDLHNY
FT                   RTGQWISRRPSTAGHEFCGRVTAIGEGVSHLVRGDVVSADSRMWCGTCPACASGRSNVC
FT                   ETLGFLGEVCDGGFAEAVQLPSRLVFRHDPKLSPHVAAMAEPLAVALHAVRRLAVPDGA
FT                   PVLVMGCGTIGGLSALLLSRLHQGPLLLTDLNADKAALVAEVTGGVVVALDGAAIEEAL
FT                   PGTRLRHALDATGSIQAIARALDILSGGGALALVGIGHGKLDLDPNILVEREISLVGCH
FT                   AFAGELPEAIELLADLAPALQRFIEVLPTLDDVPEAYERLLRGESNALKTIIEVAG"
FT   gene            217871..218602
FT                   /locus_tag="SMa0402"
FT   CDS_pept        217871..218602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0402"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /note="Bacterial regulatory proteins, gntR family; This
FT                   domain comprises the N-terminal HTH-containing region of
FT                   GntR-like bacterial transcription factors; At the C
FT                   terminus there is usually an effector-
FT                   binding/oligomerisation domain; The GntR-like proteins can
FT                   be divided into six sub-families: MocR, YtrR, FadR, AraR,
FT                   HutC and PlmA, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64872"
FT                   /db_xref="GOA:Q930I2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I2"
FT                   /protein_id="AAK64872.1"
FT                   /translation="MNTLSDSASPLYEKVKDFVLGNIGSGKWARNSRLPSENELVSALG
FT                   VSRMTVHRALRELTSEGHLRRIQGVGTFVAPPRPRSTLIEISNIITEIKTRGSRHRAEV
FT                   VVLERIARPEPELLLAFEFETVKPVDHSVVIHFENDLPVQLEERYVNPNLVSGYIDQDF
FT                   AAVATYDYLQNATPLTEVEHLISALPANAEQARLLNVRPGDCCLILHRKTWTGPVVATV
FT                   NTFTYVGSRYSLGSRYLHGGK"
FT   gene            218550..219938
FT                   /locus_tag="SMa0403"
FT   CDS_pept        218550..219938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0403"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein RSP_2154 of
FT                   Rhodobacter sphaeroides 2.4.1, conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64873"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I1"
FT                   /protein_id="AAK64873.1"
FT                   /translation="MSAAATRSAAAICTAASDRRSYALKDPSGKNAMSQPTSRTAEIRK
FT                   VAKTGDGKAEQLLAELLRDLFRIEARNVAINHDQYSLNSLNGFFETEDGAFFFKFHQEE
FT                   GEEAMSGEYYRADILARAGLPVDQPLLMSVIPGEQILVYRRRTDPRFSDVLRALDLKDD
FT                   AAARGRAVEAERRLSEAVLKVYLATLHTVGAREVAAEPIHRLFYERLVDRSAASYPGGR
FT                   MASFYVGKDFAFPNLTLDWETLSRCRFVVNGIEYSDSIGALFDAAHERLNPARLADAGG
FT                   VVAHGDAHNANVWYEERDGGAHLSFFDPAFAGENIPALLAEVKTTFHNILAHPLWLYDP
FT                   AMAAGRYKASAVLDGALLRVTTDFAPSPVRRALLDVKAEALWRPLLSELKARGMLPADW
FT                   RRVIRLGLFLCPTLVMNLRAGATTHNAISSLIGFSVAVMAGSEPVAGDDLISRFIDTID
FT                   PDNG"
FT   gene            219940..221085
FT                   /locus_tag="SMa0404"
FT   CDS_pept        219940..221085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0404"
FT                   /product="FMN-dependent dehydrogenase"
FT                   /note="Has a glycolate oxidase-like (GOX-like) FMN-binding
FT                   domain; This protein familly includes a widespread family
FT                   of homologous FMN-dependent a-hydroxyacid oxidizing
FT                   enzymes; This family occurs in both prokaryotes and
FT                   eukaryotes, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64874"
FT                   /db_xref="GOA:Q930I0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q930I0"
FT                   /protein_id="AAK64874.1"
FT                   /translation="MALVNIDDFRDLARRRRPKIFFDYIDGGSFEEETMRANRSDFSRL
FT                   TLRQNVLVEPQPQDLATAYLGKRHPLPFMLGPVGFLGLYSGKGEVKAVRAAHAAGIPFC
FT                   LSTFSIASLADLRIVTDGPLHFQLYVLEDRSLCEEFLRAAEYAGVDTLFVTVDTAITGI
FT                   RERDVRNGFRSLTRVTPDLFARLALKPRWLAEVVLAGMPSVRAVEHRPEFGRGALEQAA
FT                   NLSRRIDKTLSWKDIAWLRERWAGKLVIKGVLTPADAVRARDLGCDGVVVSNHGGRQLD
FT                   GAPSTIRALPSIRATVGTDFCLMLDGGIRRGADVIKAIALGADGVMLGRAYAYGLSAAG
FT                   QAGVAEVIAILEREISISLALMGIASVEQLKALGAEAVSTL"
FT   gene            221438..221725
FT                   /locus_tag="SMa0405"
FT   CDS_pept        221438..221725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0405"
FT                   /product="transposase, fragment"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64875"
FT                   /db_xref="GOA:Q930H9"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H9"
FT                   /protein_id="AAK64875.2"
FT                   /translation="MTPKKCQSSESDHSGRISKIGDGSVRTALYEAANVILTRPVKGSD
FT                   LKGWALAVARRAGPRKARVALARKLAVVLHCMLRDRTNFIAHKGAPALAA"
FT   gene            222078..222866
FT                   /locus_tag="SMa0407"
FT   CDS_pept        222078..222866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="pfam07040, DUF1326, Protein of unknown function
FT                   (DUF1326); This family consists of several hypothetical
FT                   bacterial proteins which are found in Rhizobium,
FT                   Burkholderia, Ralstonia, Aurantimonas and Polaromonas
FT                   species; Members of this family are typically around 210
FT                   residues in length and contain 5 highly conserved cysteine
FT                   residues at their N-terminus; The function of this family
FT                   is unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64876"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="InterPro:IPR014581"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H8"
FT                   /protein_id="AAK64876.1"
FT                   /translation="MELRVGGAKPSDNSPAASKGFSDPLDSHGVPGRSKQYLIHSAFTG
FT                   TIGGVAMAYVDWAIKGPKIASCSCDYGCPCEFNGKPTEGLCEGLECMLIEEGWFGDLRL
FT                   DGLKVAAVYRWPGPVHEGGGVVRGFFDANADQAQIDALFTILGGKEQEPTTVFNIYGST
FT                   IAQELEPIFAPIEFHSDIEKRTGGFRIDGHLELELEPIRNPVTGAPHRARIVLPEGFEF
FT                   RQAEIASGTFNANGEIAMGRQKRYGALWRAAYGPYGIIEE"
FT   gene            complement(223861..224175)
FT                   /locus_tag="SMa0412"
FT   CDS_pept        complement(223861..224175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to a group of proteins similar to the Ethyl
FT                   tert-butyl ether degradation protein EthD from Rhodococcus
FT                   ruber"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64878"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H6"
FT                   /protein_id="AAK64878.2"
FT                   /translation="MIKMSVYYPADGGSKFDHDYYRTRHMPLIQERLGDACLRYEIDKG
FT                   LAGREPGSAPEFVAACHVYSPSLATFQEALGPHRSEIAADVANYTDIAPIVQISEVVEG
FT                   "
FT   gene            224805..226475
FT                   /locus_tag="SMa0414"
FT   CDS_pept        224805..226475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has an ATP dependent DNA ligase domain; Together
FT                   with adjacent ORF, SMa0417, might be part of a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64879"
FT                   /db_xref="GOA:Q930H5"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H5"
FT                   /protein_id="AAK64879.1"
FT                   /translation="MADNLSKDRAKRDFKKTREPSGEAQVKPSNRRRFVIQKHDATRLH
FT                   YDLRLELDGVFKSWAVTKGPSLDPSDKRLAVEVEDHPLDYGDFEGTVPKGQYGGGTVML
FT                   WDRGYWEPEGRKSPEEALKKGDFKFTLHGKRLHGSFVLVRMRNDRDGGKRTNWLLIKHR
FT                   DDYSVDENGAAILEENATSVASGRSMEQIAEGTGRKPRPFMMANADVEADAVWDSKHGL
FT                   AAEERKKGSRRDVATSTAADLPDFIEPQLCETLARPPASDDWLHEIKFDGYRIQMRIAD
FT                   GKVTLKTRKGLDWTAKYPEIADAASELPDCIIDGEICALDDNGAPDFAALQAALSEGKT
FT                   GNLVYFAFDLLFDGGEDLRSMRLVERKKRLEDFLAAGSDDPRIRYVDHFESGGDAVLRS
FT                   ACKLSLEGIVSKQMDAPYQSGRTDTWAKSKCRAGHEVVIGGYATTNGKFRSLLVGVHRG
FT                   DHFVYVGRVGTGFGAAKVERFFPKLKALEASKSPFTGIGAPKKEKEVTWLPDGRALPAC
FT                   RVRSSTDVVRFRRSGRSPRALRSDRSEGRASCPRRLSPV"
FT   gene            226536..227393
FT                   /locus_tag="SMa0417"
FT   CDS_pept        226536..227393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains partial domains similar to those found in
FT                   eukaryotic-type DNA primases and ligases; Together with
FT                   adjacent ORF, SMa0414,may comprise a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64880"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H4"
FT                   /protein_id="AAK64880.1"
FT                   /translation="MKPELVAEIEFAGWTADGLVRQAAFKGLREDKPAKEVQAEKPSPP
FT                   AKTDTPEPGPSAKTRPVRRKGAKAEVMGVLISSPDKPLWPDAGDGEPVTKEDLARYHEA
FT                   VGTLFDLDPGPDVPFATVVAAAREMRDRLDELGLVSFCKTTGGKGLHVVTPFAVNKRKP
FT                   LSWAEAKGFAHDVCEQMARDNPDLYLIKMSKSLRGGRIFLDYLRNDRMATAVAPLSPRA
FT                   RPGATVSMPLNWTQVKSDLYPKRFTVRTVPALLAKTTAWQDYCDGERPLEQAIKRLGKS
FT                   RRAA"
FT   gene            227425..228318
FT                   /locus_tag="SMa5020"
FT   CDS_pept        227425..228318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5020"
FT                   /product="conserved hypothetical protein"
FT                   /note="Very similar to S; meliloti SMb21696"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5020"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07966"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW8"
FT                   /protein_id="ACF07966.1"
FT                   /translation="MDEETKDQSSTSTRVGATTDLPHDRITLARFREAFPRARWSDRLN
FT                   AWFVPGRTAEKRISRWLAEMEAEADRFADEKGRDAFAFDPIESRYLEATPATLQIQTPY
FT                   SRTVVNEIREIPPARWDADRRLWTVPYRSFDELRRRWPTIEAAAERSEPEARRARREAI
FT                   KGTQQDEASKARMRERRRKRYPVPADDAPPSDRAIGTHVGVVFFLGTDGELADPATVTA
FT                   FYFPAANSEEYVWASWRLGSLEELVTTWPARTPPNKHELERGWWIPDLGELRIARRDAQ
FT                   SRRRARERKEKGECSR"
FT   gene            228306..228824
FT                   /locus_tag="SMa0421"
FT   CDS_pept        228306..228824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to S; meliloti SMb21697"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64881"
FT                   /db_xref="InterPro:IPR025568"
FT                   /db_xref="InterPro:IPR025951"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H3"
FT                   /protein_id="AAK64881.1"
FT                   /translation="MLPVKDQQTALEEFRSLPPIAPRELVGLWKGHGIPTGHPFDGVLE
FT                   NLSWFGKRFTPDMRVDALLFRSGDRRLVAIDPKWIPLRLALRFHEVGRMRVARNLFSYL
FT                   QRGLRAKGPVASSKTMVFGGVESAAMVYDHQPIVDHFRRIHADRIMGAMTIRNDERIYF
FT                   FELQRVDGP"
FT   gene            228821..229255
FT                   /locus_tag="SMa5021"
FT   CDS_pept        228821..229255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5021"
FT                   /product="hypothetical protein"
FT                   /note="Very weak similarity, possibly spurious, to domain
FT                   of unknown function, DUF768"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5021"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07967"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLW9"
FT                   /protein_id="ACF07967.1"
FT                   /translation="MKCAQPAIIYRSPPVSMIALPSSLSAAVVRVRQGAPRKGRAPCSF
FT                   VSRVFLKLGGVILRTISVPKGSPRQEVQAMKPEQFLERWKSEHIDSGTQQSDATRLVED
FT                   LLADAEKEGISRDMLVDAAGGGLVNYIVGAIKEAVEEELW"
FT   gene            complement(229290..230330)
FT                   /locus_tag="SMa0424"
FT   CDS_pept        complement(229290..230330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0424"
FT                   /product="ATP-dependent DNA ligase"
FT                   /note="pfam01068, DNA_ligase_A_M, ATP dependent DNA ligase
FT                   domain; This domain belongs to a more diverse superfamily,
FT                   including pfam01331 and pfam01653; Similar to S; meliloti
FT                   SMb20912, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64882"
FT                   /db_xref="GOA:Q930H2"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H2"
FT                   /protein_id="AAK64882.1"
FT                   /translation="MSRRAKPLLQDDSVAKSKPARPRDPAQPNLPFDPMAERIEPCLAL
FT                   LKPVPPKGPDWVFEVKWDGYRLAIHIEPKGVRIITRGGHDWTHRFPAIAEATSKLGVGT
FT                   AILDGEAVVLDEEGRSDFGALQRSLGGRGGKRSSTESVFFAFDLLYFDGHDLSGTELSV
FT                   RRHLLEGFLDGPTGAIQSSEEVFGDGALLEKACSMGLKGIIAKHRDWPYRSGRTGDWLK
FT                   IKCLQSESFMIVGYEQSLTARGGLGSLLLAGRKGHDWIYVGSVGTGFNTKDAEYLRKTL
FT                   DRLKTSKPAVPLKGKNLVFAQPTLIAEIEFRGWTHDGSLRHASYKGLREVQDNAAVFDM
FT                   SERAIL"
FT   gene            complement(230327..231133)
FT                   /locus_tag="SMa0426"
FT   CDS_pept        complement(230327..231133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="Unknown function but contains a KU-like domain,
FT                   cd00789; This CD represents prokaryotic homologs of the
FT                   eukaryotic DNA binding protein Ku; The alignment includes
FT                   the core domain shared by the prokaryotic Yko V-like
FT                   proteins and the eukaryotic Ku70 and Ku80; The prokaryotic
FT                   Ku homologs are predicted to form a homodimer; It is
FT                   proposed that the Ku homologs are functionally associated
FT                   with ATP-dependent DNA ligase and the eukaryotic-type
FT                   primase, probably as components of a double-strand break
FT                   repair system; Similar to SMb21407"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64883"
FT                   /db_xref="GOA:Q930H1"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H1"
FT                   /protein_id="AAK64883.1"
FT                   /translation="MALRPYWKGYLKLSLVTCPVQMMPATSESEKVRFHTLNRQTQNRV
FT                   VSHYVDSVTGKEVKEEDEVKGYQRGEHEYVILEDEELENVALESTKTIDISTFTPRDSI
FT                   EWIWLDTPYCLSPNDPVGQEAFSVIRDAMEAQNMVGISRLVISRRERAVMLEPRGKGIV
FT                   LWTLRYGDEVRDEDSYFEAIGDEQADSEMMPLVQQLIKKQTKDWTPKMVADPVQERLLE
FT                   IIAAKKKALKPQKAQGKTAPSSSPSNVVSIMDALRKSVAAEKRATK"
FT   gene            complement(231427..232443)
FT                   /locus_tag="SMa0429"
FT   CDS_pept        complement(231427..232443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64884"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q930H0"
FT                   /protein_id="AAK64884.1"
FT                   /translation="MADRFLALSKDDRREALAVAAARTGRPIHLLEKDVWVVWTLETLY
FT                   SSKLGEHLVFKGGTSLSKAYGAIRRFSEDIDLTYDIRALAPDLVGDNDEALPKTRSEEK
FT                   RWTSEVRKRLPVWVAESVEPVIAAAVRGQSLPARIRIEGDTLYLDYEAVSSGSGYVAPS
FT                   VMLEFGARSTGEPASIRDVGCDAAGHVDGVEFPKASPRAMHAERTFWEKATAIHVFCLQ
FT                   ERPRGDRFARHWHDVVRLDDAGFADKAFAERQLANAVAKHKSMFFAEKAADRSPIDYAA
FT                   AGHLVLTPSGDGLRALSEDYAKMVDDGLLLGDSEPFEQLIERCALIQERANKVGTTE"
FT   gene            complement(232436..233029)
FT                   /locus_tag="SMa0431"
FT   CDS_pept        complement(232436..233029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64885"
FT                   /db_xref="UniProtKB/TrEMBL:Q930G9"
FT                   /protein_id="AAK64885.1"
FT                   /translation="MQNLTSQILGYAEQMPEGSPLSAKSLLHLGNRAAVDQALSRLTER
FT                   GELIRAGRGIYMRPVKSRFGSRPPTVEQAVEAVAQQRGEIIVSSGAAAANALGLTTQVP
FT                   VRSVYLTSGRSRTMNLGKQSVELKHVPRWQLALADRPAGVAVRALAWLGPEKAEEALSR
FT                   IKRKLPPAEFGELVAAAPQFPTWLARSVGRAAHG"
FT   gene            233560..234030
FT                   /locus_tag="SMa0433"
FT   CDS_pept        233560..234030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0433"
FT                   /product="hypothetical protein"
FT                   /note="contains PAS domain and shares similarity with the
FT                   N-terminal regions of a group of sensor kinases; Possible
FT                   truncated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64886"
FT                   /db_xref="UniProtKB/TrEMBL:Q930G8"
FT                   /protein_id="AAK64886.1"
FT                   /translation="MTKVTVIAHSPGAPVSRRALLDAIRNQASWAGKTRLQLFAPAHIG
FT                   AYLNKVRKELGIASRLIASLTALTKFGVLSLDGLEPGSPFLTQLMEDSSKELANGWDAQ
FT                   VKARQVIFGDGENVVMVQRFLEDPPHTVWPGHGHCSVCRCDKTAPAIASYLA"
FT   gene            complement(234248..234631)
FT                   /locus_tag="SMa0436"
FT   CDS_pept        complement(234248..234631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0436"
FT                   /product="hypothetical protein"
FT                   /note="contains a region with very weak similarity to a PAS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64887"
FT                   /db_xref="GOA:Q930G7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q930G7"
FT                   /protein_id="AAK64887.1"
FT                   /translation="MSTTPTVHFEAASTLAVVVSSHEPLLFLSDDLKIIAASASFCRAF
FT                   DIDPTSVPGKKLGELGQGEWAMPKLESLLKATASRSADIQAYEIDLKRPNRGTRQLVVN
FT                   AQTLDDGDVEHIRLLVAVTDMER"
FT   gene            236016..236381
FT                   /locus_tag="SMa5022"
FT   CDS_pept        236016..236381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5022"
FT                   /product="hypothetical protein"
FT                   /note="Amino-terminus has similarity to conserved
FT                   hypothetical proteins of COG5579; Carboxy-terminus has
FT                   similarity to a short stretch of amino acids found in
FT                   eukaryotic-type DNA primases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5022"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07968"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX0"
FT                   /protein_id="ACF07968.1"
FT                   /translation="MAENDPFELSRLVAAQDLVFETVLAELRAGRKETRWMWFIFPQLR
FT                   ALGRSPTANFYGIGSIEEARAYLPWTQVQSNLDPKRFTVRTVPALLAKAGAWEEYYDGQ
FT                   RPHEQAIKRLGKHKAAA"
FT   gene            236378..236794
FT                   /locus_tag="SMa5023"
FT   CDS_pept        236378..236794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5023"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07969"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX1"
FT                   /protein_id="ACF07969.1"
FT                   /translation="MTFESPGGDHTKRMKKSNIPIEQLTRLRRIRGLARLMDTALRIPG
FT                   TRMSLGADSVLGLIPGVGDFAAAAVSLIIVNEARRLGVPNDKLVKMLVNVGFDTVAGSV
FT                   PVLGDVFDVYFKSNRRNLQLVLDHFGLDHADLDR"
FT   repeat_region   complement(236849..238167)
FT                   /rpt_family="ISRm1"
FT                   /note="SMa3003; predicted by homology"
FT   gene            complement(236878..237708)
FT                   /locus_tag="SMa0444"
FT   CDS_pept        complement(236878..237708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0444"
FT                   /product="TRm1b transposase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64890"
FT                   /db_xref="GOA:Q930G4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q930G4"
FT                   /protein_id="AAK64890.2"
FT                   /translation="MKTVCETLGVARSNIAARAAGSPSRARGRPPLPDRELVEDIKAVI
FT                   ADMPTYGYRRVHAILRRNARKLGRSWPNAKRVYRVMKLHNLLLVRHTGAVDDRLHEGQV
FT                   AVERSNIRWCSDGFEIGCDNKEKVRVAFALDCCDREAIAHVATTEGIKSQDVQDLVITA
FT                   VENRFGRINMLSEPIEWLTDNGSCFVARDTASLLRDIGMEPCTTPVRSPQSNGMAEAFV
FT                   KTFKRDYVSVNPTPDAETVMAQLPFWFEHYNNLHPHSALGYQSPREFISSQSQT"
FT   gene            complement(237705..238097)
FT                   /locus_tag="SMa0445"
FT   CDS_pept        complement(237705..238097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0445"
FT                   /product="TRm1a transposase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64891"
FT                   /db_xref="GOA:G3XCP7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:G3XCP7"
FT                   /protein_id="AAK64891.1"
FT                   /translation="MTSSNFKMEVLSGPERRRRWSTAEKLAIIHETYEADATVSIVARR
FT                   HGIQPNQLFAWRKLASQGALTATAAEEEVVPASEYRALQAQVKELQRLLGKKTMESEIL
FT                   KEALEIAGSPKKHLLRSLSLPRGILG"
FT   gene            238528..239649
FT                   /locus_tag="SMa0447"
FT   CDS_pept        238528..239649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains pfam01594, UPF0118, Domain of unknown
FT                   function DUF20; This transmembrane region is found in
FT                   putative permeases and predicted transmembrane proteins it
FT                   has no known function; It is not clear what source
FT                   suggested that these proteins may be permeases and this
FT                   information should be treated with caution, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64892"
FT                   /db_xref="GOA:Q930G3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q930G3"
FT                   /protein_id="AAK64892.1"
FT                   /translation="MSMVTQGKLIGQLLAFGALGLLAIGCTLVLWPFLSAILWAAVICF
FT                   STWPAYRLFERAVGGYRALAAAAMTVLVVVVIVAPLALLATTLADNISSLVAGVTHVLE
FT                   QGPPAPPDWVRGLPIAGEGLATYWEGLAHNAPAFTIELKKVIGPFADVALIGGTLFGAG
FT                   LLELALSIFIGFFLFLHGRRMTALTRQIAERVAGARARRLLSVVGVTVTGVVYGLIGTA
FT                   LAQGLLAGVGFWIAGVPQALLLGCLTFVLSFVPAGPPFVWGPVALWLFMQESVWWGIFV
FT                   AIWGLLLVSSIDNFLRPYLLGRNTNLPVLLGLFGLIGGVLAFGLIGLFLGPTLLAVAHS
FT                   LFREWIAAELEERRQPPSSSTGRDQRSGPRQGG"
FT   gene            complement(240025..240435)
FT                   /locus_tag="SMa0448"
FT   CDS_pept        complement(240025..240435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0448"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to the C-terminal regions of a group
FT                   of conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64893"
FT                   /db_xref="UniProtKB/TrEMBL:Q930G2"
FT                   /protein_id="AAK64893.1"
FT                   /translation="MVGLLTGLELMAILGVGPVVAAGWLAATAAGAVAGAVAGGAAGGL
FT                   IGALTDSGVDEEDAHVFAKGVRRGGTFVTARVDDTLAPEAQAILQDLNRVDPAARWGVF
FT                   AQEEWTRFDENADPYTLEAVPLYDAVTASKDW"
FT   gene            240985..241272
FT                   /locus_tag="SMa0450"
FT   CDS_pept        240985..241272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0450"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein SMa1797 of
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64894"
FT                   /db_xref="UniProtKB/TrEMBL:Q930G1"
FT                   /protein_id="AAK64894.1"
FT                   /translation="MVTEMSSEKMRKLIQDYQRDIAAYLAPESGISERQLLQQLASRLD
FT                   GQQAQDALGNGWQGWLPDDEDPAAADDGSPAPTRWWTEPEFFGTMWKLRS"
FT   gene            243155..243562
FT                   /locus_tag="SMa0453"
FT   CDS_pept        243155..243562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0453"
FT                   /product="Yle homolog"
FT                   /note="Similar to Yle of Agrobacterium tumefaciens; Yle of
FT                   A; tumefaciens resembles plasmid stability locus and might
FT                   have a role in Ti plasmid maintenance; Similar to COG1487,
FT                   VapC, Predicted nucleic acid-binding protein, contains PIN
FT                   domain, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64896"
FT                   /db_xref="GOA:Q930F9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F9"
FT                   /protein_id="AAK64896.1"
FT                   /translation="MYLVDTNIVSEARRGTPQAVSWLRSVDPLSIHLSALSLGEIMRGI
FT                   ALKQRSDPKTAAHLTEWLRKLRHDHGDRILPITDQIAVEWGRIAAIRPRGDIDGLIAAT
FT                   AIVHDLILVTRNVKDFEDTDASVINPWETSA"
FT   repeat_region   245057..246355
FT                   /rpt_family="ISRm3"
FT                   /note="SMa3004; predicted by homology"
FT   gene            245116..246318
FT                   /locus_tag="SMa0461"
FT   CDS_pept        245116..246318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0461"
FT                   /product="TRm3 transposase"
FT                   /note="Elements of external origin; Transposon-related
FT                   functions, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64898"
FT                   /db_xref="GOA:P80011"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80011"
FT                   /protein_id="AAK64898.1"
FT                   /translation="MAIEKELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELDD
FT                   HLDVERLEGGPANRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDFDD
FT                   KIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYPLVF
FT                   FDAIRVKIRDEGFVRNKAVYVALAVLADGSKEILGLWIEQTEGAKFWLRVMNELKNRGC
FT                   QDILIAVVDGLKGFPEAITAVFPQTIVQTCIVHLIRHSLEFVSYKDRRTVVPALRAIYR
FT                   ARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEA
FT                   LNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIFGERFF
FT                   N"
FT   gene            complement(246386..248227)
FT                   /locus_tag="SMa0462"
FT   CDS_pept        complement(246386..248227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="has very weak, probably spurious similarity to
FT                   eukaryotic peroxidases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64899"
FT                   /db_xref="GOA:Q930F7"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR037120"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F7"
FT                   /protein_id="AAK64899.1"
FT                   /translation="MVTKKKARAKQTPKRLDVMKATKNKAETANAAAFEIPEQAGKFLR
FT                   DTSIPQGFANPQPIVLAELQKRVTEMNLRPTVSLEQFLASANRIKPVDLPIEELSDDVK
FT                   ESIPALKPEIRRFHGVKIPLYWFPFPWLSSVCSDRFGYMSSAATRAATKLPFNVATQAL
FT                   LGQLGNMMGDAGRDPNPASHNPADAGVSSLPAGFTYFAQFVDHDITFDVSSTLDADIDA
FT                   NTVNNMRSPALDLDSLYGRGPGLDPFLYVFPTSGPATAIKLHRGTNTPVGPGGPSNNGN
FT                   PSGMLQQTNWDVPRMQGTNTAVTGDPRNDENLIIVQFHHAMLRFHNAVVDLLLAAAFAG
FT                   DIFAEAKRIVTHHYQWAVVHDFLERICGVATVNNAIASVSAPIGSSFRMPVEFAVAAYR
FT                   FGHSMIRDTYWVNFNFPNATLGQVFEFNRIPRLPVFSNWVVDFNAFFDTGVPVPVHNKA
FT                   RKIDSLMASGLESLPGFSGMMAILATRNLRRALALGLPSGQGMANSFGIAPMTAAQLIF
FT                   GLPPAEVAVLNASGGLLLNKTPLWYYVLREAAVLAGGNQLGAVGGRIVAETFVRILKRD
FT                   ASSYLNVAGGFTPILPSSTPGNFTVADLVAFVGVTQP"
FT   gene            complement(248442..251618)
FT                   /gene="cyaI2"
FT                   /locus_tag="SMa0464"
FT   CDS_pept        complement(248442..251618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaI2"
FT                   /locus_tag="SMa0464"
FT                   /product="adenylate/guanylate cyclase"
FT                   /function="Predicted ATPase"
FT                   /EC_number="4.6.1.1"
FT                   /note="Amino-terminus contains an adenylate/guanylate
FT                   cyclase domain of the type found in family 3 adenylate
FT                   cyclases; Also contains an approximately 750 amino acid
FT                   domain found in ATPases, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64900"
FT                   /db_xref="GOA:Q930F6"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F6"
FT                   /protein_id="AAK64900.1"
FT                   /translation="MAVIRRPSRSLTPTEEIALARPEPPAEDVRKTITILIADIVDSSR
FT                   LSLTLDPEALRELFARYFDEMTSTIQRHGGVVDRYVGDEILAVFGVPTLHEDDALRAVS
FT                   AAVDMRDTLARLNHEFETGWGVQLAHRIGLNTGEVFTGIDRWGHRFLTGEAVRVAKRLQ
FT                   EAAAANEILMGEATHKLVRHAVVVESSSPRAVKHGETFPAIIVLTVIARTTGFQRRFDT
FT                   PFVGRKRQLAMISTLLGDFVSNRTCHLLTVLGEAGVGKSRLVSEVAGNLAREMTVAHGR
FT                   CLPYGDGITYWLLADIVREIFRAGGGDSGKLSVAAIAEVLAGVDKAKLIAERIAGLLGF
FT                   GAGDPGTREETFWAVRRLFEVFARERPVVIVVEDLHWADPTLLDFIEHLVDFSHGFPIM
FT                   IVATARPELLDTRPGWGGGTPNATTIALEPLSEAESRDMVLNLLHRLPLSPAVELMITR
FT                   AVGGNPLFAEELVAMLVDEELLRRNEDCWVAREDLSELPVPSTIIALLAARLEGLTSQE
FT                   RAILTAAAVEGAVFHRSAVDELARPAPKALGDGLLSLVRRDLIRPEAPSFVGEETYRFR
FT                   HDMIREAAYRSLPKNARADLHERFASWLEITAKERLREFEEVVGYHLEQAFQYRIALGP
FT                   RGARAASLAARACERLEAAGRRALVRSDLSAAISLLERVSRLLLADDPRRIALLAELSG
FT                   ALIESGRLDDAGRVLEEAGGLAGAAMDRRLAAHVRVQRQFLRLLHGEEGGLEKAAQAAA
FT                   EVIPVFEGFGDDLGLCRARRLEAWLFFNGARGEAAAAAWERAAAHARRAGNLHEYYEIL
FT                   TWIASSLWFGPTPAAEGIRRCEAMRAEVGESLESEAAILRQLACLNAVVGRFAIARELI
FT                   AASNATYADLGLTLYVASSEHEAVVELLAGNPAAAERSARAAYRALEEMGERAFRSTMA
FT                   ASLAVVILEQGRDEEAEDFAKLSAQLAASGDLVTQVRWRRVRARVLARRAEISAAEALA
FT                   REALEIAEKTDFINDRADALVDLSHVLEASRRRDEAVAAATGAVHLYELKGNVVAAAAT
FT                   RLRLGKLVAM"
FT   gene            252021..253625
FT                   /locus_tag="SMa0466"
FT   CDS_pept        252021..253625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0466"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="best similarity to bacterial extracellular solute-
FT                   binding proteins, family, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64901"
FT                   /db_xref="GOA:Q930F5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F5"
FT                   /protein_id="AAK64901.1"
FT                   /translation="MAIEFTRRSILAAGMAHAAFVSVTGTFVIARAAKAAEQIELVTWA
FT                   LPSIPDTLFIPHAWTTYTGAIMSLVQEGLLGFGEDLGLETALADRWEEVDPTTIKYHLR
FT                   GGVKFGDGSPLAADDIVATFKYHMSPDSPSQLASFYNSVATVEATAPDEVTVKLKAPNV
FT                   QFAFTPAHMAGFVFKKEQLADKNIGTPEALPLGTGAYKLVEFVPTDRVILEARDDYSGP
FT                   KPAVKRITFKAIPDRPARLLAMQQGEIDGTFDLAISDIDQWKALGNVDVVAAPSLGVYL
FT                   LTLDHSAPPFDDIHVRRAVAYSVDRNGLVQALLKGNGEAATALNPPEIWSGVLPPDEVR
FT                   AFYATLLPNYAFDLNKAKAELAQSNHPDGFDVTIPASTADPYMVNILQSVTENLKQIGI
FT                   RAHIQESDNNTWFTNYVTHDKLGMQIMAYYPDFADAANYPSLFFSSANAEKGGMNGSNF
FT                   NNREVDAKLKIANENADPKARADALKKVFTIANEEVAVVPIFWPASAMAINNKYKLTGY
FT                   NAFWYSIPWAMRGFGPK"
FT   gene            253863..254879
FT                   /locus_tag="SMa0467"
FT   CDS_pept        253863..254879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0467"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to DppB, ABC-type
FT                   dipeptide/oligopeptide/nickel transport systems, permease
FT                   components, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64902"
FT                   /db_xref="GOA:Q930F4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F4"
FT                   /protein_id="AAK64902.1"
FT                   /translation="MHRAAPSTGLTAISGGANGGSSLVVFITRRFAVTIPLLLIISFGV
FT                   FALIHIAPGDPVSSLLGARASDPATLAAIRARYHLDDSLLVQYGTWLSQVIRGDLGVSI
FT                   LGNRSVTSTIADRLGVTIFLSLMSTTLVLGLGILLGALAAFRRGTGLDRTVVMFSVFGI
FT                   SSPAFVTGIFFLYVFGVLLHWFPTFGAGTGFLDRAWHLALPALALAASTMAIVVKITRA
FT                   AVIEELARDYVTFARARGVSSRRILLAYVLRNSLIPVITAAGLIVIGILAGAIYVEVTF
FT                   SLPGLGALMIDAVQKRDIPTIQGITLLFSAFVVLVNLAVDVIYTLIDPRIRFGRVGS"
FT   gene            254921..255718
FT                   /locus_tag="SMa0469"
FT   CDS_pept        254921..255718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0469"
FT                   /product="ABC transporter, permease"
FT                   /note="best similarity to peptide and nickel transporters,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64903"
FT                   /db_xref="GOA:Q930F3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F3"
FT                   /protein_id="AAK64903.2"
FT                   /translation="MPVPVVVLFAALIIAAVVICAVLGERIAPDSPFLQRLGVGDTPPS
FT                   QDHIAGTDLLGRDVLSRVIYGARTALAGPVVVAAGAFAISTLLGLLSGYLGGLVDSAIM
FT                   RWVDFMFALPGPLVAIVVVGVVGGGYWTAVLVLVVLFTAPDTRIVRSAVLEQRPLAYID
FT                   AARTLGISKTRILFVHILPNIAPIILAYVVLDFAFALVNLAGLSFLGLGVEPGTPDWGR
FT                   MLFENRTILFSNPAALLLPAGMIILTAVSMNLVGDWLFERFSK"
FT   gene            255727..257562
FT                   /locus_tag="SMa0470"
FT   CDS_pept        255727..257562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0470"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase domains; The two domains
FT                   are very similar to those of the NikE/OppD family of
FT                   transporters, but in this case the domains are duplicated
FT                   within one protein, rather than being encoded by separate
FT                   genes, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64904"
FT                   /db_xref="GOA:Q930F2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F2"
FT                   /protein_id="AAK64904.2"
FT                   /translation="MAREGQESPLLKVEGLAISHGDVPITLPLEIVVERGETIAIVGES
FT                   GSGKSLTARAIVGILPPGINAKGAVTLDGVPLMRLAERELRTIRGSRVSMLMQDPFTML
FT                   NPLMRSGDHIDEMLRDRPEFASRAVRADEVKRRLAEVGIVDEDVARRMPFQLSGGMCQR
FT                   VALAAALARDPELLIADEPSTALDVTTQAEIIKLLRRIQRERNMAVILITHNLRLAFST
FT                   CQRIYVLYAGSMLEVGDAAAVERQPFHPYTLGLLLSEPPVDIRVPRLVAIRGSVPRAAD
FT                   VIDSCGFADRCEWAKQICRAGKPSLAARDASRFTACIRQDEIQGELDALRSATLSATPE
FT                   TPRRGGTAGALVHVDALVKTFAGRRGRPICAIRDVSLHIMAGESVGLVGESGSGKTTIG
FT                   RCLVGLETPTDGDIRINGIAAADFGAMAKADRDRVRRTIQMIFQDPYSTLNPKHSVGQA
FT                   LREALGASAGAPSPAPQERIASLLAEVGLSAAYATRRPASLSGGERQRVAIARALAVKP
FT                   AILVCDEPVSALDVSVQAQVLNLFRRLQVEHELSYLFITHDLAVVRQIAERIYVLYLGE
FT                   IVEEGPTERVISNPQHPYTRRLIESIVRSAIQRAP"
FT   gene            258225..258533
FT                   /locus_tag="SMa0471"
FT   CDS_pept        258225..258533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has similarity to pfam04221, RelB antitoxin, but is
FT                   missing about one third of the RelB domain; RelE and RelB
FT                   form a toxin-antitoxin system; RelE represses translation,
FT                   probably through binding ribosomes (,); RelB stably binds
FT                   RelE, presumably deactivating it"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64905"
FT                   /db_xref="GOA:Q930F1"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F1"
FT                   /protein_id="AAK64905.1"
FT                   /translation="MASNALVQTRIDAEVKERATAVLENMGLTVSDAVRILLTRTANEG
FT                   ALPLELFSHSEAHDAWFRAKVLRALEDTRPDVDDADADAHFRERRAAALRKAAAGDR"
FT   gene            258530..258823
FT                   /locus_tag="SMa0473"
FT   CDS_pept        258530..258823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has similarity to ParE, Plasmid stabilization system
FT                   protein; Also has similarity to proteins annotated as
FT                   'Addiction module toxin, RelE/StbE' but the significance of
FT                   this is unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64906"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q930F0"
FT                   /protein_id="AAK64906.1"
FT                   /translation="MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDF
FT                   PESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRILRVLHGAQKWPSELDDG"
FT   repeat_region   258869..260541
FT                   /rpt_family="ISRm17"
FT                   /note="SMa4001; predicted by homology"
FT   gene            259012..259911
FT                   /locus_tag="SMa0475"
FT   CDS_pept        259012..259911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0475"
FT                   /product="TRm17a transposase"
FT                   /note="Similar to IS5 family transposases, high confidence
FT                   in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64907"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q930E9"
FT                   /protein_id="AAK64907.1"
FT                   /translation="MRQERTVQGSIFDLFAEHEIGRELEAMSQWLDAHRDLLNLVTSDL
FT                   RRQGVTETGRQGLPSEAVLRCALLKQYRQLSYEELAFHLEDSASFRAFARLPWGWSPKK
FT                   SVLHKTISAIRADTWEAVNKMLLASARQERLESGRVVRVDSTVTAALIHEPSDSSLLWD
FT                   CVRVMVRLLQQADSLGSTIPWHDHCRAAKKRARVIEYTRGRPKRVQHYRALLRIARNTL
FT                   DYLQQAAAQLPLAAGPAGKLWQAQVRHYQPLITQIIAQTERRVLAGEAVPAGEKLVSLF
FT                   EPHADIIVKGSRERRLRT"
FT   gene            259996..260349
FT                   /locus_tag="SMa0476"
FT   CDS_pept        259996..260349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0476"
FT                   /product="TRm17b transposase"
FT                   /note="Similar to IS5 family transposases, high confidence
FT                   in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64908"
FT                   /db_xref="GOA:Q930E8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q930E8"
FT                   /protein_id="AAK64908.1"
FT                   /translation="MPLLERHIAFYGEAPRQAAADGGYASRENLRQAKAWGVRDMAFHK
FT                   KSGLRIEDMVRSRWVYRKLRNFRAGIEAGISCLKRTYGLARCTWRGLDHFKTYVWSSVV
FT                   AYNLALFARLRPT"
FT   gene            complement(260764..261969)
FT                   /locus_tag="SMa0478"
FT   CDS_pept        complement(260764..261969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0478"
FT                   /product="Dehydrogenase, NAD-dependent"
FT                   /note="Similar to formate dehydrogenase and D-isomer
FT                   specific 2-hydroxyacid dehydrogenases, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64909"
FT                   /db_xref="GOA:Q930E7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR033689"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930E7"
FT                   /protein_id="AAK64909.1"
FT                   /translation="MEMAKVACVLYDDPVDGYPTAYARDGLPTLERYPGGQTLPTPKAI
FT                   DFEPGALLGSVSGELGLRKFLEGQGHTLVVTSDKDGPDSVFERELVDAEIVISQPFWPA
FT                   YLTAERIVKAARLKLAITAGIGSDHVDLQAAIDRGITVAEVTYCNSISVSEHVVMMILS
FT                   LARNYIPSYQWVVKGGWNVADCVARSYDIEGMDIGTVGAGRIGTAVLRRLKPFDVKLHY
FT                   TDRHRLPDEVAKELGVTFHQTAAEMVPVCDVVTINAPLHPETENLFNEAMIGKMKRGAY
FT                   LVNTARGKICNRDAVARALESGQLAGYAGDVWFPQPAPKDHPWRSMPHHGMTPHISGSS
FT                   LSAQARYAAGTREILECWFEGRPIREEYLIVSGGKLAGAGAHSYSAGDATRGSEEAAHF
FT                   KT"
FT   gene            262378..262674
FT                   /locus_tag="SMa5024"
FT   CDS_pept        262378..262674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5024"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to the central region of a group of
FT                   conserved hypothetical proteins, including S; meliloti
FT                   SMa2147, which contain a region with weak similarity to
FT                   ParB-like nuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5024"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07970"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX2"
FT                   /protein_id="ACF07970.1"
FT                   /translation="MVFADTRSAGTWYLLDGHLRLEALKELGFAKVECLVATDDDTYTY
FT                   NKRVNRLAPIEEHRMIARAIERGVSSADIADAWGFRWSPSFAGSVCWKASAPR"
FT   gene            complement(263506..264432)
FT                   /locus_tag="SMa0483"
FT   CDS_pept        complement(263506..264432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0483"
FT                   /product="Phosphatase"
FT                   /note="Similar to cd01641, Bacterial_IMPase_like_1,
FT                   Predominantly bacterial family of Mg++ dependent
FT                   phosphatases, related to inositol monophosphatases; These
FT                   enzymes may dephosphorylate fructose-1,6-bisphosphate,
FT                   inositol monophospate, 3'-phosphoadenosine-5'-phosphate, or
FT                   similar substrates; This predicted protein is longer than
FT                   other bacterial phosphatases, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64912"
FT                   /db_xref="GOA:Q930E4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="UniProtKB/TrEMBL:Q930E4"
FT                   /protein_id="AAK64912.1"
FT                   /translation="MPPMQFLRARRSPADNRLSIGIAIPTCRRWTCSPAGGTVPPTTIK
FT                   GVQNSMFDPPLGEFASFAHDIADLARQTISSAAGVRREPIAKSDASPVTETDRAVEKCL
FT                   RERIADHFPDHGVLGEEFGAEGLGNEFVWVIDPIDGTKAFVAGLPVYGTLISLTRGGTP
FT                   ILGLIDNPMTGDRWLGVSGQPTTLNNVPIRTASTTALATAFIANGNPDAFSPADKSRVE
FT                   SLRRITRWCVYGGSCIAYGRVADGSVDISIDGGLDPYDYCALVPVITGAGGCITDWQGR
FT                   PLTLNSGGLCVATATDLLHRHVLEILA"
FT   gene            complement(264485..265939)
FT                   /gene="thrC2"
FT                   /locus_tag="SMa0485"
FT   CDS_pept        complement(264485..265939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC2"
FT                   /locus_tag="SMa0485"
FT                   /product="ThrC2 threonine synthase"
FT                   /function="Threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="CATALYTIC ACTIVITY: O-phospho-L-homoserine + H(2)O =
FT                   L-threonine + phosphate, COFACTOR: Pyridoxal phosphate,
FT                   PATHWAY: Threonine biosynthesis, SIMILARITY: Belongs to the
FT                   serine/threonine dehydratase family, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64913"
FT                   /db_xref="GOA:Q930E3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:Q930E3"
FT                   /protein_id="AAK64913.1"
FT                   /translation="MIKYVSTTGGIEPVGFDEAVLQGFAADGGLFVPDRIPVIDQEQLQ
FT                   AFSTLSFQDLAFELVSLYIDASIIPRQDLRRLIDNSYREFQRPDIVNLVPIRGNRDTYV
FT                   LELFHGPTQSFKDMAMGFLMQVVDYLLGQRRERLNIVLATTGDTGPAAAWAAAGKQRID
FT                   CWPLYPRGMISREQERQMTTLRADNVHPVGVENCPDGGDDLDLVVAELFSDEKLKRTLA
FT                   LSSVNSINWCRVMTQTVHYFYSYYRAVERVGDPVVFSVPSGAFGNLFAGYLARSMGLPV
FT                   ARFVCANNVNNALHTAFSRGVLPRHDLVQTPSSAIDIVAPYNFWRLLYFATNRDTARIR
FT                   QWMKDFAARREVVLDVETTKTIQGGFISASISDEETLATVRSVYEAEGHYLIDPHTAVA
FT                   VAAVEAVRDSLPAAAAIVCFATAHPAKFPDVIKRALDVEELPAAGHHPVIDEARDACEH
FT                   LRICQLENLRSNLIGEMTRQVARRRG"
FT   gene            complement(266004..266954)
FT                   /locus_tag="SMa0486"
FT   CDS_pept        complement(266004..266954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0486"
FT                   /product="putative cyclodeaminase"
FT                   /note="This family contains the bacterial Ornithine
FT                   cyclodeaminase enzyme, which catalyses the deamination of
FT                   ornithine to proline; This family also contains
FT                   mu-Crystallin the major component of the eye lens in
FT                   several Australian marsupials, mRNA for this protein has
FT                   also been found in human retina, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64914"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930E2"
FT                   /protein_id="AAK64914.1"
FT                   /translation="MTKVFGIEEIRAATASMDLTSVMEAGFVAYSDGKVVVPPVGELLF
FT                   EEPPGDTHIKYGYIRDDRVFVIKIASGFYGNAALGLPSSSGLMLVFSQKTGFLESVLLD
FT                   EGYLTNVRTALAGRIAARYLAPKEVKAIGVFGTGTMARMQVTYLSTETDCQNIVAWGRS
FT                   DDSLRRYCDDMAALGYHVTTTRDAREVAEACNLIIMTTPSTKPLLMASQLQPGTHITAM
FT                   GSDTPEKQELDSLILARADIVVADSLEQCLSRGEIFHAVRAGHIAAAQVRELGGQIRAG
FT                   TRVRTSQDQITVADLTGVAVQDIQIAKAVCERLSS"
FT   gene            complement(267102..267869)
FT                   /locus_tag="SMa0489"
FT   CDS_pept        complement(267102..267869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0489"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are
FT                   the ATP-binding components of the bacterial periplasmic
FT                   histidine and glutamine permeases, repectively; Histidine
FT                   permease is a multisubunit complex containing the HisQ and
FT                   HisM integral membrane subunits and two copies of HisP;
FT                   HisP has properties intermediate between those of integral
FT                   and peripheral membrane proteins and is accessible from
FT                   both sides of the membrane, presumably by its interaction
FT                   with HisQ and HisM; The two HisP subunits form a homodimer
FT                   within the complex; The domain structure of the amino acid
FT                   uptake systems is typical for prokaryote extracellular
FT                   solute binding protein-dependent uptake systems; All of the
FT                   amino acid uptake systems also have at least one and in a
FT                   few cases two extracellular solute binding proteins located
FT                   in the periplasm of Gram-negative bacteria or attached to
FT                   the cell membrane of Gram-positive bacteria, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64915"
FT                   /db_xref="GOA:Q930E1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q930E1"
FT                   /protein_id="AAK64915.1"
FT                   /translation="MIEATFMNKPNDTMIQLIGVGKRFGQFEALKQVSLEVRRGEKIVL
FT                   CGPSGSGKSTLIRCINRMEEHTSGRIIIDGRELTDRTKDINAVRREVGMVFQSFNLFPH
FT                   MTILKNLTIAQRLVRKTPEKEAKEVAMHYLKRVKIPEQASKYPVQLSGGQQQRVAIARA
FT                   LCMKPQIMLFDEPTSALDPEMISEVLDVMVDLARDGMTMICVTHEMGFARSVADRVMFM
FT                   DGGQLIEEGDPETFFANPRNERTALFLRQILRH"
FT   gene            complement(267881..268564)
FT                   /locus_tag="SMa0492"
FT   CDS_pept        complement(267881..268564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0492"
FT                   /product="ABC transporter, permease"
FT                   /note="Binding-protein-dependent transport systems inner
FT                   membrane component, His/Glu/Gln/Arg/opine family, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64916"
FT                   /db_xref="GOA:Q930E0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930E0"
FT                   /protein_id="AAK64916.1"
FT                   /translation="MNIGIVFDAIPRMLGGIVMTFQLLLLSLAIGTMIAVLLLLMRISG
FT                   RWWLSWPAQFYTYVFRGTPILVQIFIVYYGLPQFEWIRESIFWPILRDPFGCAILALSL
FT                   NTGAYLSEIFRGGVLAVERGLLEAGAALGMSATHRFIYITTPLAIRIALPAYGNEVISL
FT                   MKSTALASTITLVDMTGIGRTIVAETFAPYQVFLSLAIVYVAITWIIQRSVKRLEVYLG
FT                   RSTAR"
FT   gene            complement(268561..269259)
FT                   /locus_tag="SMa0493"
FT   CDS_pept        complement(268561..269259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0493"
FT                   /product="ABC transporter, permease"
FT                   /note="Best similarity to a component of the octopine
FT                   active transport system probably consisting of four
FT                   subunits: Q, M, P and T and to the binding-protein-
FT                   dependent transport system permease family; HisMQ
FT                   subfamily, SUBCELLULAR LOCATION: Integral membrane protein;
FT                   Inner membrane (By similarity), family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64917"
FT                   /db_xref="GOA:Q930D9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D9"
FT                   /protein_id="AAK64917.1"
FT                   /translation="MEALNGWWDDYLLASVTVAKVFVCSLILMVIFGLLGASAKLSSNR
FT                   LANAVGNAYTVFFRGTPEILVILLLYFGSAVSLTTIARVFDPSVAFVDIPPFWAGSIAI
FT                   ALVVGSYATETFRGAFNGVKSGSIEAARALGMNGLQTFFYIRIPEMWRIALPPFGNHML
FT                   SLIKDTALISIIGLNETLFVAKQAASTTGKPFTMYIVVGLIYLGFSTAITISVLLLEAL
FT                   ANRHIQRRPS"
FT   gene            complement(269299..270117)
FT                   /locus_tag="SMa0495"
FT   CDS_pept        complement(269299..270117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0495"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Belongs to pfam00497, SBP_bac_3, Bacterial
FT                   extracellular solute-binding proteins, family 3, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64918"
FT                   /db_xref="GOA:Q930D8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D8"
FT                   /protein_id="AAK64918.1"
FT                   /translation="MNAMKNWQTSLTGLITAVLLSAAPANADTLRVGMECTYAPFNYRT
FT                   SDGKLEGYDVDVAKGISEIIGVDFEYVCQEWDGMIPALLANKFDLIIASMSITDKRKEQ
FT                   IDFSSPYRNSVGRIVGPVGKDLKLFDDKGQPVVGNFDGLRIGVERASTYFEWFSAKLPK
FT                   ADLVLYDSNEAMYLDLKNGRVDVIMTNPMKAHLSFLSGEGKGKYEFIGPEVNEPKFFGP
FT                   GVGVGLRKGNDELRDKISAAIRKLIREGKLKEYALKIFPFQIHDDAWAEE"
FT   gene            270311..270979
FT                   /locus_tag="SMa0496"
FT   CDS_pept        270311..270979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64919"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D7"
FT                   /protein_id="AAK64919.1"
FT                   /translation="MKKKDQELGKGIGPELSPFVPVCDAIANLFAPFAEVVLHDMASAS
FT                   VVYIAGNFSKREFGDPSNLEEIDFKPADVLIGPYEKTNWDGRRIKSISSVLRTASGKEV
FT                   GVLCINVDVSVFENILLTLQTFVSLPATAGKLDSLFRDDWFERINSYIRHWTTSRGLNI
FT                   SDLSRAQKKELVQALADDGAFSGKNAAGYICRLLGMGRATVYNYLNGDAAKVAGGNSKQ
FT                   "
FT   gene            complement(271057..271956)
FT                   /locus_tag="SMa0498"
FT   CDS_pept        complement(271057..271956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0498"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Contains LysR-type HTH domain and substrate-binding
FT                   domain, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64920"
FT                   /db_xref="GOA:Q930D6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D6"
FT                   /protein_id="AAK64920.1"
FT                   /translation="MTLSFSALESFYWVSQLRSFNAAANKLNVSQPTVSYRIRELEERL
FT                   GVSLFVRQRRQLVLTSEGEALKHYAESMIAIARDIESNIKTRNTRLPTLRVGVIDSFAA
FT                   VCLPSLLDELDIRFAGARIAATVDTSHKLADQLSEGLLDIAVLSTPPSHDNVALELLGR
FT                   QSVDWIASHKLGLPQTIVSDEELLRQRIFATPAPSNLHSLTTGFLAATAGAGLRLNVCN
FT                   SLGTILNLVESGTGISILPSRLLQEQIRHGTIQVLKTRTTLPLQEVFIGTNKGAIVRAL
FT                   PQVSQMIRKVSASVGFCV"
FT   gene            272059..272691
FT                   /locus_tag="SMa0499"
FT   CDS_pept        272059..272691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0499"
FT                   /product="hypothetical protein"
FT                   /note="Has partial similarity (is missing about the first
FT                   65 amino acids) to COG3481, Predicted HD-superfamily
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64921"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D5"
FT                   /protein_id="AAK64921.1"
FT                   /translation="MHKTISREHILEDLPEIAEIQSDDLREKVVDAWVFALERSSFDRV
FT                   VDIPGEGSPNVFALKRGTQDAHLRGVTRLALAIYDEFARTYPEARVDRDIILAGGLCHD
FT                   IGKTWEFDPINLKRWRERGDRYGEPSFRHSAYGTHVCLSVGLPEEIGHICMGHSLEGAH
FT                   IGHSTECYIIRQADHAWWHVAAALDLCHPETIGFAGPNLRVRPIGMQ"
FT   gene            272734..273420
FT                   /locus_tag="SMa0501"
FT   CDS_pept        272734..273420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0501"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to HisM, ABC-type amino acid transport
FT                   system, permease component, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64922"
FT                   /db_xref="GOA:Q930D4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D4"
FT                   /protein_id="AAK64922.1"
FT                   /translation="MDYTFQFGPLLNYLPQIVSGLWLTIGLSFVGIFGGIALGIFCAVM
FT                   STLSSPIPRLLVRLYVEVVRNTPLLVQIFVIFFGLPNIGIRLSPLTSVFIALVLNNGGY
FT                   VAEIVRGGIEATHRSQVEAAESLGLSYFQTLRYVILPPALEKVFTPVVSQCVLLMLSTS
FT                   LVSAIGVEDLTGAAMIASSETFRTMEIYLVVAMVYVVLNFVFRAVLNVAGLMIFTRSRR
FT                   RLLGRA"
FT   gene            273422..274078
FT                   /locus_tag="SMa0503"
FT   CDS_pept        273422..274078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0503"
FT                   /product="ABC transporter, permease"
FT                   /note="Binding-protein-dependent transport system inner
FT                   membrane component, His/Glu/Gln/Arg/opine family, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64923"
FT                   /db_xref="GOA:Q930D3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D3"
FT                   /protein_id="AAK64923.1"
FT                   /translation="MRTFGSPEFLFIVYALRWTLTLTVLAFVGGGIMGIVLALLRIARI
FT                   RAFSAITTFYMQVIQGLPLLVLLFLCYYAPSLFGIEIAALTAAAIALTINSSAFLGAIW
FT                   ESALRAIPKAQWESADALALTPYKTLRFVIAPQAIRLALPSTVGFLVQIIKQTSLASII
FT                   GFIEITRAGQLVSNATFEPLKAFLSVAALYFAVCFPLTQLSLWLERRTACRGART"
FT   gene            274136..274933
FT                   /locus_tag="SMa0506"
FT   CDS_pept        274136..274933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0506"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Belongs to pfam00497, SBP_bac_3, Bacterial
FT                   extracellular solute-binding proteins, family 3, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64924"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D2"
FT                   /protein_id="AAK64924.1"
FT                   /translation="MTMRLKSLLLPLVGLLAITVGAATASASSLDDIIARKKVMIGVDL
FT                   SVPPFGITNEEMQPDGLDVDVAKLLAKDLGVELELVPVTGQSRIPSLQTGKVDFVVASF
FT                   GIYTERALSVAFSNPYGGHRSIIIAPKEATIKSLADLAGKRVGVPRGTAHEKILSAANV
FT                   EGMELVRFDDDSTTLNALVSGQVDAIGTVNYIAAQLQERYPDRGFEEKTTYLQSFYGVG
FT                   LRRNDPDLLHWLNTVLFVHKQSGELGAIYEKWMKTPIPELPSF"
FT   gene            274983..275714
FT                   /locus_tag="SMa0508"
FT   CDS_pept        274983..275714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0508"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are
FT                   the ATP-binding components of the bacterial periplasmic
FT                   histidine and glutamine permeases, repectively; Histidine
FT                   permease is a multisubunit complex containing the HisQ and
FT                   HisM integral membrane subunits and two copies of HisP;
FT                   HisP has properties intermediate between those of integral
FT                   and peripheral membrane proteins and is accessible from
FT                   both sides of the membrane, presumably by its interaction
FT                   with HisQ and HisM; The two HisP subunits form a homodimer
FT                   within the complex; The domain structure of the amino acid
FT                   uptake systems is typical for prokaryote extracellular
FT                   solute binding protein-dependent uptake systems; All of the
FT                   amino acid uptake systems also have at least one and in a
FT                   few cases two extracellular solute binding proteins located
FT                   in the periplasm of Gram-negative bacteria or attached to
FT                   the cell membrane of Gram-positive bacteria, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64925"
FT                   /db_xref="GOA:Q930D1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D1"
FT                   /protein_id="AAK64925.1"
FT                   /translation="MSVVVAKNIRKSFGGLQVLKGVSLTVEGGEVVALIGGSGSGKSTF
FT                   LRCLNGLESVDSGEIEVAGHRMSRKPAELRRLRRDVGIVFQSYNLFPHLTAGENIMLAP
FT                   VQVKGIGKDAARSEAKRCLSLVGLGDRFEAYPDMLSGGQQQRVAIARSLAMQPKVLLFD
FT                   EVTSALDPELTGEVLAVIEKLARDGMTMILVTHEMGFARRVANRTIFMRDGIIHEEGPS
FT                   AEFFSSPKTPELRAFLHAEVG"
FT   gene            275787..276734
FT                   /locus_tag="SMa0510"
FT   CDS_pept        275787..276734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0510"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /note="Belongs to the D-isomer specific 2-hydroxyacid
FT                   dehydrogenase family; Pfam PF00389, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64926"
FT                   /db_xref="GOA:Q930D0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930D0"
FT                   /protein_id="AAK64926.1"
FT                   /translation="MPKIELLQVGPYPSWDEERLNANFTMHRYFEAADKAAFLAEHGAA
FT                   IRGIATRGELGANWAMIEALPRLEIISVYGVGYDAVDLAAARERGIRVTNTPDVLTKDV
FT                   ADLGVAMMLAHARGMIGGETWVKSGDWAKKGLYPLKRRVHGKRAGVLGLGRIGFEVAKR
FT                   LAGFDMEIAYSDTGAKDFARDWSFIADPVELAARSDFLFVTLAASAETRHIVGRRVIEA
FT                   LGPDGMLINISRASNIDEEALLDALESKVLGAAALDVFEGEPNLNPRFLALDNVLLQPH
FT                   MASGTAETRKAMGQLVFDNLSAHFGGRPLPTPVL"
FT   gene            276745..277776
FT                   /gene="idnD"
FT                   /locus_tag="SMa0512"
FT   CDS_pept        276745..277776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnD"
FT                   /locus_tag="SMa0512"
FT                   /product="IdnD L-idonate 5-dehydrogenase"
FT                   /note="pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64927"
FT                   /db_xref="GOA:Q930C9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C9"
FT                   /protein_id="AAK64927.1"
FT                   /translation="MKAIVIHTAKDLRVEECAVEKPGPGEVEIRLAAGGICGSDLHYYN
FT                   HGGFGTVRLKEPMILGHEVSGHVAALGEGVSDLAIGDLVAVSPSRPCGACDYCLKGLPN
FT                   HCFHMRFYGSAMPFPHIQGAFRERLVAKASQCVKAEGLSAGEAAMAEPLSVTLHATRRA
FT                   GEMLGKRVLVTGCGPIGTLSILAARRAGAAEIVAADLSERALGFARAVGADRTVNLSED
FT                   RDGLVPFSENKGTFDVLYECSGAQPALVAGIQALRPRGVIVQLGLGGDMALPMMAITAK
FT                   ELDLRGSFRFHEEFATAVKLMQGGLIDVKPLITHTLPLGEALKAFEIASDKGQSMKTQI
FT                   AFA"
FT   gene            277846..278601
FT                   /gene="idnO1"
FT                   /locus_tag="SMa0513"
FT   CDS_pept        277846..278601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnO1"
FT                   /locus_tag="SMa0513"
FT                   /product="IdnO1 gluconate 5-dehydrogenase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.69"
FT                   /note="FUNCTION: Involved in the nonphosphorylative,
FT                   ketogenic oxidation of glucose and oxidizes gluconate to 5-
FT                   ketogluconate; Dependent on NADP, almost inactive with NAD,
FT                   CATALYTIC ACTIVITY: D-gluconate + NAD(P)(+) = 5- dehydro-D-
FT                   gluconate + NAD(P)H, SUBUNIT: Homodimer, SUBCELLULAR
FT                   LOCATION: Cytoplasmic, SIMILARITY: Belongs to the
FT                   short-chain dehydrogenases/reductases (SDR) family.enase,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64928"
FT                   /db_xref="GOA:Q930C8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C8"
FT                   /protein_id="AAK64928.1"
FT                   /translation="MSTELFDLTGKRALVTGSSQGIGYALAKGLAATGAEIILNGRDAA
FT                   KLAAAARDLGAGHTLAFDATDHQAVRKAVDAFEADVGAIDILVNNAGMQHRTPLEDFPA
FT                   DAFERLLKTNVSSVFNVGQAVARHMIKRGAGKIINIASVQTALARPGIAPYTATKGAVG
FT                   NLTKGMATDWARYGLQCNAIAPGYFDTPLNAALVADPSFSDWLERRTPAGRWGKVEELV
FT                   GACIFLSSDASSFVNGHVLYVDGGITASL"
FT   gene            278603..279121
FT                   /gene="idnK"
FT                   /locus_tag="SMa0514"
FT   CDS_pept        278603..279121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnK"
FT                   /locus_tag="SMa0514"
FT                   /product="IdnK gluconate kinase IdnK"
FT                   /EC_number="2.7.1.12"
FT                   /note="Gluconate kinase catalyzes the phosphoryl transfer
FT                   from ATP to gluconate; The resulting product gluconate-6-
FT                   phoshate is an important precursor of gluconate metabolism;
FT                   GntK acts as a dimmer composed of two identical subunits,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64929"
FT                   /db_xref="GOA:Q930C7"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C7"
FT                   /protein_id="AAK64929.1"
FT                   /translation="MAPHSARRGIVLMGVAGCGKSAIGAALATRLGATYVDGDDLHPPE
FT                   NIARMSRGEPLTDDDRWPWLTLVGRRLAAPDGVLIIGCSALKRRYRDHIRNEAGAPVTF
FT                   VHLSGTKVLITARMGARAGHFMPVSLIESQFAALEPPTTDENVITVDIDQPLEVLVDEI
FT                   AVKLEETPS"
FT   gene            279118..280005
FT                   /locus_tag="SMa0516"
FT   CDS_pept        279118..280005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0516"
FT                   /product="dehydrogenase"
FT                   /note="best similarity to 3-hydroxyisobutyrate
FT                   dehydrogenase and related beta-hydroxyacid dehydrogenases,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64930"
FT                   /db_xref="GOA:Q930C6"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C6"
FT                   /protein_id="AAK64930.1"
FT                   /translation="MTNRVALIGAGAMGGSIGARLVETGNRLTVFDPGPDKVQALVDKG
FT                   AFAAPSAAEAAAVSDYVILSLNAPAIVRQAVFGDAGVAAGAQAGTLIIDMSSIDPNATK
FT                   QLAADAAEKGLRWVDSPLSGGAPKALIGELTLMAGGTAQDVKDAHAVLRHVASNYTHMG
FT                   SVGAGQTTKLINQVLCGLGFLAVAEATQLALDAGVDASKIPQALMGGRADSAILQEYMP
FT                   RFVTKDYRHTGRIDNMVKDLAGAQDLARRTNTAMPLTAACAEIHRMLTAAGLGGEDQAA
FT                   LMEFFRGPNKENFK"
FT   gene            280002..280334
FT                   /locus_tag="SMa0518"
FT   CDS_pept        280002..280334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64931"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C5"
FT                   /protein_id="AAK64931.1"
FT                   /translation="MITRYALFEGKVKDGHTEAFRKAVIERILPKWKQFPHATDVRISF
FT                   AESRDEGAPELSMILAINYPDLEAVEEALASPVRAEARAATEAVLAEFFEGRIHHHVMS
FT                   ASEFKL"
FT   gene            280693..281535
FT                   /locus_tag="SMa0520"
FT   CDS_pept        280693..281535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0520"
FT                   /product="Transcriptional regulator, RpiR family"
FT                   /note="Contains a helix-turn-helix domain, rpiR family.The
FT                   best characterised member of this family is RpiR, a
FT                   regulator of the expression of rpiB gene, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64932"
FT                   /db_xref="GOA:Q930C4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C4"
FT                   /protein_id="AAK64932.1"
FT                   /translation="MLIAERVQTIADTLTPAERRLVKEIIAKPRDVALGTAGELARRTG
FT                   VHEATASRLARKLGFETYAGFRHAIRDEFIVKTDPALRVRRTLETSRGHGMLEMLVQQE
FT                   IEALTRLSSYVDEERLAAAAAALSDRRRIFIFARGNAETLAVLMNRRLRRMAFETVLVC
FT                   GDSRDIAEQILSMGPDDALLVFAFRRQPRAYAPLIERAGKVGAVSVVVSGTVGPSLSPK
FT                   ADHLLAAPRAGDADAFQTLTVPMAICNGLILSMAQSDEVRSLSNLEQLGELIGELEGR"
FT   gene            281664..282392
FT                   /locus_tag="SMa0522"
FT   CDS_pept        281664..282392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0522"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="best similarity Fe3+ and thiamine transport systems,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64933"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C3"
FT                   /protein_id="AAK64933.1"
FT                   /translation="MKRMMMIGAVLVALAAPAMAQDVDTLSPEALLTLAQKEGKVTVYS
FT                   FTSRIARVEKAFEEAYPGIDLIGFDMSSTEMITRLRTEAAAGITNADVVYVSDAPVVLS
FT                   DLLETGLLKNYVPPRIADKLDTAFKSPLLAQRLSTKVLMYNEAAYPNGAPIKNLWDLTT
FT                   PEWKGKVLMVDPLQRGDYLDLMTEFVLRSDEMAKAYEALFRKPIELDDGVETAGHQFIV
FT                   DLFENDLVLLADGRCECGGW"
FT   gene            282373..282777
FT                   /locus_tag="SMa0523"
FT   CDS_pept        282373..282777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0523"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="best similarity to Fe3+ transport systems, possible
FT                   frameshift leading to truncated proteins (SMa0522 &
FT                   Sma0523), family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64934"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C2"
FT                   /protein_id="AAK64934.1"
FT                   /translation="MNAAVGKLGQDQPPVGFTSYSDRRDNEDEGWALQVVNDVVPSNGI
FT                   VFPALLALTADTKNPAASRLAIDFLMGDDSETGGPGYAPFYVAGDWPTRSDIKGHPDAI
FT                   PLADFKAWRVDPAATATIRKSVGDLVLQLQ"
FT   gene            282774..284579
FT                   /locus_tag="SMa0525"
FT   CDS_pept        282774..284579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0525"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to those transporting ferric (Fe3+)
FT                   iron, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64935"
FT                   /db_xref="GOA:Q930C1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C1"
FT                   /protein_id="AAK64935.1"
FT                   /translation="MIRVPPSPSGRGASALSDILMSTQSRNRSFKDAFLSPGLGLKAAV
FT                   LVLLTALVAAPLLKVFGATLAPGAWSAWSDVLASNLSRNLFWLPLANTMILGAGVATGC
FT                   VLVGGFLAWLVVMTDVPFRRTIGLLATLPFMIPSFATALAWGSLFRNARVGGQIGFLEG
FT                   LGFSVPDWLAWGMVPTLVVLMAHYYSLAFTVIAAALATVNSDLVEAAQMTGAGRRRIFL
FT                   GIVLPVALPALVAGASLTFAGAVSNFAAPALLGLPVRMQTLATRLYGMIEIGQAERGYV
FT                   LAILLILVSAFFLWAGNRVISGRRSYATITGKGGRSKRFALGTARLPLFVAAASICVLT
FT                   TVVPVVILIASSLAPSSSALFSDWSLHYWIGASDPAIARGQAGIWNNPLILSATGVTVG
FT                   LGVTVAFSASLVGLLVAFVLARSRSGFLSAAINQISFLPLLVPGIAFGAAYVALLGAPI
FT                   GPLPALYGTFLLLVIAATAYLVPFAVQTGRAVIQQVSGDLDESARMTGAGFLRRLFAIT
FT                   VPLAIRGLSAGALIVFVKIVRDLSLVVLLFTPTMPLLSVLAYRYASDGFTQFANALTVV
FT                   VLVISVAATLFANRLQAKSQPWLQS"
FT   gene            284576..285622
FT                   /locus_tag="SMa0526"
FT   CDS_pept        284576..285622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0526"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Most similar to the cd03259, ABC_Solutes_Sugar
FT                   family; This family comprised of systems involved in the
FT                   transport of apparently unrelated solutes and systems
FT                   specific for di- and oligosaccharides and polyols, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64936"
FT                   /db_xref="GOA:Q930C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q930C0"
FT                   /protein_id="AAK64936.1"
FT                   /translation="MIQIESLHKQFGSYEAVQGVSLSVPKGAFLVLVGPSGCGKSTILR
FT                   MLAGLEAPTSGTITFGGNTVSDGGRGWVIEPSRRDTGLVFQSYALWPHMTVAGNIDWPL
FT                   KVAGLDRDKRCSRVGEVLDLLGIGQLAARYPNEISGGQQQRVAIARMIAPKPGILLFDE
FT                   PLSNLDAKLRVEMRTELLRVHRATGATSVYVTHDQVEAMTMATHVAVMNAGRIEQFGSP
FT                   GELVARPRTAFVATFVGTPPANLVPVVNGAYCGRLADAALAGRNGSAMFRPEELTLAES
FT                   PSDRTLTLDYAEASPMAGRVMVTGIRADLRLTAIVDSLPSFSVGHEVHFQLPPAPSMFF
FT                   TPEGVRAQ"
FT   gene            285619..286218
FT                   /locus_tag="SMa0527"
FT   CDS_pept        285619..286218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0527"
FT                   /product="phosphatase"
FT                   /note="Phosphoglycerate mutase family protein; Most similar
FT                   to GpmB, Fructose-2,6-bisphosphatase; Lesser similarity to
FT                   GpmA, Phosphoglycerate mutase, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64937"
FT                   /db_xref="GOA:Q930B9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B9"
FT                   /protein_id="AAK64937.1"
FT                   /translation="MKRIILVRHGESAWNSVRRLQGQADIGLSARGEAQATALRATIEA
FT                   MRPDHVIASDLLRARHTAALLGYPHAQLSPALREIDVGDWTGRAIGDLMAEDQDAYLGW
FT                   RAGTYAPRGGERWQEFRDRVTAGLGKAVSIPGERLLVVCHGGVIRALLDGLLGLPPKRI
FT                   IPVGPASVTVLADKPGGMRLETFNFSPDGPVFDAPD"
FT   gene            complement(286919..287350)
FT                   /locus_tag="SMa5025"
FT   CDS_pept        complement(286919..287350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5025"
FT                   /product="hypothetical protein"
FT                   /note="Has weak, possibly spurious, similarity to the SAM-
FT                   binding domain found in methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5025"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07971"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX3"
FT                   /protein_id="ACF07971.1"
FT                   /translation="MAKDLSPRLLAIVDALPLRRGMRVLEIGCGPGAMAREIAGRIGDG
FT                   HVLAIDRSAKAIAQAQAASQAEIGSGRLSLRQVAAEDFELEAGEMPYDIAVAVRVGALD
FT                   GRHPEAGRRAKRRVAAALTPQGQLLIDGGDPLRRLLLDD"
FT   gene            complement(287402..287641)
FT                   /locus_tag="SMa0535"
FT   CDS_pept        complement(287402..287641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0535"
FT                   /product="hypothetical protein"
FT                   /note="Miscellaneous; Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64938"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B8"
FT                   /protein_id="AAK64938.2"
FT                   /translation="MQAAHLVARFESGKTCDQIAPRVKAIPFVTRIDSLAGEIDLLVSV
FT                   DADSIDSVEDVRRQVASVPGIATVTTALVLRRHL"
FT   gene            287923..288336
FT                   /locus_tag="SMa0537"
FT   CDS_pept        287923..288336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64939"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B7"
FT                   /protein_id="AAK64939.1"
FT                   /translation="MTHTKAPITAEDTIRSWAGAVAACDIEAVCYADPLLVFDVVGQLQ
FT                   REGKALYRRAWEDEFFPWHGGTGKFALRELSVHAGGDIAFATGLLDCGGTEGGRPAEYT
FT                   LRLTLGLAKTPNGWYIVHEHSSEPTSFNEKVVG"
FT   gene            288341..288703
FT                   /locus_tag="SMa0538"
FT   CDS_pept        288341..288703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64940"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B6"
FT                   /protein_id="AAK64940.1"
FT                   /translation="MALLDEILEIERRLWRNDADVYAATYLPQAVLIFPGIGRIDLDTA
FT                   VEAIRGENAAGRHWAEVSFSAETAVEVAAGTCLVAYHADARWNDQPTAEAVDCLTVYVK
FT                   RDGRWRVAAHQQTASA"
FT   gene            289833..290228
FT                   /locus_tag="SMa0541"
FT   CDS_pept        289833..290228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has similarity to a PRC-barrel domain; The PRC-
FT                   barrel is an all beta barrel domain found in photosystem
FT                   reaction centre subunit H of the purple bacteria and RNA
FT                   metabolism proteins of the RimM group; PRC-barrels are
FT                   approximately 80 residues long, and found widely
FT                   represented in bacteria, archaea and plants; This domain is
FT                   also present at the carboxyl terminus of the pan- bacterial
FT                   protein RimM, which is involved in ribosomal maturation and
FT                   processing of 16S rRNA; A family of small proteins
FT                   conserved in all known euryarchaea are composed entirely of
FT                   a single stand-alone copy of the domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64941"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B5"
FT                   /protein_id="AAK64941.2"
FT                   /translation="MRRILIALAATTTIVGAAAAQTAETTTTETFVTAKPTDVLSYNLI
FT                   NLNVTNTANESIGEIKDLVLSEGQLAGYILSVGGVLGMGERYVVVSPKALKITYVENDK
FT                   KWTAVMDATKDQLKAAPEFKYEGRWKR"
FT   gene            290367..290957
FT                   /locus_tag="SMa0543"
FT   CDS_pept        290367..290957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64942"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B4"
FT                   /protein_id="AAK64942.1"
FT                   /translation="MVAVALLMPGTDEDATETATPPATTTEPTTPQPSTSAPPPTTEPA
FT                   PTTPRRNHQPLSRPTRSPRSRLTHGSDRRSLLLDRRNVRDASRDRRARRPSRFGCQRRN
FT                   NNVSSRACGSQMATQDKRGGNGRNAGNGSYLRRTSSTLSIESASTLTSRSISPARESIR
FT                   VTNGTAPYLRGRFLSISPHQAAFDAVEDFPHNL"
FT   gene            complement(291198..291638)
FT                   /locus_tag="SMa0545"
FT   CDS_pept        complement(291198..291638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted nucleic acid-binding protein, contains PIN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64943"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B3"
FT                   /protein_id="AAK64943.1"
FT                   /translation="METLVADASIAIKWVVEEEGTDSAVELRSRFRFAAPELLIPECAN
FT                   ILWKKVQRGELSRDEAVLAAKLLERSGIDFVSMTGLLEEATNLSIVLSHPAYDCTYLIA
FT                   AQRTGSRFVTADMRLLRIVSERAPGEIARLCVSLPDARNDAH"
FT   gene            complement(291638..291877)
FT                   /locus_tag="SMa0548"
FT   CDS_pept        complement(291638..291877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64944"
FT                   /db_xref="GOA:Q930B2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B2"
FT                   /protein_id="AAK64944.1"
FT                   /translation="MPGNLHVRNLDDDLISKLKIRAARHGRSAEAEHREILRQALASEG
FT                   GPDFEELAADLRKLTASRKQTPSEVLLRESRDER"
FT   gene            292217..293509
FT                   /locus_tag="SMa0551"
FT   CDS_pept        292217..293509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0551"
FT                   /product="hydrolase"
FT                   /note="belongs to superfamily of metal dependent
FT                   hydrolases, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64945"
FT                   /db_xref="GOA:Q930B1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B1"
FT                   /protein_id="AAK64945.2"
FT                   /translation="MGMALIGPGFIDLDALSDIDTGVLGLDHQPGWKKGRVWPRDYVEE
FT                   GPVEMLTPEELAFQKRYAFAHLIRNGITTALPIASLFYRAWNETPEEFASAAESAADLG
FT                   LRVYLGPAFRAGHSVIEADGTLTVEIDAARGRAGLDAAIAFCAAHDNTHGGLVRAMLAP
FT                   DRVEYWTADLLKRTAGVARDLGVPVRLHCCQSTFEVETIRRSFGTGSAEWRHDIGFLSE
FT                   RALLPHGTHTDREGLRIIADSGATVVHCPLVMARHGAALNHFGDLRRAGLRLGMGTDTW
FT                   PPDMILNMQIGLMLGRVMGGELDSPSSADLYDVATLGGADARGRPDLGRLQAGAAADIV
FT                   VIDLAAHHLGQVRDPIAGLVASANGRDVRTVFIAGRRVMSEGTIPGFDFAEAHARAGAQ
FT                   FERLVAQYPRRTWRHPAVQSIFPPSYEVTRT"
FT   gene            293602..294093
FT                   /locus_tag="SMa0552"
FT   CDS_pept        293602..294093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0552"
FT                   /product="putative cyclic amidohydrolase"
FT                   /note="has similarity to dihydroorotase over about 50% of
FT                   its length; possible frameshift, conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64946"
FT                   /db_xref="GOA:Q930B0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q930B0"
FT                   /protein_id="AAK64946.2"
FT                   /translation="MCDLFVRNATVVTEERTFDGGISVSNGRIDELVVGQRDIAAARQI
FT                   IDASGLLLLPGLVDAHVHFSEPGRGHWEGFETGSRAAAAGGITTFVEMPLNAQPATIDA
FT                   AALVMKKAAAKQSHIDYALWGGLVDDNLDDLADLRRGGVVGFYRERHCRGGGRGLAGAT
FT                   "
FT   gene            294071..294868
FT                   /locus_tag="SMa0554"
FT   CDS_pept        294071..294868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64947"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A9"
FT                   /protein_id="AAK64947.1"
FT                   /translation="MVWREQLDLLLGALSALHIGGLQAEGAEIWRDPEGQFVWELLCHP
FT                   AVIAYYERHYPFAPPLLLRAAGDRRLPDTYRSQWQAELEQEGFDAAYRQFLHLNARFIS
FT                   NDVIGYFIELLDGFYVFDTHIDEFRRELEQPARLGGWLTRPDRWQLLEGMASFYEFALD
FT                   LDQYLAALEFPMLRGHVWLHFAYWFGNGGARMEEVALWLQNAVAHAAEDESIDGAELGE
FT                   ALARLRAPQRYPLVLIEQTAEVLGPWLESSGVGEQLSAGSRSL"
FT   gene            complement(295587..296474)
FT                   /locus_tag="SMa0557"
FT   CDS_pept        complement(295587..296474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0557"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Contains LysR-type HTH and substrate binding domain,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64948"
FT                   /db_xref="GOA:Q930A8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A8"
FT                   /protein_id="AAK64948.1"
FT                   /translation="MQREELGDLLAFLAVAEEESFTKAAARLGTSQSSLSLIIKRLEAR
FT                   LGVRLLTRTTRSVAPTEAGEQLFSTLAPAFGTIEAQLSALSEFRDKPAGNFRITAGQHS
FT                   IDTILWPKLSAFLLAYPDIKVELVAESALTDIVAERFDAGVRLGDQVEKDMIAVRIGPP
FT                   ARMIVVGAPSCLRDRPPPKTPQELTTHRCINLRLPSYGGFYAWEFERDGHEVRVRVDGQ
FT                   VAFNGVPQIVKAALDGFGLTYVHEDVVREYLKNGRLVQILDDWTPPFPGYHLYYPSRRH
FT                   PSPAFTLLVEALKE"
FT   gene            296598..296990
FT                   /locus_tag="SMa0558"
FT   CDS_pept        296598..296990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64949"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A7"
FT                   /protein_id="AAK64949.2"
FT                   /translation="MGLKRLLIIAASIIAPLPVQQVVAQEAKGPVIRIAELEIDPAQMA
FT                   AYSAAVKEEMEESMRVEPGVLALYAVSIKGQSHHLRFFEMYADQAAYESHRESPHFRKY
FT                   VETTKDMITSRKLLETDNFQLSAKLR"
FT   gene            297048..297791
FT                   /locus_tag="SMa0559"
FT   CDS_pept        297048..297791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0559"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /note="parital similarity to members of the
FT                   carboxymuconolactone decarboxylase family, conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64950"
FT                   /db_xref="GOA:Q930A6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="PDB:4G9Q"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A6"
FT                   /protein_id="AAK64950.2"
FT                   /translation="MMTTSNAGAQQPNVEGRRFSPDQVRSVAPALEQYTQQRLYGDVWQ
FT                   RPGLNRRDRSLVTIAALIARGEAPALTYYADQALENGVKPSEISETITHLAYYSGWGKA
FT                   MATVGPVSEAFAKRGIGQDQLAAVESTPLPLDEEAEAQRATTVGNQFGSVAPGLVQYTT
FT                   DYLFRDLWLRPDLAPRDRSLVTIAALISVGQVEQITFHLNKALDNGLSEEQAAEVITHL
FT                   AFYAGWPNAMSALPVAKAVFEKRRG"
FT   gene            297935..298318
FT                   /locus_tag="SMa0561"
FT   CDS_pept        297935..298318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64951"
FT                   /db_xref="InterPro:IPR016888"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A5"
FT                   /protein_id="AAK64951.1"
FT                   /translation="MLPMNIWPTDELRQIAESDDLHIAPFRENGRTYGTLTWIWSVVVD
FT                   GELYVRGYNGQQSRWYQAAIRQKAGRITAAGMTKEVSFEPVEGAINDQIDEGYRRKYAT
FT                   SRYLAPMIGERARAATVKITPKD"
FT   gene            298329..299318
FT                   /locus_tag="SMa0563"
FT   CDS_pept        298329..299318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0563"
FT                   /product="aldo/keto reductase"
FT                   /note="Similar to Tas, Predicted oxidoreductases (related
FT                   to aryl-alcohol dehydrogenases), family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64952"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A4"
FT                   /protein_id="AAK64952.1"
FT                   /translation="MQKRKLGQGLEVSALSLGCMGYGKARDIPDRPQMIELLRRAVDLG
FT                   MDFFDTAEVYGPWTNEEMVGEAFAGMRDKVKIATKFGWDIDQSTGEHGGGVNSKPTQIR
FT                   SAVEGSLKRLRTDFIDLLYQHRVDPDVPMEDVAGTVKDLIAEGKVRYFGLSEAGAESIR
FT                   RAHAVQPVAALQSEYSLWTREPEAEIIPTLEELGIGLVPFSPLGKGFLAGKIDASTAFA
FT                   ANDFRSQIPRFAPEAREANQALVDLIRSVGERRSATPAQVALAWLMAQKPWIVPLFGTR
FT                   KLERLEENLGALSVTLSDDDLEQIESGAAAIRIEGARYPEEMLRRSGR"
FT   gene            299384..300487
FT                   /locus_tag="SMa0564"
FT   CDS_pept        299384..300487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0564"
FT                   /product="dehydrogenase"
FT                   /note="similarity to glucose/sorbosone dehydrogenase,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64953"
FT                   /db_xref="GOA:Q930A3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A3"
FT                   /protein_id="AAK64953.2"
FT                   /translation="MPILPEKRRTRMRKRLICTTLSILVGGCCLSGTSMAQDASTPILD
FT                   RGEGAWSSSVLADGLDYPWDIVRDGERLILTEKAGTVVIIEGGNVQRSTLQTSDPLRTE
FT                   GGAGLLGIALAPDFADSGQAFFYYSYSSGSEPANRIVAARFDGNTWRETAVLVDAIPGH
FT                   RLYNGGRIAIGPDDHLYVTTGWTENYERPQDLQSLAGKVLRLTLAGGVPEDNPFQGSLV
FT                   YSFGHRNPQGLAWNAEGELFVSEHGQAALDEINLIAPGANYGWPIISGDETQEGMQPPF
FT                   VHSGGDTWAPSGIAFAGNELLVTALQGRGLYVLDRQARTLQPVVSLGERVRHVLPVGDD
FT                   LLLITTNRSPRGQGPSKDRLVRLSAQN"
FT   gene            300571..301050
FT                   /locus_tag="SMa5026"
FT   CDS_pept        300571..301050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5026"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein, contains double-
FT                   stranded beta-helix domain [Function unknown]; Weak
FT                   similarity to cupin"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07972"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX4"
FT                   /protein_id="ACF07972.1"
FT                   /translation="MKKLIAAASLVILSTAIARAQTIEITPNASAPSALGDAKLFSGHV
FT                   VVASLFPANEFTHGTGGHVTFAPGARTAWHTHPAGQMLIVTSGKGWVQQEGGEKREINS
FT                   GDVVWIPVGVNHWHGATNKTGMGHIAISYMKEGKNVEWGKLVTDEEFVGQVPPRD"
FT   gene            301204..301761
FT                   /locus_tag="SMa0567"
FT   CDS_pept        301204..301761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0567"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to the carboxy terminus of Acs, Acyl-
FT                   coenzyme A synthetases/AMP-(fatty) acid ligases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64955"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A1"
FT                   /protein_id="AAK64955.1"
FT                   /translation="MRSSLRGLSINSFFETTSYLEFRSSYSDESARIDQVAEPAFDVSQ
FT                   HGGIVIHGRSDATLNPGGVRIGTAEIYSQVEQLHEVAESLCIGQDWDDDIRVILFVLLR
FT                   DGFDLTEELQAKIKAKIRTGASPRHVPTKIVQVSDIPRTKSGKIVELAVRDVDHGRPVV
FT                   NKEVLANPEALDQFVAMVELSV"
FT   gene            complement(301877..303766)
FT                   /gene="cyaF4"
FT                   /locus_tag="SMa0570"
FT   CDS_pept        complement(301877..303766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaF4"
FT                   /locus_tag="SMa0570"
FT                   /product="CyaF4 adenylate cyclase"
FT                   /note="CATALYTIC ACTIVITY: ATP = 3',5'-cyclic AMP +
FT                   diphosphate, SIMILARITY: Belongs to the adenylyl cyclase
FT                   class-3 family, SIMILARITY: Contains TPR repeats, function
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64956"
FT                   /db_xref="GOA:Q930A0"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q930A0"
FT                   /protein_id="AAK64956.1"
FT                   /translation="MERKLCAILAADVVGYSALMERDEAGTFERLHAGRKELFEPEIAR
FT                   HHGKVFKLMGDGLLAEFGSVVDAVECAVSLQRGLTERNAAVPHDQRIRVRIGINLGEVI
FT                   VEREDRYGEGVNVAARLQQLAEPGGICVSGKVAREVEKKLAFGFEPMGEQKVKNIIEPV
FT                   QAFRIIIEWQARRRPVIRFQRYWVGTGTAVLALLLVLAGAAWQFWPTATVSGKPSVAVL
FT                   PFDNYGGDEASGRLADGLTEDIITDLARFPEFKVIARNSTETYKGKAIDVREIGKALDV
FT                   GFVVEGSIAREADRVRVTAQLIDSKQGRHLWSQRWDRPDKEVFVIQAEIAEQIANRLGG
FT                   GAGLVQESGRIAAHRKVPGNLNAYELYLLGTERLEQLDQANLEAALSLLTQAVQSDPGL
FT                   ARGWVELFHTHDLLAGLGIEPERNRALADAAAERALTLDPSDPEAHAVYGSSLGMRGDF
FT                   ARAEAEYEAALRMAPNAAEILIFYIGWASTFGKPERGADLVERAIQLDPNYPGWANRPF
FT                   GLAYFMAGRYPEAVTMFERLGIERHNRWSWAAHAGALAAAERRTEAAALVARAMAAHPD
FT                   LSIELIANEPGWSDAERRRFINTMRLAGFPACTKPEVLAKIEKPLRLPECASL"
FT   gene            304557..304880
FT                   /locus_tag="SMa0572"
FT   CDS_pept        304557..304880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64957"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ9"
FT                   /protein_id="AAK64957.1"
FT                   /translation="MKTIIPRQLARSDVEAAIDYYAREAGTEVTHGFIGALQAAYASIA
FT                   SHPEAGSLRYAYELGLPDLRSVSLKRYPYLIFYRDQPDHVDVWRVLHAKRDNPQWMQEP
FT                   NNH"
FT   gene            complement(305128..305841)
FT                   /locus_tag="SMa0574"
FT   CDS_pept        complement(305128..305841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64958"
FT                   /db_xref="GOA:Q92ZZ8"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ8"
FT                   /protein_id="AAK64958.2"
FT                   /translation="MIVQACLNGARPSDYHPRLPLTADAIALDGAACISAGAAELHIHP
FT                   RGPDGRESLLAVDEAIYAVRRACPGSLVGVSTGAWIERDEKQTRDCISAWRQLPDYASV
FT                   NISERDAPAVIALLHRMGVGVEAGLATVADAERFVTLPDCHRAFRILIEIEEQDLGKAD
FT                   AIADGIAQVLERANILRPVLLHGLDATAWHFVNRAHQRRWSTRVGLEDGCQLTNGEIAG
FT                   GNADLVADALQIFRS"
FT   gene            305892..306179
FT                   /locus_tag="SMa0575"
FT   CDS_pept        305892..306179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64959"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ7"
FT                   /protein_id="AAK64959.2"
FT                   /translation="MGSFEPLIAPIADDHLRAKGAVRHEPCARLVARMFTFWAKKIAYC
FT                   IAWNSGLLVELRRVVGAVPKAPTTLITEPPPLSHRSTLIGQEPDPATRFA"
FT   gene            306248..307339
FT                   /locus_tag="SMa0576"
FT   CDS_pept        306248..307339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0576"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Best similarity to LivK, ABC-type branched-chain
FT                   amino acid transport systems, periplasmic component,
FT                   specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64960"
FT                   /db_xref="GOA:Q92ZZ6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ6"
FT                   /protein_id="AAK64960.1"
FT                   /translation="MRHLFTAAALAFALASQSEAEVLIGVAGPMSGKLAWTGTQLRRGA
FT                   EMAVANINAAGGVLGQQVRLIVADDFCDPRQALAAAEKLVADGAVFVIGHYCSGASIPA
FT                   SKIYAAAGVLQISPSSTNPMLTEQGHANVFRVCSRDDAQGHKAGNYLADHWGDSKIAIL
FT                   HDNTTYGKGLADETKKQLNMRGVTEAVYQSYTPGKDDYSVEVAALQTAHIAVLYLGGYH
FT                   TEAALMVRAARDRAYPVQLISGDDTATEAFGLIAGPAAEGTLFTFVADPRRNAEAAEVV
FT                   ERFRAENFEPDSWTLHSYGAAEIWAQAVTKANSLDLQAVIAALREDQFDTVLGRIDFDK
FT                   KGDLTVQSWVWYVWKSGEYVPVE"
FT   gene            307530..309989
FT                   /gene="cyaN"
FT                   /locus_tag="SMa0579"
FT   CDS_pept        307530..309989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaN"
FT                   /locus_tag="SMa0579"
FT                   /product="adenylate/guanylate cyclase"
FT                   /function="Adenylate cyclase, family 3 (some proteins
FT                   contain HAMP domain)"
FT                   /note="Carboxy-terminus contains a cyclase catalytic domain
FT                   and is most similar to those found in CyaA, family 3-type
FT                   cyclases; Also contains a HAMP domain (found in Histidine
FT                   kinases, Adenylyl cyclases, Methyl binding proteins,
FT                   Phosphatases); Similar across all thing to Rhizobium etli
FT                   cyclase accession #YP_470453, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64961"
FT                   /db_xref="GOA:Q92ZZ5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR038188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ5"
FT                   /protein_id="AAK64961.2"
FT                   /translation="MFDRLGVRGRLLFAFFGISAFAVLATVGALYAFLELSQVLERVTE
FT                   RRAPSALASLELSRHAERVAATAPAFLASTSRARHSEVSAAIGSEMARLEELLAALKGA
FT                   TLSSGVVSEIEDAVVGLRRNLHALDDLVTVRLAAVARKEELLRRLSATTNASQRLVAPG
FT                   ILVMNSKVPRWRAATADAVTTPEAEAAATRDLARAIAAYIPQQTAQREIAAINDTLLQA
FT                   AVAPTPGDLSLISFPLRRSIETLESVTPEFDEQLRKRFQQLVDQFEALIDGQRSIPNAR
FT                   NEELAVVAEGEKLVVENDKLSRKLTLAVDRLVAAAKGDIAEAGSEAATVRRYGTGVVLG
FT                   SALLSLLSSVLIVWLYVDRNLLARLTGLSHSMLAIAAGDLRVPLPQTRGDEIGRMAKAL
FT                   RVFRDTAIEVEEKNLRTVAEARQRLIDAIESISEGFAFYDSEDRLLVCNSRYRDILYPG
FT                   MDDTVVSGTHFEAIIRAAAERGLIEDAIGREQEWLAERLEAHRNPTGTLLQQRGPDRWI
FT                   QISERRISGGGTVAVYSDITELKRREQDLSEKSVALEALSAKLAKYLAPQVYNSIFSGK
FT                   QDVRIESRRKKLTICFSDIAAFTETTDKMESEELTQLLNQYLTEMSKIALSFGATIDKY
FT                   VGDAILMFFGDPETRGIREDAIACVSMALAMQERMGELGETWRSVGIEMPLRCRIGIHT
FT                   DYCTVGNFGSEDRMDYTIIGGAVNLAARLEEEAAPGSVLISYETFAQVKDLIHCEETGR
FT                   VQIRGIAYPVATYRVVDFKANLTKSCNAIRTELPHLRLEAEPELMSTGEREVAITALRE
FT                   TLDRLRR"
FT   gene            complement(310425..311225)
FT                   /gene="nrtC"
FT                   /locus_tag="SMa0581"
FT   CDS_pept        complement(310425..311225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtC"
FT                   /locus_tag="SMa0581"
FT                   /product="Nitrate transporter, ATP binding protein"
FT                   /note="Belongs to the TauB, ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system family,
FT                   ATPase component, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64963"
FT                   /db_xref="GOA:Q92ZZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ3"
FT                   /protein_id="AAK64963.1"
FT                   /translation="MTKSYLSLELLDKSFERGGTRTEVLKQVSLTVDKGEFISIIGHSG
FT                   CGKSTLLNIVGGLTQATTGVVLLDGKVVDEPGPDRAVVFQNHSLLPWLTVYENVRLAVD
FT                   KVFSRTRNKQERHEWTMRNLELVQMAHAAEKHPSEVSGGMKQRVGIARALAMEPKVLLL
FT                   DEPFGALDALTRAHLQDQVMQIHATLGNTVLMITHDVDEAVLLSDRIVMMTNGPSARVG
FT                   EILDVPLARPRRRIELASDRTYLTCRESVLKFLYERHRFVEAAE"
FT   gene            complement(311239..312132)
FT                   /gene="nrtB"
FT                   /locus_tag="SMa0583"
FT   CDS_pept        complement(311239..312132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtB"
FT                   /locus_tag="SMa0583"
FT                   /product="Nitrate transporter, permease"
FT                   /note="Belongs to the TauC, ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system family,
FT                   permease component, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64964"
FT                   /db_xref="GOA:Q92ZZ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ2"
FT                   /protein_id="AAK64964.1"
FT                   /translation="MSVTNLKLKPQATPQTAAQVIALGQTASRGIDGRLSRFVTQTVTN
FT                   LLPLLVTLTFFTLAWQLICSSPESSLPAPSRVLEESWELIAHPFYIGQGVDQGLFWHVF
FT                   ASLQRVALGYAMAAAVGVALGTLVGQSALAMRGLDPIFQVLRTVPPLAWLPLSLAAFQD
FT                   GTPSAIFVIFITAIWPIIINTAVGIRNIPQDYQNVAKVLRLNSFEYFGKIMLPAAAPYI
FT                   FTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSLISDIIVALIYVGIVGFLLDR
FT                   LIALVGRAVTRGTANA"
FT   gene            complement(312195..313487)
FT                   /gene="nrtA"
FT                   /locus_tag="SMa0585"
FT   CDS_pept        complement(312195..313487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtA"
FT                   /locus_tag="SMa0585"
FT                   /product="Nitrate transporter, periplasmic nitrate binding
FT                   protein"
FT                   /note="Belongs to the TauA, ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems family,
FT                   periplasmic components, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64965"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ1"
FT                   /protein_id="AAK64965.1"
FT                   /translation="MTKTLFGGLTRRSVLKTTATAAMVGAARTLLPSGAFAQGAGPETA
FT                   KATLGFIALTDSAPLIIAKEKGLFDKYGMTEVEVVKQASWGTTRDNLVLGSAGAGIDGA
FT                   HILTPMPYLISTGKVTQNNQPLPMAILARLNLDAQAISVGAAYADLKVGIDASVLKDAF
FT                   AKKKAGGEAAKVAMTFPGGTHDLWIRYWLAAAGIDPDKDVETIVVPPPQMVANMKVGTM
FT                   DCFCVGEPWNEQLVNQKIGYTAVNTAEIWAEHPEKSFAMRADWVEKNPRAVKALVMAIE
FT                   EAAQWCDDMANKDELAKIVGKRSWFNVPPKDIVDRLKGEYDYGNGKIVENSPHFMKFWR
FT                   EHASYPFQSHDAWFLTENIRWGKLASDTDIKGLIAKVNREDIWREAAKDLGISDIPAST
FT                   SRGPETFFDGKVFDPANPETYLKSLAISRIA"
FT   gene            314305..314763
FT                   /locus_tag="SMa0590"
FT   CDS_pept        314305..314763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64966"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZZ0"
FT                   /protein_id="AAK64966.1"
FT                   /translation="MICGPYHDSVRFAANCAAGCLSYLSDTRGRFGRLPGEAGAQFVAR
FT                   HVVSPAREGGTDDGRGGSGYHAPTPNPRILASQTQAQDQSDHRQERTDSLSRHRSRQSG
FT                   RQRAAFALTGAPHPSMARRRGRRAPTAAMRAVKTYPRPRPGVCAIWPS"
FT   repeat_region   314549..314988
FT                   /rpt_family="ISRm17"
FT                   /note="SMa4002; predicted by homology, possible ISRm17
FT                   fragment, 92% identical over length to ISRm17"
FT   gene            314792..314986
FT                   /locus_tag="SMa0591"
FT   CDS_pept        314792..314986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0591"
FT                   /product="transposase, fragment"
FT                   /note="partial similarity to transposase of ISRm17,
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64967"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY9"
FT                   /protein_id="AAK64967.1"
FT                   /translation="MVRSRWVYRKLRNFRAGIEAGISGLTRTYGLAHCTWRGLHHFETY
FT                   VSSSVVAYNLALFARLRPT"
FT   gene            315280..316452
FT                   /locus_tag="SMa0592"
FT   CDS_pept        315280..316452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has weak similarity to HipA of E; coli; In E; coli,
FT                   HipA is the toxin module of the HipBA toxin-antitoxin pair;
FT                   deletion of the hipBA module produces a sharp decrease in
FT                   persisters in both stationary and biofilm cells; Similarity
FT                   may be spurious as S; meliloti does not appear to encode a
FT                   protein with similarity to HipB"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64968"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY8"
FT                   /protein_id="AAK64968.1"
FT                   /translation="MALRSANILFKDETAGTLVETANGGTRFAYHSDWNEGNIACCFPS
FT                   TQREHEWKVGLHPFFQHLGPEGWLREQQARSAHIVEEDDLGLLLRYGADCIGAVSIRPP
FT                   DDAAQLPEITEATVSPGRTVSGVQKKLLVTKDDENRFVPASATGSALYIAKFNSDRIDN
FT                   LVRNELLSLRWTAAVLGEREVTGFTASLTAVVDETALIVTRFDRRPNGEKLRLEDCAQI
FT                   LSKPKGQDYAGKYDAAYEDIAAIIRQHSSRAPIDLLRFFNRLIVFTLIGNCDAHLKNFS
FT                   LLETPTGLRLSPAYDVVNTAFYDGFDQTLALSIGGEKIHLEAANQAIFRAFGKEIGLPD
FT                   RAIDQTFKQLKRQVEKAASIIRPPDAEPADGFVHRFKEIVDNSCLRILET"
FT   gene            316428..317459
FT                   /locus_tag="SMa0594"
FT   CDS_pept        316428..317459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains region with weak similarity to a helix-
FT                   turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64969"
FT                   /db_xref="GOA:Q92ZY7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY7"
FT                   /protein_id="AAK64969.1"
FT                   /translation="MPENTGNIAPLAWQRYVEEALRRRKAEGLTQKHHSALAGVSHPTM
FT                   AAFERGETTLTLAKALDILRVVGLVDEPTEGDTQARFVRDAFERWRNLVAPLPQDSPAR
FT                   FPNGWYRFDYWLEGDLKMSELTAFERILEKAVVRKTGWPPFWLPTREAIQPREVDGLIE
FT                   CWLAPQGEEVERGFNDPAHCDFWRAAPSGRMFLIRGYQEDGAETFPAGTILDTTLPLWR
FT                   MGEVLLHAEKLASLLRKDADTAVTVHFRAMFTGLRGRVLRSWANPLSDLLVEGHGARSD
FT                   EAVLEAKFSANDIESRLAECMLPLLTSLYERFGVAGLSLNRVEAEVQRLLNSPISKERR
FT                   PRR"
FT   gene            complement(318078..319409)
FT                   /locus_tag="SMa0599"
FT   CDS_pept        complement(318078..319409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64971"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY5"
FT                   /protein_id="AAK64971.2"
FT                   /translation="MGKQVTGHNRCTIHSGLFRPLQSIVVCGMLVVVAGCGGHPKGVLT
FT                   PVADSMPATSRVEMLITTTRGRSEVPGEMFTGERARAPAFANITVSIPPVRKVGEVAWP
FT                   KKLPSNPATDFATLKADDLTRDGAKTWLNTTVSKSPDRSVLVFVHGFNNRFEDSVYRFA
FT                   QIVHDSGIKSAPVLVTWPSRGSLLAYGYDRESTNYTRNALESLFQYLAEDGEVKEVSIL
FT                   AHSMGNWLTLEALRQMAIRNDGLPAKFKNVMLAAPDVDVDVFRSQIEDMGSQHPRFTLF
FT                   VSRDDRALAFSRRVWGDIPRLGSIDPEADPYKQELAENEITVIDLTKVKAGDGMHHGKF
FT                   AESPEVVRLIGARISEGQPLTDSRMGLGDHLIAGTTGAAAAAGSAAGLILAAPVAVIDP
FT                   HTRDNYANHVGAAMGQSDGKQKIAVTDCVSRQSAERDPACAPQN"
FT   gene            complement(319553..321799)
FT                   /locus_tag="SMa0601"
FT   CDS_pept        complement(319553..321799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted to be an integral membrane protein and has
FT                   a tetratricopeptide repeat domain, has partial similarity
FT                   to predicted adenylate cyclases of S; meliloti; Similar to
FT                   S; meliloti SMa0664"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64972"
FT                   /db_xref="GOA:Q92ZY4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY4"
FT                   /protein_id="AAK64972.2"
FT                   /translation="MIHAAASEAEKPQSTDSRCLAQLARIRQSAEFDATGREHRFLQYV
FT                   VEETLAGRGSRIKAYTVAVEVFGRDSTFDPQNDPIVRIAASHLRRSLERYYLTAGKSDP
FT                   IVIGIPKGGYLPTFSERGSPEDANAAESSMPTMQAQAAGPSDASPVAARPPPGPGPGPG
FT                   PDDVRAQFERIVSSKEFHGGGRGDALLRYIIEETLAGRAERIKGYSIAIEVFKRDKSFT
FT                   QDDPVVRIEAARLRRALERYYLVAGQNDPLRIEVPKGGYGPTFSWKEAVRAESDRTAVP
FT                   DASGPIVSARRRGRVLLTVGVVAVAAAAILGYWTIDRPGSVSSLRAGSVSVPDGPTLVI
FT                   APFANLGEGPNAELYTDGVTEELLTALPRFKEIKVFGRETSKSLPPDVDVSQVRDELGA
FT                   RYLLAGGVRVSGSRIRVTARLVDASDGAILWSEDYDNDLQSRDLFAIQSDVASKVATAV
FT                   AQPYGIIAQTDAANPPPDDLGAYSCTLSFYDYRAELSAERHAKVSACLESAVARYPGYA
FT                   TAWAMLSIAHLDEERFKFNPKSGAPMAMERALQAARRAVQLDPGNTRGLQALMTALFFN
FT                   GQYAEAMRTGEQALAMNSNDTELMGELGTRVAMGGQWQRGAALLDRAIALNPGGAGYYH
FT                   GTRALAAHMLGDHPAAVAGIRQADLQKFPLFHAVASVIYAEAGMLHEARRAGETFMRRR
FT                   PDFVPNLQAEFMMRNLQPKDQLRLVSGLRKAGFSIPDGVEASIAAAEAADAKSR"
FT   gene            322421..323233
FT                   /locus_tag="SMa0604"
FT   CDS_pept        322421..323233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0604"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64973"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY3"
FT                   /protein_id="AAK64973.2"
FT                   /translation="MKQQNVGANLVSGTRRRAGGLAVAAMAVALSNAPSRAQSVINPDA
FT                   DSVLRAMTDQLQALQEFSVEYDTDHEVVQLDGEKIQYSASGRIAMSRSAGFRMTRQGPY
FT                   TDTEISFDGKVVSLYGKRLNVYARIDSPGPSIDEAVAEIQAATGFDAAGADFLSADPYA
FT                   ALAEGVLSGSLVGTAFVGGMLCDHLAFRNDDVDWELWISKGEQNLPLKYVITTKWVTGS
FT                   PQYTLRFRNWATGGVSSKSFEFKPPTDARKVDVVHTDVVGDLLLEAQQ"
FT   gene            323230..323565
FT                   /locus_tag="SMa0606"
FT   CDS_pept        323230..323565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0606"
FT                   /product="hypothetical protein"
FT                   /note="Has partial similarity to various hypothetical
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64974"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY2"
FT                   /protein_id="AAK64974.1"
FT                   /translation="MSMKRTSHRYISAAAMIAALVTVDGWTARLSGHGAVFIGNAQARV
FT                   GRPLTPASVAGVARRTTRRTIRRSAIYVAALPAACVKTSVSGTVLWQCGATYYQPYGGR
FT                   YVVVYVD"
FT   gene            323618..325168
FT                   /locus_tag="SMa0607"
FT   CDS_pept        323618..325168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64975"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY1"
FT                   /protein_id="AAK64975.1"
FT                   /translation="MKIARKYGPIAAAFVAALAITTSYAQSPTPGYNTKIPEQILTPDK
FT                   VESSIGTLNFADGVPTAETAGKIYDYLDTLRGVEVFLNFMPAASLEALRMGNAEMGATK
FT                   ANQALIFDQLLDSNPLLLTGNTDTVYCSVFLDLETDGPTVVEVPPGTGPGTVNDAFFRF
FT                   VIDMGAPGPDQGKGGKYLIVPADYKGDLPKDKSEGGEYYVARSPSHVNWLILRGFLVDG
FT                   KPDAASKLFREGLKVYPLAKKSNPPKMEFLDGSKVAFNTVHANTFEFYKELDHVIQKEP
FT                   IDLFDPELRGLAAGIGIRKGRSFAPDDRMTKILTDAVGIGNATARSIAFHNRDPRSPLY
FT                   PNSQWRSGFVGSDYRWIDLDGVSGRNKDARTNFFYMATVNTPAMAAKLIGKGSQYALIT
FT                   ADATGNAFDGAKTYRLNVPSNPPAKDFWSVVLYDPQTRSELQTSQPFPSRNSKRDKLVA
FT                   NADGSVDLYFGPKAPAGKDSNWIETVPGKGWFSLLRLYGPLEPWFDKTWRPGEIEEVR"
FT   gene            325226..325801
FT                   /locus_tag="SMa0609"
FT   CDS_pept        325226..325801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0609"
FT                   /product="hypothetical protein"
FT                   /note="Is very similar to the amino terminus of proteins in
FT                   the DUF1214 (conserved hypothetical proteins of unknown
FT                   function; Also has similarity to pfam06863, DUF1254,
FT                   Protein of unknown function (DUF1254); This family
FT                   represents a conserved region about 130 residues long
FT                   within hypothetical proteins of unknown function; Family
FT                   members include eukaryotic, bacterial and archaeal
FT                   proteins; Together with adjacent ORF, SMa0610,may comprise
FT                   a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64976"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZY0"
FT                   /protein_id="AAK64976.1"
FT                   /translation="MITKRDLLRSAAIGALVAATANSTTVIAQDKAEWPSPLEAKDIAE
FT                   EGFIYGLPLVMNYAVMQEFAVNRDSGQFKAPFNEINNMHQLASPEDTAIITPNSDTPYS
FT                   ILWLDLRVEPVVVSVPAVDKERYYSVQLIDGNTYNFGYIGSRATGTEPGSYLVVGPDWK
FT                   ARSPRASSRSSDRPPRSYSPTFGPSLST"
FT   gene            325807..326667
FT                   /locus_tag="SMa0610"
FT   CDS_pept        325807..326667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0610"
FT                   /product="hypothetical protein"
FT                   /note="Is very similar to the carboxy terminus of proteins
FT                   in the DUF1214 (conserved hypothetical proteins of unknown
FT                   function; Together with adjacent ORF, SMa0609,may comprise
FT                   a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64977"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX9"
FT                   /protein_id="AAK64977.1"
FT                   /translation="MPNVEKVQAGYKAQPLSAFLKQPAPTAAPEIAFVPATTAGIKDNF
FT                   FQYLDAALQFVPETLRDNAIRAKLAKIGIGPGKTFEFKELSLEHKAEMLISVKQGDDKI
FT                   NKWLASGNKPINRWNVSSLLGDEVFFNGDWLRRAGAAKAGLYGNDAVEAMYPFTRTDAT
FT                   GEPLDGSKHKYTLTFPPGQLPPVNAFWSVTMYDGKSQFLVKNPINRYLINSPMLPGMKT
FT                   EPDGSVTLYIQEDNPGAGKEANWLPAPDGPIYLVMRLYWPKTTPPSILPAGKGTWQPPG
FT                   VKRVS"
FT   gene            326972..328627
FT                   /gene="fixN3"
FT                   /locus_tag="SMa0612"
FT   CDS_pept        326972..328627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixN3"
FT                   /locus_tag="SMa0612"
FT                   /product="FixN3 cytochrome c oxidase subunit 1"
FT                   /EC_number="1.9.3.1"
FT                   /note="Cytochrome cbb3 oxidase subunit I; Cytochrome cbb3
FT                   oxidase, the terminal oxidase in the respiratory chains of
FT                   proteobacteria, is a multi-chain transmembrane protein
FT                   located in the cell membrane; Like other cytochrome
FT                   oxidases, it catalyzes the reduction of O2 and
FT                   simultaneously pumps protons across the membrane; Found
FT                   mainly in proteobacteria, cbb3 is believed to be a modern
FT                   enzyme that has evolved independently to perform a
FT                   specialized function in microaerobic energy metabolism;
FT                   Subunit I contains a heme-copper binuclear center (the
FT                   active site where O2 is reduced to water) formed by a high-
FT                   spin heme and a copper ion; It also contains a low-spin
FT                   heme, believed to participate in the transfer of electrons
FT                   to the binuclear center; The cbb3 operon contains four
FT                   genes (fixNOQP), high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64978"
FT                   /db_xref="GOA:Q92ZX8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX8"
FT                   /protein_id="AAK64978.1"
FT                   /translation="MGQLTTRERDLAAAILLVLAIVGIAMAAAGRFDPLGVHGAVVLLY
FT                   SLALLYLIMSSSFGPPPDPSRISRYYDDPIKAGVWFTLFWAIFGMFIGVWAAAQLAWPS
FT                   LNFDTAWASFGRIRPAHTTGVIFGFGGNALIATSFHVVQRTSRARLADQLSPWFVLFGY
FT                   NLFCILAVTGYFMGVTQSKEYAEAEWYADLWLVIVWVTYFILYIRTLARRREPHIYVAN
FT                   WYYMAFIVVVAILHIINNLTVPVSLGHAKSYTIWSGVQDSMVQWWYGHNAVAFFLTAGF
FT                   LAMLYYYLPKRAERPIFSYRLSILSFWGITFFYMWAGSHHLHYTALPHWVQNLGMTFSV
FT                   MLLVPSWASAGNALLTLNGAWHKVRDDATLRFIMMAAFFYGLSTFEGSFLAVRPVNSLS
FT                   HYTDWTVGHVHAGALGWVALITYGSLYTLVPAIWKRERMYSAALVEVHFWLAFAGTVIY
FT                   VFAMWNSGIIQGLMWRTYTGDGTLAYSFVDSLVAMYPYYIARAFGGLLFLIGAVVATYN
FT                   IWMTVRGVPALAERHGDVPVAAPLPEGAATGPAE"
FT   gene            328632..329384
FT                   /gene="fixO3"
FT                   /locus_tag="SMa0615"
FT   CDS_pept        328632..329384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixO3"
FT                   /locus_tag="SMa0615"
FT                   /product="FixO3 cytochrome-c oxidase subunit"
FT                   /EC_number="1.9.3.1"
FT                   /note="FixO is a membrane bound mono-heme constituent of
FT                   the fixNOPQ complex; Cytochrome cbb3 oxidase, the terminal
FT                   oxidase in the respiratory chains of proteobacteria, is a
FT                   multi-chain transmembrane protein located in the cell
FT                   membrane; Like other cytochrome oxidases, it catalyzes the
FT                   reduction of O2 and simultaneously pumps protons across the
FT                   membrane; Found mainly in proteobacteria, cbb3 is believed
FT                   to be a modern enzyme that has evolved independently to
FT                   perform a specialized function in microaerobic energy
FT                   metabolism; The cbb3 operon contains four genes (fixNOQP),
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64979"
FT                   /db_xref="GOA:Q92ZX7"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX7"
FT                   /protein_id="AAK64979.1"
FT                   /translation="MRELIHRKLERTAIGFVLAIILAASVGGIVEIAPLFTIDETVEDV
FT                   EDMRLYTPLELAGRNIYIREGCYACHSQMIRTLRDEVERYGPFSLAVESKYDHPMLWGS
FT                   KRTGPDLARVGGKYSDFWHVAHLTNPRDVVPESNMPAYAWLARTPLRLDDLGSHLEAQR
FT                   SVGVPYTDEMIENAARDAFGQAVPDSEQASGVTERYGDETQVSAFDGVATRVTEMDALV
FT                   AYLQVLGRLTKAAYQNTAAPEQVPDPTN"
FT   gene            329407..329577
FT                   /gene="fixQ3"
FT                   /locus_tag="SMa0616"
FT   CDS_pept        329407..329577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixQ3"
FT                   /locus_tag="SMa0616"
FT                   /product="FixQ3 nitrogen fixation protein"
FT                   /EC_number="1.9.3.1"
FT                   /note="Cytochrome cbb3 oxidase, the terminal oxidase in the
FT                   respiratory chains of proteobacteria, is a multi-chain
FT                   transmembrane protein located in the cell membrane; Like
FT                   other cytochrome oxidases, it catalyzes the reduction of O2
FT                   and simultaneously pumps protons across the membrane; Found
FT                   mainly in proteobacteria, cbb3 is believed to be a modern
FT                   enzyme that has evolved independently to perform a
FT                   specialized function in microaerobic energy metabolism; The
FT                   cbb3 operon contains four genes (fixNOQP); FixQ is a single
FT                   transmembrane helix protein; It has been shown to protect
FT                   the core complex from proteolytic degradation by serine
FT                   proteases; FixQ3 is more similar to FixQ of Mesorhizobium
FT                   and Azorhizobium than to FixQ1 and FixQ2 of S; meliloti,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64980"
FT                   /db_xref="GOA:Q92ZX6"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX6"
FT                   /protein_id="AAK64980.1"
FT                   /translation="MEVTHETLVEAAKTWGLFYLIGFSICVIVYAFWPANRERFDRAKR
FT                   GILEEDDQPWT"
FT   gene            329568..330449
FT                   /gene="fixP3"
FT                   /locus_tag="SMa0617"
FT   CDS_pept        329568..330449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixP3"
FT                   /locus_tag="SMa0617"
FT                   /product="FixP3 Diheme c-type cytochrome"
FT                   /EC_number="1.9.3.1"
FT                   /note="Cytochrome cbb3 oxidase, the terminal oxidase in the
FT                   respiratory chains of proteobacteria, is a multi-chain
FT                   transmembrane protein located in the cell membrane; Like
FT                   other cytochrome oxidases, it catalyzes the reduction of O2
FT                   and simultaneously pumps protons across the membrane; Found
FT                   mainly in proteobacteria, cbb3 is believed to be a modern
FT                   enzyme that has evolved independently to perform a
FT                   specialized function in microaerobic energy metabolism,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64981"
FT                   /db_xref="GOA:Q92ZX5"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX5"
FT                   /protein_id="AAK64981.1"
FT                   /translation="MDVEEVDPISGRRTTGHEWNGIKELDTPVPRGVLLFLVVTHVFAL
FT                   LWWVLLPTWPLGTTYTKGLLGIDERNVVEEKLAAAAAARAVWEKRIDTLSYEQIRADEQ
FT                   LMATVRSTGHQLFGDNCAVCHGIDGKGRSNYPDLTDDDWLWGGGPEDIEQTLRVGINTR
FT                   HPESRVAQMPSFGREQMLERNQVRDVAAYVYSLTNPGYSTPENIGRIEAGREVFLTSCA
FT                   ACHGENARGSREVGAPNLTDAYWIYGGTMQTIIESVHGGRQGHMPTWDERLTSAEIKIL
FT                   ALYINSLGVEKP"
FT   gene            330668..331474
FT                   /locus_tag="SMa0620"
FT   CDS_pept        330668..331474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64982"
FT                   /db_xref="GOA:Q92ZX4"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX4"
FT                   /protein_id="AAK64982.1"
FT                   /translation="MSGTGKLQRWVGEVSGIEETWNPKWQRHLPAQAPFEWLAKGWRDL
FT                   ITYPMLSLSYGVAVFVVSFLIIWLLFATGRDYFLFPAVAGFMIIAPLLATGLYLKSSRL
FT                   ERSEPVSLGSMLRVRPVAGAQVFFTGLLLCMLMLLWMRAAVLVYALFFGVRPFPGLGHI
FT                   TQLLLTTPTGWAMLAVGIFIGALFAGFSFAISVFSIPMLLDQRIDAFTAMGVSVALVWN
FT                   NLRPMLVWGAIVLGMFLVSVATAMIGLVVIFPLLGHATWHAYRAVR"
FT   gene            331477..333744
FT                   /gene="fixI2"
FT                   /locus_tag="SMa0621"
FT   CDS_pept        331477..333744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixI2"
FT                   /locus_tag="SMa0621"
FT                   /product="FixI2 E1-E2 type cation ATPase"
FT                   /note="Very similar to S; meliloti FixI1, high confidence
FT                   in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64983"
FT                   /db_xref="GOA:Q92ZX3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX3"
FT                   /protein_id="AAK64983.1"
FT                   /translation="MSCCSGIAVPSAGAASRTSISPEEIRLASRDLGDGLRQTAMTLPD
FT                   AHCAACIAAVEGALRKISGVELARVNLSARRVTINWRGNDDESPDFAAALAKIGYASHL
FT                   ASIEEETQDPVLASLLKALAVAGFSAMNIMILSVSVWSGADPATRHAFHLVSAALALPA
FT                   IVYSGRFFYRSAWAALRHGRTNMDVPISVGVLLAFALSVYDTLHNAAFAYFDASTSLLF
FT                   VLLAGRTLDHLMRGRARSAVGALARLSPRGASVVQADEAIDYVPLSEIQPGMRLLVAAG
FT                   ERVPVDGVVVKGASELDASIVSGESEWRRAAPGSALQAGVMNLANPLTLLATASVDGSF
FT                   LAEMTRMMEAAESGRSTYRRIADRAASLYAPVVHGVALLSMVAWLFGTGDLHKSVTIAI
FT                   AVLVITCPCALGLAVPMVQVVAVRRLFERGIMARDGSAFERLNEIDTVLFDKTGTLTLG
FT                   EMRLVNAGDIQPRLLSLAAAMARVSRHPASVAIALADPRRPVAPVEFDSLEEVHGCGIE
FT                   GRAGDAVYRLGRPSWASTAKQVDLGTSSTTVLSKDAETIAVFAFEETVRPGARELVQTL
FT                   RSAGLSVRILSGDRSAAVSSIARQLDIEAFSAELLPGEKVEAIRALAATGRKVLMIGDG
FT                   LNDAPALAAAHVSIAPSSATDVGRSASDFVFLGQSLLAVRDIIQTAARADVLIRQNFAM
FT                   AIAYNVVSVPFAIGGVVTPLAAALAMSLSSIVVVGNALRQGAKVKKGPRTFGATKPATA
FT                   KI"
FT   gene            333741..334001
FT                   /gene="fixS2"
FT                   /locus_tag="SMa0622"
FT   CDS_pept        333741..334001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixS2"
FT                   /locus_tag="SMa0622"
FT                   /product="FixS2 nitrogen fixation protein"
FT                   /note="Predicted protein is longer than other FixS
FT                   proteins; Only about the first 50 amino acids share
FT                   similarity to other FixS proteins; Has weaker similarity to
FT                   domain of cytochrome oxidase maturation protein cbb3- type,
FT                   function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64984"
FT                   /db_xref="GOA:Q92ZX2"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX2"
FT                   /protein_id="AAK64984.1"
FT                   /translation="MNYLALLVPVALAMGFVGLLAFFWSLRSGQYDDLDGAAERILLDD
FT                   EEDEGPLPDPVRDGTASRRQRSPKEDGESKLYSGVSNAKHG"
FT   gene            334433..334594
FT                   /locus_tag="SMa0625"
FT   CDS_pept        334433..334594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0625"
FT                   /product="hypothetical protein"
FT                   /note="Similar to amino terminus of Sinorhizobium meliloti
FT                   1021 hypothetical protein SMa1201"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64985"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX1"
FT                   /protein_id="AAK64985.1"
FT                   /translation="MMARERTGLSPALALVAAFMLFLQSVVHAFAGQPSDILPFDAFGN
FT                   SLCVTGTP"
FT   gene            335117..336379
FT                   /locus_tag="SMa0626"
FT   CDS_pept        335117..336379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0626"
FT                   /product="outer membrane protein"
FT                   /note="predicted periplasmic protein, has domain similar to
FT                   that found in OmpA, Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins, conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64986"
FT                   /db_xref="GOA:Q92ZX0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZX0"
FT                   /protein_id="AAK64986.1"
FT                   /translation="MSNAHITIFGDSKYDLRWRKSGRNASLCEGVARKLLMAGALVAAT
FT                   NVPCWSQSVADPVKQYSKESMQQALQTREQYDVHGLSFDTGQSTLQPGAKPLLDDIATA
FT                   LKNFPDWSLRIVGHTDASGSAESNERLSLERANTIKAALVERGIDAGKLLAAGAGQSRP
FT                   IASNETDEGKALNRRVELMRFTDSAEAKKLLKAMSDYLAAQKAISFAYDANLQVVTNSD
FT                   QKLGLASSGTVTLSRPDKVHTTRSGGFVDVESLFDGKTLTLLGKNVNKYTQVEIPGTVD
FT                   HLVDELKDKYGLPLPAADLLLTNAYDELIQGVYDSKDLGSGVINGAECDSLAFRKDDVD
FT                   FQIWVAQGAQPHPCRLVITSRLVKGGPEYSVQIRDWKSGDGVTLGDFSFKNPTDAEKID
FT                   VNDLKGTLGELPENFVGGGGK"
FT   gene            336766..337464
FT                   /gene="aqpZ2"
FT                   /locus_tag="SMa0627"
FT   CDS_pept        336766..337464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aqpZ2"
FT                   /locus_tag="SMa0627"
FT                   /product="AqpZ2 aquaporin"
FT                   /note="Major intrinsic protein (MIP) superfamily; Members
FT                   of the MIP superfamily function as membrane channels that
FT                   selectively transport water, small neutral molecules, and
FT                   ions out of and between cells; The channel proteins share a
FT                   common fold: the N-terminal cytosolic portion followed by
FT                   six transmembrane helices, which might have arisen through
FT                   gene duplication; On the basis of sequence similarity and
FT                   functional characteristics, the superfamily can be
FT                   subdivided into two major groups: water-selective channels
FT                   called aquaporins (AQPs) and glycerol uptake facilitators
FT                   (GlpFs); AQPs are found in all three kingdoms of life,
FT                   while GlpFs have been characterized only within
FT                   microorganisms, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64987"
FT                   /db_xref="GOA:Q92ZW9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZW9"
FT                   /protein_id="AAK64987.1"
FT                   /translation="MFKKLCAEFLGTCWLVLGGCGSAVLASAFPQVGIGLLGVSFAFGL
FT                   TVLTMAYTVGGISGGHFNPAVSLGLAVAGRVPAASLVSYVIAQVAGAIIAAAVLYVIAT
FT                   GKADFQLGSFAANGYGEHSPGGYSLTAALVTEVVMTFFFLIIILGSTHRRVPAGFAPIA
FT                   IGLALTLIHLVSIPVTNTSVNPARSTGQALFVGGWALSQLWLFWIAPLFGAAIAGIVWK
FT                   SVGEEFRPVD"
FT   gene            complement(337732..338109)
FT                   /locus_tag="SMa0629"
FT   CDS_pept        complement(337732..338109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64988"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW8"
FT                   /protein_id="AAK64988.1"
FT                   /translation="MNQFKIISAMDSHNFERKRASGPTKRDTLMLGREARRKTTLPLWF
FT                   RGFVAADRGDRPRLALGLVGARTAERLRRNARQISGAHSRPLDRRLGLAERHFVARCNY
FT                   AIQSNALVRNEFETRRREVLE"
FT   gene            complement(338133..339704)
FT                   /locus_tag="SMa0630"
FT   CDS_pept        complement(338133..339704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0630"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Has similarity to a group of large conserved
FT                   hypothetical proteins; This group includes SMa0937 and
FT                   shares some similarity with the mechanosensitive ion
FT                   channel; Two members of this protein family in M;
FT                   jannaschii have been functionally characterised; Both
FT                   proteins form mechanosensitive (MS) ion channels upon
FT                   reconstitution into liposomes and functional examination by
FT                   the patch-clamp technique"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64989"
FT                   /db_xref="GOA:Q92ZW7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW7"
FT                   /protein_id="AAK64989.1"
FT                   /translation="MASVGSFLAFEWPPLLRKIILTLLLAVIVFRVVRAIGKLLFALSG
FT                   ASGIADQPPSVFESDAARRFWLSRISIIAGFLLFGWAIASLMPALSFSNEVTRLAAFLF
FT                   GLGILVTAVEVVWRRPDKPAPLVVKSLLTIYLVVLWSAWVAGLLGLLWLGIYSLLLPPL
FT                   VRGVGDVAQALATRAQRTGPPGIVLSVVIVRGARAAVIAAAVAWLAYIWRIRAAALAGS
FT                   EPGAIVIPGLLNGIIALLVADLLWQMSKALIAYRMGLGPKDGSNVDELARSGRLRTLLP
FT                   IFRNVLAVFIGAVTVLTILSGLGVQIAPLIAGAGIFGVAIGFGSQTLVKDVLSGVFYML
FT                   DDAFRVGEYIQSGSYKGTVESFSLRSVRLRHHRGPIFTVPFGELGAVQNMSRDWVIDKM
FT                   TLNVTYDADVDLARKLIKKVGQELAADPEFAADTIEPLKMQGVDSFGDFAIVLRMKLMT
FT                   KPGAQFTIKRRAFMMIKKAFDENGIKIAVPTVHVSGGSDNAAAAQQALNMSKAAELAAN
FT                   KAPVGL"
FT   gene            complement(339652..340218)
FT                   /locus_tag="SMa0631"
FT   CDS_pept        complement(339652..340218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0631"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to the N-terminus of a group of large
FT                   conserved hypothetical proteins; This group includes
FT                   SMa0937"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64990"
FT                   /db_xref="GOA:Q92ZW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW6"
FT                   /protein_id="AAK64990.1"
FT                   /translation="MNSVQPIRIGFLLLAVAPILFWMLLGVSWAQQAPVGVPPEKAQQF
FT                   LDLLSDPQVKTWLEGKIPSAAAEPPAGSPVETISSWEAAIRDRINGLMGAVPRIPEELA
FT                   RGAAVVSRDVNSGRPGLVVSILAVLIAVGLGAEWLIRRVFARARKSGANENAGQEILSE
FT                   IACLADVCLGQRRFIPGIRMAALTA"
FT   gene            complement(340397..340783)
FT                   /locus_tag="SMa0633"
FT   CDS_pept        complement(340397..340783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64991"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW5"
FT                   /protein_id="AAK64991.1"
FT                   /translation="MGTPVLDQVGFEMIVYVAEISGRGIAAFDAANDIEAQAQLANRGL
FT                   LRDLIVLQNEGRALWDGVADIHLRTATPEETEIWQTSRTAAVQSGEDSDDEGRHVFLVP
FT                   VVDPSHDNFDDDDNPHHDDDRDGD"
FT   gene            341499..342152
FT                   /locus_tag="SMa0636"
FT   CDS_pept        341499..342152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains 2CBS domains; originally identified in
FT                   cystathionine beta-synthase; This domain is found in a wide
FT                   range of proteins, often in tandem arrangements and
FT                   together with a variety of other functional domains; It has
FT                   been proposed that the CBS domain may play a regulatory
FT                   role, although its exact function is unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64992"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW4"
FT                   /protein_id="AAK64992.1"
FT                   /translation="MTTKVVKLSPDDSVRQAAKLMFDHHVSGVPVVDDDGHLLGVISEG
FT                   DLIRRAELCSEASVLMADMAIDPDDRANAFIRRCSWRVGDVMTANPVTIEEEAPLARVA
FT                   GLMQERGIKRIPVVRDGELVGIVSRADLLQAIFSTKPDETAAGDEAIRRSILVRLGENT
FT                   SLEELDVTVTVTEGIVHFWGQVETAGCRRAARIMAESVHGVRGIVEHFPDPYTQ"
FT   gene            342592..342981
FT                   /locus_tag="SMa0637"
FT   CDS_pept        342592..342981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0637"
FT                   /product="hypothetical protein"
FT                   /note="has similarity in its N-terminus to the C-termini of
FT                   a group of conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64993"
FT                   /db_xref="GOA:Q92ZW3"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW3"
FT                   /protein_id="AAK64993.1"
FT                   /translation="MNARVSFAREPLYRSQVAGAASWGVSALEDQQLAGLIMWVPAGMI
FT                   YVAAALAIAAALIGGSNTSFAGESNDDAGARGGKLPCVTAAFKTARITLSVRRGSSGQC
FT                   QIHASCPTRVRRLSRSLRAKRHGRR"
FT   gene            342978..343235
FT                   /locus_tag="SMa0638"
FT   CDS_pept        342978..343235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0638"
FT                   /product="hypothetical protein"
FT                   /note="Miscellaneous; Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64994"
FT                   /db_xref="GOA:Q92ZW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW2"
FT                   /protein_id="AAK64994.1"
FT                   /translation="MTAAPVTEKSRYRSRPPSLYAPWWKSKEVITPSVIGGGASLLTVI
FT                   GGIPWQNLLLILVAFGAIAGFLYWRKNADRRAVARVEGMA"
FT   gene            343640..344044
FT                   /locus_tag="SMa0639"
FT   CDS_pept        343640..344044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to the conserved hypothetical protein
FT                   SMc04440"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64995"
FT                   /db_xref="GOA:Q92ZW1"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW1"
FT                   /protein_id="AAK64995.1"
FT                   /translation="MKAPTLAFAVLASAIGMSPAKAQTCIGICNGGTGGTTNHNLFIER
FT                   EYRDFLQQRYPNYGSRYRGMRPDISIGPGATVGGPRVGVRQQFRLRQRMVIDANKHLRW
FT                   CQERYLSYRLADDTFQPFEGARRPCNSPYN"
FT   gene            344135..344554
FT                   /locus_tag="SMa0640"
FT   CDS_pept        344135..344554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0640"
FT                   /product="hypothetical protein"
FT                   /note="Miscellaneous; Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64996"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZW0"
FT                   /protein_id="AAK64996.1"
FT                   /translation="MRRRRNAPATAKRSSKSHQTTRAGDCLKHRNPKRWSQLRKGGLNI
FT                   TSILLSSYLALPADSLLGRDLGEGERQLEFAGKFHRSPRQAPDSGRSLPPAGRQSRLRI
FT                   SAVEKQAAEAATSMKAVRIRSTASILTHDPHPLVQ"
FT   gene            345407..345667
FT                   /locus_tag="SMa0643"
FT   CDS_pept        345407..345667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0643"
FT                   /product="transposase, fragment"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64997"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV9"
FT                   /protein_id="AAK64997.1"
FT                   /translation="MNPGKLNNWIDDAAISGLVAIARFARVLHRDLDAVCSAIELLWSN
FT                   GQAEGQINPLKTIKRAMYGRAGPELLRARMLPLDQNYRHKK"
FT   gene            345684..345992
FT                   /locus_tag="SMa0645"
FT   CDS_pept        345684..345992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0645"
FT                   /product="hypothetical protein"
FT                   /note="Contains short region of similarity to a group of
FT                   conserved hypothetical proteins; This group includes
FT                   SMb20042"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64998"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV8"
FT                   /protein_id="AAK64998.1"
FT                   /translation="MQNDIGGELVHLEDLVLDDATKNVRTPTHELTIPLGLSAAGLRSL
FT                   RGRDFVSGSPAASSAADGTVEVTTDPDVDRSTEGRDESNGDVSVFGAEFVAIDAVLA"
FT   gene            346110..346361
FT                   /locus_tag="SMa0647"
FT   CDS_pept        346110..346361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0647"
FT                   /product="hypothetical protein"
FT                   /note="Is similar to an approximately 80 amino acid long
FT                   sequence found in a group of conserved hypothetical
FT                   proteins; Together with adjacent ORF, SMa0649, may comprise
FT                   a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAK64999"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV7"
FT                   /protein_id="AAK64999.1"
FT                   /translation="MLRQAHDLPPVLQAIVALDAWNVLSVLQHAPWLGRVLAASILRQA
FT                   GVTASAHLATVNLGLETMPVERRRHRDRNFRLLALPMG"
FT   gene            346342..346659
FT                   /locus_tag="SMa0649"
FT   CDS_pept        346342..346659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0649"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to short region found in a group of
FT                   conserved hypothetical proteins; Together with adjacent
FT                   ORF, SMa0647, may comprise a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65000"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV6"
FT                   /protein_id="AAK65000.2"
FT                   /translation="MRCPWADCSRRDRAEGARPAGAGKNDDGAKLKGRRTSSTLPELVD
FT                   LVMARPLVSASMVAKTLDVTPQAARRIVLELGLREIALVTVDDAASLVLRIVNTLQECF
FT                   R"
FT   gene            complement(347249..347851)
FT                   /locus_tag="SMa5027"
FT   CDS_pept        complement(347249..347851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5027"
FT                   /product="hypothetical protein"
FT                   /note="Possible secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07973"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX5"
FT                   /protein_id="ACF07973.1"
FT                   /translation="MARLPSMAAAALALAASFPLICVTTTPASAQSLSAGDDGGDISAS
FT                   DVRDFLRDALRARSDRRDLIRDLVPERQDRRDELLDLLGDGGDLMGDRGDRLERLRDLL
FT                   AARRDRPDDLMELIGDRGDRRERLMDLIAARRDRRDELMDLIGDRDDQGGGRGLLRQRL
FT                   LERLADGNDENCVFITRSLRAENGDWLAFVRRRVCRD"
FT   repeat_region   complement(348201..349286)
FT                   /rpt_family="ISRm24"
FT                   /note="SMa4003"
FT   gene            complement(348248..349249)
FT                   /locus_tag="SMa0656"
FT   CDS_pept        complement(348248..349249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0656"
FT                   /product="TRm24 transposase"
FT                   /note="Belongs to IS30 family, high confidence in function
FT                   and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65002"
FT                   /db_xref="GOA:Q92ZV4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV4"
FT                   /protein_id="AAK65002.1"
FT                   /translation="MSQCYLHLTLPDRRRVHQLLERKAPTAEIARQLGRHRSTIYRELK
FT                   RNTFHDAEFPEYSGYYSGIANDISKERRRRLRKLSRHPQLRELVIEQLKALWSPEQIAG
FT                   RLLADGVSAVRVCTETIYRFIYSKEDYALELYQHLPEGRRKRRPRRSRKPRDGSIPLDC
FT                   RISQRPDFIADRSQFGHWEGDLLIFRRDLGEANVTSLVERKSRYTVMIKNGSRHSRPLI
FT                   DKIIDAFSPLPAFARQSFTFDRGTEFRGFKALEDGLGARSWFCDPNSPWQKGAVENTNK
FT                   RIRRFVPSDTDLSAVSQPQLVALAHHLNSLPRKCLGYRTPAEVFMAHLRDCG"
FT   gene            349400..349597
FT                   /locus_tag="SMa0657"
FT   CDS_pept        349400..349597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0657"
FT                   /product="cytochrome c binding protein, amino terminus"
FT                   /note="Probable protein fragment; Likely is nonfunctional;
FT                   Similarity to amino terminus of cytochrome c binding
FT                   protein associated nitrate reductase involved in
FT                   denitrification; SMa0659 is similar to the C-terminus,
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65003"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV3"
FT                   /protein_id="AAK65003.1"
FT                   /translation="MTLGGFVGGVIFWGAFNTALELTNTEEFCVSCHEMRANVYEELRR
FT                   TVHFSNRSGPGVLSRLPRAA"
FT   gene            349623..350021
FT                   /locus_tag="SMa0659"
FT   CDS_pept        349623..350021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0659"
FT                   /product="cytochrome c binding protein, carboxyl terminus"
FT                   /note="Probable protein fragment; Likely is nonfunctional;
FT                   Similarity to carboxyl terminus of cytochrome c binding
FT                   protein associated nitrate reductase involved in
FT                   denitrification; SMa0657 is similar to the N-terminus,
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65004"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV2"
FT                   /protein_id="AAK65004.1"
FT                   /translation="MQASKEVWGKIFGSINTREKFLDHRLELAKHEWARLKANDSLECR
FT                   NCHSSAAMDLSKQTQRAAEIHTRYLLPGKVTCIDCHKGIAHELPNMQGVEPGWKLPPEL
FT                   EGETLPSASATDELKKVMNDSHTVAFGN"
FT   gene            350388..350867
FT                   /locus_tag="SMa0661"
FT   CDS_pept        350388..350867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0661"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to a small group of proteins from
FT                   Nitrobacter, Bradyrhizobium and Rhodopseudomonas"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65005"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV1"
FT                   /protein_id="AAK65005.1"
FT                   /translation="MRATWAIPVAALVLLLDSSDGTAGQPGKSADQPSKYVPSVGEIMN
FT                   KIDLSRSKLWYSVKLRNWALAGYQLDQVKTGFDDVSRHHPDKSNFDFANVQKIANLIEE
FT                   AIVARSDEQFQQSFALMTTECNDCHRAVGKPFLHVGAPKVPSPYSDKMLEPGAFR"
FT   gene            complement(350925..351560)
FT                   /locus_tag="SMa0662"
FT   CDS_pept        complement(350925..351560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0662"
FT                   /product="Transcriptional regulator, CAP/Crp family"
FT                   /note="Similar to FixK of S; meliloti, but its expression
FT                   is not FixJ-dependent, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65006"
FT                   /db_xref="GOA:Q92ZV0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZV0"
FT                   /protein_id="AAK65006.1"
FT                   /translation="MNTSISASWGRYINAIPPRSGEAALAPLSSFVDGQCIYSFGERAD
FT                   QVYQVEFGAVRVYRLAANGRRQILAFHFGGNWFGLQSRDRHSSNAEAIGVTGVRCISLQ
FT                   EEPLFRPALFSAALDNVSAAQEHQLVIGRQSAIERVAAFLLEMSERSGYSRRFELSMSR
FT                   VDVADYLALTVETVSRSLTKLKHRGFIELHGARGIELVGYRALQNLCL"
FT   gene            complement(351675..351944)
FT                   /locus_tag="SMa0663"
FT   CDS_pept        complement(351675..351944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0663"
FT                   /product="hypothetical protein"
FT                   /note="weak similarity to hypothetical protein RNGR00298
FT                   from Rhizobium sp; NGR234"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65007"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU9"
FT                   /protein_id="AAK65007.1"
FT                   /translation="MNGEPDWKHCMAAALRRFPARSLQIRELSMRDEDFRGMCEDFAAA
FT                   ENALAAVDQLPLHIREERRAEFKGLIESLAAEIAIALGPADGSI"
FT   gene            352085..353842
FT                   /locus_tag="SMa0664"
FT   CDS_pept        352085..353842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0664"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted to be an integral membrane protein and has
FT                   a partial tetratricopeptide repeat domain, has partial
FT                   similarity to predicted adenylate cyclases of S; meliloti;
FT                   Similar to S; meliloti SMa0601"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65008"
FT                   /db_xref="GOA:Q92ZU8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU8"
FT                   /protein_id="AAK65008.1"
FT                   /translation="MTIAGRGSVRAGSPTALPTNTEILVQLDRIRLSAEFDVPDRARKF
FT                   LAYIVGEAIAGRADRIKAYSIATEVFGRDSSFDAQTDPVVRIEAGRIRRALERYYFVAG
FT                   SNDPIVIKIPKGGYAPAFEKRGGAPYQLSSGQAANVQSRSMSLEQTALWVSVATVGLLT
FT                   CGLLANAFFGSAATTIESLTKPGGTRPNIPKLMVMPFEDLSQTPQSAMITRGLTDEVIS
FT                   NIAKFKEIVVVAGPAAPNPHSAEREYPAFALEGRVRLDGDKLRLGIRLVQHSDGSVVWA
FT                   NTYDEVLQPRKIIELQQNAAAAVASAIAQPYGIVFQANATHFMRSVPDDWQAYACTLAY
FT                   YGYRGDLNPQTHASVQECLQHATTQFPDYATAWALLSLTYVDELRFRYRLNRSTTVSLS
FT                   HAIEAAARAVELDPQNVRALQAEMLTLFFRGEVNAALTVGARAYAINPNDTELSGEYGF
FT                   RLALSGQWRSGCDLVSKTVASNPGPVGYFEAALAVCCYIEHDYVAAERWARSADLHANP
FT                   VYHVILLAILGKLGKMDLARAEREWLEINVPGFLENARNEVALRIHRPEDQKHFIEGLR
FT                   QAGVPIPGK"
FT   gene            complement(353876..355030)
FT                   /locus_tag="SMa0665"
FT   CDS_pept        complement(353876..355030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0665"
FT                   /product="conserved hypothetical protein"
FT                   /note="has transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65009"
FT                   /db_xref="GOA:Q92ZU7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU7"
FT                   /protein_id="AAK65009.2"
FT                   /translation="MDDNPSSQRNPDPVNPAARPSIEPRITEIARIGLVGLFAYWSFTL
FT                   IAPFAIILIWAAILAVALYPAYAALSAILGQRPRVAALVITMLGLLVIVAPLAAIAFSF
FT                   AEGLQVVLARLNDRSLLISAPPDSIRSFPLIGERIYSVWSMASDNLEAVLQQIKPALLQ
FT                   AGSKALGKIASIGADLLSFVVSVLVAGFLFGSGARLANSAQGFASRMGGDRGVGFLQLA
FT                   AATIRNVARGVIGVALLQAFLCILILSLFKVPAPGAIAFVVLILCIIQIGPALALLPVI
FT                   VWAWTSMEFGMAALFTILLIPLLIIDNVMKPILVARGLSTPTLVILLGVLGGTLSYGLI
FT                   GLFLGPIVLSVFHSLLLIWMNTDTVGSEGLRLGNPDYRIRREKT"
FT   gene            355528..356016
FT                   /locus_tag="SMa0667"
FT   CDS_pept        355528..356016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65010"
FT                   /db_xref="GOA:Q92ZU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU6"
FT                   /protein_id="AAK65010.1"
FT                   /translation="MEDSLHPAAVAHLPPFITAPGQTDVLFNVMIVFVLLMVFVVGILY
FT                   LRLHALPEHMAHGASKVQLQIVGVLALIALFTHNHLFWIAALLLAMVEFPNFSSPVESI
FT                   ARSLAKMADRHDGTDEPGTSAQPAAMPPRANESHASPPQWVPLEIEPVAGDNKAERRG"
FT   gene            356020..357249
FT                   /locus_tag="SMa0669"
FT   CDS_pept        356020..357249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0669"
FT                   /product="HlyD-family protein"
FT                   /note="has similarity to EmrA, a Multidrug resistance
FT                   efflux pump and other HlyD-family proteins, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65011"
FT                   /db_xref="GOA:Q92ZU5"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU5"
FT                   /protein_id="AAK65011.1"
FT                   /translation="MLEFLICSLLTIFPDYLVRRYVQGKRVGREINLYSMWFELRYGIT
FT                   ACLILTISLITMIFYFHPSTSNVTAVFRTVTIMPESTGRVAEVYVDLNEKVSAGAPLFR
FT                   LDDSEQRAALETARRRVAEIEAEAIVAQSELASADGLIAQAEGDYLQALNELETQVELN
FT                   QRNPNIVARREIERLQVAVDGRDGARAASISNKRTLETKIASLLPAQKASAEAALTQAQ
FT                   VELDKTIVRAGTAGVVQQFALRAGDIVNPMIRSAGILVPEQRRIGLIAGFGQIEAQVMK
FT                   AGMIAEATCIGKPFTIIPMVVTEVQDVIAAGQIRPTDQLVDAQQLASPGTLTAYLEPLY
FT                   EGQFSGVPPGSSCIANAYTSNHDALHAPGISTPHWLFLHVVDAVGLVHAMILRLQALLL
FT                   PVQTLVFKGH"
FT   gene            357359..358213
FT                   /locus_tag="SMa0670"
FT   CDS_pept        357359..358213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0670"
FT                   /product="conserved hypothetical protein"
FT                   /note="very weak similarity over part of its length to
FT                   TMPK, Thymidine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65012"
FT                   /db_xref="GOA:Q92ZU4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZU4"
FT                   /protein_id="AAK65012.1"
FT                   /translation="MDKHTDDRKKNNHWKAEDRKSAATEASETRSGGNYAKELARLQEE
FT                   IAHLQAWVKKTGARIVIVFEGRDAAGKGGVIKRITERVSPRVFRVVALPAPTDREKTQI
FT                   YMQRYIQQFPAAGEVVIFDRSWYNRPGVERVMGFCSEKKAKRFLEIAPRFEAAMIESGI
FT                   VLLKYFLDVSEEEQDRRFRQRINDPLRQWKLSPMDVESYRRWWDYTRAYDEMIRMTDTD
FT                   DAPWWIVPSDNKKQARVNCIAHILSSIPYERVKFEDPDLGKRQKRPADFEGDTRRRTVP
FT                   NLF"
FT   repeat_region   358752..360049
FT                   /rpt_family="ISRm3"
FT                   /note="SMa3006; predicted by homology"
FT   gene            358810..360012
FT                   /locus_tag="SMa0673"
FT   CDS_pept        358810..360012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0673"
FT                   /product="TRm3 transposase"
FT                   /note="Belongs to mutator family of transposases, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65013"
FT                   /db_xref="GOA:P80011"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80011"
FT                   /protein_id="AAK65013.1"
FT                   /translation="MAIEKELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELDD
FT                   HLDVERLEGGPANRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDFDD
FT                   KIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYPLVF
FT                   FDAIRVKIRDEGFVRNKAVYVALAVLADGSKEILGLWIEQTEGAKFWLRVMNELKNRGC
FT                   QDILIAVVDGLKGFPEAITAVFPQTIVQTCIVHLIRHSLEFVSYKDRRTVVPALRAIYR
FT                   ARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEA
FT                   LNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIFGERFF
FT                   N"
FT   gene            complement(360005..360349)
FT                   /locus_tag="SMa0674"
FT   CDS_pept        complement(360005..360349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65014"
FT                   /db_xref="GOA:Q92ZU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU3"
FT                   /protein_id="AAK65014.1"
FT                   /translation="MSEKVPGNGGSKHLFYGVLNPVDRSNEVLFGLIMVMTFTNSLSTT
FT                   DAGRADVRSMLVGAVGCNLAWGIIDAVMYFMSSMAERKLSERTVHRVRTADDVKAGTVR
FT                   NSVRWAGFIS"
FT   gene            complement(360346..361491)
FT                   /locus_tag="SMa0675"
FT   CDS_pept        complement(360346..361491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0675"
FT                   /product="Ca2+/H+ antiporter"
FT                   /note="best similarity to ChaA, a Ca2+/H+ antiporter; Has
FT                   weaker similarity to the family of sodium/calcium exchanger
FT                   integral membrane proteins found in eukaryotes, function
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65015"
FT                   /db_xref="GOA:Q92ZU2"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU2"
FT                   /protein_id="AAK65015.2"
FT                   /translation="MRTFEVKGSTKQSRSAIETVLRELRRSPLLALIFFVPVVILLERM
FT                   APKAHTLLFFVAIAAIVPLAALLSRATESVAAKTGDAVGGLLNATLGNLTELIITLAAL
FT                   QAGQYLLVKASIAGAIVTNSLFMFGGAFLIGGLKHHLQEFNRVNARFQAILLFLATIAI
FT                   LVPSLTSGLDRTPAAEFSQQLSLGLAILLIVVYGLGMVFSLKTHKELFASVGQAEAGEE
FT                   PWPLSIGIVVLIVVTLLVAMVSEIFVGSVQAAAQHLGLTPAFVGFIVIALVGGAAEMTT
FT                   AFSAARANRLDLSVGIALGSAAQIALFVAPVLVLVSYFIGPQPMSLEFWPGAVAMMLVA
FT                   TMAATLLSNGGHAAWYAGVMALAVYAIFALTLFLLPPGVTQ"
FT   gene            complement(361696..362637)
FT                   /locus_tag="SMa0677"
FT   CDS_pept        complement(361696..362637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0677"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="PBPb, Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound, membrane-
FT                   associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and inorganic ions; PBPs
FT                   have two cell-membrane translocation functions: bind
FT                   substrate, and interact with the membrane bound complex; A
FT                   diverse group of periplasmic transport receptors for
FT                   lysine/arginine/ornithine (LAO), glutamine, histidine,
FT                   sulfate, phosphate, molybdate, and methanol are included in
FT                   the PBPb CD, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65016"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU1"
FT                   /protein_id="AAK65016.2"
FT                   /translation="MQAAPGKGRQSGRRIVRFGLTLGAVTVSMWASAEAQTLDRIRSSS
FT                   TVKLGYDATARPFSFKAEGESATGYAVSLCMEVVEELKRELGIADLAVEWIELTREAAD
FT                   HAIRQGSADLFCGASPVTLTRRKEVSFSIAIFPSGTGAVLNASAPLALREVLTQGRPSD
FT                   RPIWRGSPARTVLNQKTFSPIAGTTSEDWLAERIKTFQLSATIAAVENYDQGIANILNG
FT                   ESDVLFGDLPLLLDAAARGENSGDLIVLKRHFTYEPLALVLARNDEDFRIVVDRALSRT
FT                   YRSEDFPAFFSEWFGPPDDTIVTFFRQTTLPE"
FT   gene            complement(362667..364025)
FT                   /locus_tag="SMa0678"
FT   CDS_pept        complement(362667..364025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0678"
FT                   /product="amino acid transporter"
FT                   /note="has similarity to putrescine/ornithine,
FT                   cadaverine/lysine, arginine/agmatine antiporters, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65017"
FT                   /db_xref="GOA:Q92ZU0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZU0"
FT                   /protein_id="AAK65017.1"
FT                   /translation="MTEHSLNVAMEAASKKKMNLVQLTFIVAVNMMGSGIIMLPANMAQ
FT                   VGAISLLSWLVTAVGSMAIAYGFAQAGLFNQRPGGMSAYAEDAYGKPGYFLVFLLYFLS
FT                   LAVGNVAIGISAVGYLAGFFPWLTSTPIATCVSLIILLWLTTVANFGGPRVTGRIGSIT
FT                   VWGVILPVGLLCIIGWAWFSSEVFAAAWNPNGLTLVQGMGSSISLTLWAFLGMESAAQN
FT                   SDAVENPKRDVPLACLFGTLGAAIIYILSTTVIQGIVPNAELAASTGPFALAFATMFNP
FT                   AIGSVVMALAVLACVGSLLGWQFTIAQTARAAADERMFPSLFSRVNEMGAPVTGMIVMG
FT                   VVQSLLALMTISPTLNEQFAALVNLAVVTNVLPYIISLSALFVMMRAAGVSESKFRLNS
FT                   SIAIVGMLYSVFAIYASGKDAVLGGMLVTGIAFIIYGLIAPRFTPRPGIVRTA"
FT   gene            complement(364053..366401)
FT                   /locus_tag="SMa0680"
FT   CDS_pept        complement(364053..366401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0680"
FT                   /product="decarboxylase (lysine, ornithine, arginine)"
FT                   /EC_number="4.1.1.17"
FT                   /EC_number="4.1.1.19"
FT                   /note="CATALYTIC ACTIVITY: L-lysine = cadaverine + CO(2),
FT                   COFACTOR: Pyridoxal phosphate, SUBCELLULAR LOCATION:
FT                   Cytoplasmic (Probable), SIMILARITY: Belongs to the
FT                   Orn/Lys/Arg decarboxylase class-I family, specificity
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65018"
FT                   /db_xref="GOA:Q92ZT9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZT9"
FT                   /protein_id="AAK65018.1"
FT                   /translation="MKAPTVPIPFHKLLKVVAFVDESNLETKRLLAHIVAENFEVELRG
FT                   SYNADVSEDASVGAYIGTVEGGRLEDARKFVRAVRDIGFRTPLWALADSHGIADIAAIK
FT                   MAGEVDGFVYLGQQTPAFYAKQIISSLVNYGKTLLPPFFGGLMAYDGEANIAFDCPGHQ
FT                   GGQFYRKSPAGQLFFNYFGESIFRADLCNADVDLGDLLIHEGPAAEAQKNAARIFGADR
FT                   TYFILNGTSTSNKVVTNAVLRAGDLVLFDRNNHKSLHQGALVQAGAIPVYLPTSRNSFG
FT                   MIGAVDWDAWDEASLRRQIERHPLVEDKARASAERPFRLACIQLATYDGTIYNVRKVLE
FT                   QIGHLCDYVLWDEAWIGYNAFHPLFEDHSPMRIDTLDAEMPGLFSTQSVHKQGAGFSQA
FT                   SQIHKRDEHIRDQRRYVEHKRFNESLLMHVSTSPFYPLFASLDVNAKIHEGKAGEMLWD
FT                   RCIELGIEARKKLREFTRYYESSGAGPQEQWFFDPFVPDVVTISGSKHTEDVVESRWEA
FT                   LPTEVIKREQQCWRFRPGASWHGYSGYSDGYAMVDPNKLTLLTPGIDRATGEYRDFGIP
FT                   ATMVANYLREQRIVPEKCDLNSILFLLTPAEDESKLNTLIAKLVKFKNLWDRDAPLAEV
FT                   LPTVFAANRERYAGYTLRQVCAEMHDFYRQAGVKELQRLCFRAESMPEPAMTPKAAYEA
FT                   LVANEVDYVALDEAFGRISATLALIYPPGIGVIVPGERWDERARPMHNYFLAFQESFNR
FT                   FPGFNYEVQGVFQERVDGQIKFYTYAVRE"
FT   gene            complement(366403..368673)
FT                   /locus_tag="SMa0682"
FT   CDS_pept        complement(366403..368673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0682"
FT                   /product="decarboxylase (lysine, ornithine, arginine)"
FT                   /EC_number="4.1.1.17"
FT                   /EC_number="4.1.1.19"
FT                   /note="CATALYTIC ACTIVITY: L-lysine = cadaverine + CO(2),
FT                   COFACTOR: Pyridoxal phosphate, SUBCELLULAR LOCATION:
FT                   Cytoplasmic (Probable), SIMILARITY: Belongs to the
FT                   Orn/Lys/Arg decarboxylase class-I family, specificity
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65019"
FT                   /db_xref="GOA:Q92ZT8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZT8"
FT                   /protein_id="AAK65019.2"
FT                   /translation="MEFYKAFPIAVIDEDYEGKSAAGRGMRSLAEAIEKEGYRVVAGLT
FT                   YEDARRLVNVFNTESCWLISVDGTESSTTRWEILAELLAAKRSRNNLLPIFLFGDDTTA
FT                   EMVPAPVLRHANAFMRLFEDSPEFMARAIVRAAQNYLERLPPPMFKALMEYTLHGAYSW
FT                   HTPGHGGGVAFRKSPVGQLFYTFFGENTLRSDISVSVGSVGSLLDHVGPIGEGERNAAR
FT                   IFGADETLFVVGGTSTANKIVWQGMVTRNDLVLCDRNCHKSILHSLIMTGATPIYLTPS
FT                   RNGLGIIGPIAKEQFTPEAIAHKIVASPFASETNGKVRLMVVTNSTYDGLCYNVDGIKS
FT                   ALGDAVEVLHFDEAWFAYANFHEFYDGYHAISSTKPARSQEAITFATQSTHKLLAAFSQ
FT                   ASMLHVQHAVAKQLDITRFNEAFMMHTSTSPQYGIIASCDVAAAMMEQPAGRALVQETI
FT                   DEAMSFRRAVNAVRTQMQDSWWFEVWEPPIADRAPSDATSDWLLKPGDAWHGFEDLAEN
FT                   HVMVDPIKVTILSPGLNAGGAMLEHGIPAAVVTKFLSSRRIEIEKTGLYSFLVLFSMGI
FT                   TRGKWSTLITELLNFKDLYDANAPLSRALPALAAAHPDVYRAMGLRDLCEKIHDVYRSD
FT                   GVPNAQREMYTVLPEMALRPADAYNRLVKGCVESVDIDELIGRTLAVMIVPYPPGIPLI
FT                   MPGERITAATRSIQDYLVYARSFDRKFPGFETDIHGLRFVANPSGRRYLVDCIVEEGQD
FT                   DTA"
FT   gene            complement(368879..369805)
FT                   /locus_tag="SMa0683"
FT   CDS_pept        complement(368879..369805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0683"
FT                   /product="Cation efflux protein"
FT                   /note="Belongs to cation efflux protein family; Members of
FT                   this family are integral membrane proteins, that are found
FT                   to increase tolerance to divalent metal ions such as
FT                   cadmium, zinc, and cobalt; These proteins are thought to be
FT                   efflux pumps that remove these ions from cells, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65020"
FT                   /db_xref="GOA:Q92ZT7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZT7"
FT                   /protein_id="AAK65020.2"
FT                   /translation="MCNEQTFLRASIAATVVVAAFGIILGLLSGSFSITFDGVYSLADA
FT                   GMTVLALWVSRLIAVSATGDALSARMRDRFTMGFWHLEPIVLLLNGTLLMAIAVYALIN
FT                   ALTSVLKGGHQLQFGFAIAYAAVTVFVCAMMAVIGARANRGLRSNFIALDVKAWIMSGG
FT                   IASALLVAFIIGHAVQETALHWMTLYVDPVVLAFVCIVIIPLPIGTVKSALADILLITP
FT                   NELRARVERIADETVRKQGFLSYRAYVARVGRAKQIELHFIVPSNFPPQPVESWDQIRD
FT                   EIGIAIGDEGHNRWLTVAFTADERWAE"
FT   gene            complement(369951..371276)
FT                   /locus_tag="SMa0684"
FT   CDS_pept        complement(369951..371276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0684"
FT                   /product="amino acid transporter"
FT                   /note="best similarity to the ABC transport family that
FT                   includes putrescine/ornithine antiport, lysine/cadaverine
FT                   transport, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65021"
FT                   /db_xref="GOA:Q92ZT6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZT6"
FT                   /protein_id="AAK65021.1"
FT                   /translation="MSAPSSGKSLGLAACTAIVVGNMVGSGFYLSPAAVAPYGNLAIVI
FT                   WIVMGAGAICLGLTFARLAKLSPAVGGPYAYTRLAYGDFPGFLIAWGYWISIWASLPVI
FT                   AVAFAGVVIDFFPFLRGRGTATLLTLSVIWLVVLVNLRGVHAAGLFSEITTYAKMIPFG
FT                   AVALLGLFYIDFSHFADFNPSGQPLLQASAALAPLTMFAYLGLESATVPAGDVRDAERT
FT                   IPRSTVLGIAIAVTLYVLGTIVVMGLVPREELVHSVAPFSEAARRMWGPAGELAISLAV
FT                   VLSSIGALNGWTLLMGQVPMAAARDGLFPPLFSRLSARHVPATGIVVSATLATILVLVQ
FT                   AAGSEGFSSIYRLFVGLSTMTAVIPYAFCALASSLVSARVSGGTLIPRVTLIELVGFTF
FT                   AIFTLYGCGAEPVLYGLVLLLLSIPVYIWQRRRSFVPGDFGQ"
FT   gene            complement(371790..372296)
FT                   /locus_tag="SMa0687"
FT   CDS_pept        complement(371790..372296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0687"
FT                   /product="hypothetical protein"
FT                   /note="weak similarity to Silicibacter pomeroyi SPO1168 &
FT                   SPO3568"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65022"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZT5"
FT                   /protein_id="AAK65022.2"
FT                   /translation="MNVTSKTRIVAATAVSLLCSGTMVQAQDMKKYGTAAGWDIVVRGD
FT                   MGPGCLIAKKLGNDMQIQMGIDETTGRRGYMALYTKLAANVGSGEKRAVIFDVDGQKFS
FT                   GEATGQQLEGFDGAYVWVNNPDFIYDLAKMKTLTITPDGRKPFALSLAGTDAAMQAMRA
FT                   CQEAN"
FT   gene            complement(372485..373435)
FT                   /locus_tag="SMa0689"
FT   CDS_pept        complement(372485..373435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0689"
FT                   /product="conserved hypothetical protein"
FT                   /note="Most similar to hypothetical proteins from
FT                   Ralstonia, Pseudomonas and Geobacter"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65023"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZT4"
FT                   /protein_id="AAK65023.1"
FT                   /translation="MIKLLHTLLVGSAASLAPLLGAIDAALAQAEGPASVYDYAAAEEP
FT                   PVFDDPAKAVEAFKSVLAANDFDDLARLLGLNAAKLKAGEGSMETFGLIREGAARNIVV
FT                   RDLDGRKIIVIGDRLWPLPFPIVKDEAGKWAFDTYVGLEEIVNRRVGENELEAIETARA
FT                   YVEAQRDYVSQDRDADGVLEYAQKLISSPGQTDGLYWPSDQGDGESPVGDAISEAALEK
FT                   ARTGEGYFGYRFRILTSQGDNIAGGKYDYTINGNMIAGFALVSWPVAYAETGVKTFVIN
FT                   QQGIVYERDLGPSTEEIVPFIDRFDPDEKWSVVTD"
FT   gene            complement(373456..374856)
FT                   /locus_tag="SMa0690"
FT   CDS_pept        complement(373456..374856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0690"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weak similarity in amino terminus to region of
FT                   chromosome segregation ATPases; Carboxy terminus is glycine
FT                   rich"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65024"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZT3"
FT                   /protein_id="AAK65024.1"
FT                   /translation="MMRGMTLALAGAMTLMLSMQVNGSLAQEPTKAATGTVASTPEPLT
FT                   DDELEVLVARIALYPDELVALISAVSLYPLQIVEAERFLENHKKKPDLKPKESWDGSVI
FT                   SLLNYPDVVKMMSDDLEWTQALGQAVAYQQKDVLIAIQQLRDEAVAKDIIKSDDKMTVV
FT                   QEGDNIIIQSANPETIYVPQYPPEMLYEPDYAPVPIDYYDTPYPSYYYPGAAFFAGAVT
FT                   GAVFGAIVDWDDWGVWGGDWGGDIDVDCDNCFNNVDIDGKVKWNDIDWKNVDRSKLKFD
FT                   RDQLQKLDRTNLKNNIKANGDNNIRNRATEINRDRLKSGPGGGASQLKDVRKSTLEGLK
FT                   AQPRRDAAARPTAKPGGGQAVAKAKSSGAKAGVNRPKGKKSSANRPAGKKKMASKAQNR
FT                   PKKPSGLGNVNSGRREVSASRRGGHSMGGGQRGGGRPQMSRGGGRPPMGGGGRGGGRGG
FT                   GGRGGGRR"
FT   gene            375708..376937
FT                   /gene="arcA1"
FT                   /locus_tag="SMa0693"
FT   CDS_pept        375708..376937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA1"
FT                   /locus_tag="SMa0693"
FT                   /product="ArcA1 arginine deiminase"
FT                   /function="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="Belongs to pfam02274, amidinotransferase family,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65025"
FT                   /db_xref="GOA:Q92ZT2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZT2"
FT                   /protein_id="AAK65025.1"
FT                   /translation="MRTVGVHSEVGKLRTVMVCRPSLAHQRLTPGNCHDLLFDDVIWVH
FT                   EAQKDHYDFVLKMEERGVEVLELHDLLSDTLIDAEARKFVLDRRVAPNVMGSQIAELMR
FT                   PWMEEMDSRRLAAFLIGGISIADLPEGQGKALMASAFHSTQFVLPPIPNTLFQRDPSCW
FT                   IYNGVTCNPMFWPARRAETLIQRAVYKFHPSFKGAAFDIWWGDSDEQFANATMEGGDVM
FT                   PIGDGILLVGMGERTTYQAVGQVAKALFKAGAATRVIGCLMPKSRAAMHLDTVFTFCDR
FT                   DVVTLFADVVDQIRCYSLFPLDDEGNFEVRQEDRPMLEVVAEALGVDKLRTIATGGNTY
FT                   EAEREQWDDGNNVVALEPGVVVAYDRNTYTNTLLRKAGIEVITIRGSELGRGRGGGHCM
FT                   TCPIWREPTD"
FT   gene            376973..377977
FT                   /gene="arcB"
FT                   /locus_tag="SMa0695"
FT   CDS_pept        376973..377977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="SMa0695"
FT                   /product="ArcB, ornithine carbamoyltransferase, catabolic"
FT                   /function="Ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="Catalyzes the reaction: carbamoyl phosphate + L-
FT                   ornithine = phosphate + L-citrulline, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65026"
FT                   /db_xref="GOA:Q92ZT1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZT1"
FT                   /protein_id="AAK65026.1"
FT                   /translation="MSFNLRNRSLLTVQDYTPREFRYLVDLARDLKRAKYARTEQEHLK
FT                   GKEICLIFEKTSTRTRCAFEVACSDQGANVTYLDPAGSQIGHKESFKDTARVLGRMYDA
FT                   IEYRGASQAGVETLAKYAGVPVYNGLTDEYHPTQMIADVMTMREHSDKPISEIKYAYIG
FT                   DTRSNMGHSLLIVGCLMGMDVRICGPRSLWPSEEYQTIAKRLKAQSGARLMITDNPREA
FT                   VEGVDFIHTDVWVSMGEPKEVWKERIQLLTPYQVNAELMAASGNPQTKFMHCLPAYHDT
FT                   ETTIGKQISDDYGMSDGLEVTDEVFESQANIAFEQAENRMHTIKALLVATLGD"
FT   gene            377980..378954
FT                   /gene="arcC"
FT                   /locus_tag="SMa0697"
FT   CDS_pept        377980..378954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="SMa0697"
FT                   /product="ArcC carbamate kinase"
FT                   /function="Carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="Belongs to pfam00696, amino acid kinase family, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65027"
FT                   /db_xref="GOA:Q92ZT0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZT0"
FT                   /protein_id="AAK65027.1"
FT                   /translation="MRVVIALGGNALLKRGEPMTAEVQRQNIKIAAEAIAPIAAEHQIV
FT                   VTHGNGPQVGLLALQGSAYKPEEAYPLDILGAETEGMIGYMLEQELGNVLPFEVPLATI
FT                   LTMVEVDGNDPGFQNPTKFVGPVYDASEAGELHQQKGWVFKQDGNKWRRVVASPIPRRI
FT                   FELRPIQWLLDKGAVVICAGGGGIPTMYERGKERTLIGVEAVIDKDLCSALLARDIEAD
FT                   LLILATDAEAVFTGWGTPERKAIFKTNPRRLGEFSFPAGSMGPKVEAACHFVNATGRVA
FT                   AIGALADIPAMVRAERGTIISSSFSDITWHVEVPIPGPASRPV"
FT   gene            379173..379643
FT                   /locus_tag="SMa0699"
FT   CDS_pept        379173..379643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0699"
FT                   /product="hypothetical protein"
FT                   /note="Has some similarity to the carboxy terminus of CBS
FT                   domain proteins; Note that in this group of CBS proteins,
FT                   the CBS domains are located in the amino terminus"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65028"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS9"
FT                   /protein_id="AAK65028.1"
FT                   /translation="MAEKQHIDLEAAPASAKDLRMQLLQRQMEEMEKERQFKAVQEQKL
FT                   TDFAGVFLEEHVTPEEVAVVRRLVANAVRDGKFEAMVYSFPSNLCTDSGRAINSADRDW
FT                   PQTLQGKAKEFYERYQKFGKPQGFKLKAMIVNFPGGMPGDVGFFLNWAPDDA"
FT   gene            380049..380483
FT                   /locus_tag="SMa0702"
FT   CDS_pept        380049..380483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0702"
FT                   /product="hypothetical protein"
FT                   /note="Has local similarity to various hypothetical
FT                   proteins and very weak, probably spurious similarity to a
FT                   short region in potassium voltage-gated channels"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65029"
FT                   /db_xref="GOA:Q92ZS8"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS8"
FT                   /protein_id="AAK65029.1"
FT                   /translation="MEAWVLFRLAIACGLIAATVAVQASFMSAGLGVFRRLEEDRRDFL
FT                   LRYPTVTTVIWIVYLIVPIALDVVLWATFYYLSRALPDFEDALYFSTVTFTTVGYGDIV
FT                   LGRDWRQVATFEAVNGWIIFGWATALMMAVIQRLHFRGND"
FT   gene            complement(380966..381907)
FT                   /gene="dgoK2"
FT                   /locus_tag="SMa0705"
FT   CDS_pept        complement(380966..381907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgoK2"
FT                   /locus_tag="SMa0705"
FT                   /product="DgoK2 2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="CATALYTIC ACTIVITY: ATP + 2-dehydro-3-deoxy-D-
FT                   galactonate = ADP + 2-dehydro-3-deoxy-D-galactonate 6-
FT                   phosphate, PATHWAY: D-galactonate degradation; second step,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65030"
FT                   /db_xref="GOA:Q92ZS7"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS7"
FT                   /protein_id="AAK65030.2"
FT                   /translation="MSNSAFEPVTVVLDWGTTGFRAFLVRSDGSLVDQKEGERGIQSIA
FT                   KGEHGRVVSEALASWRAGYGPLDIVAAGMIGSRNGWIEMPYVPTPASAADVAAAARTEG
FT                   LPEGNRITFLPGLTDPTGFPFPDVMRGEEAQLVGFGLDRDIIVVLPGTHAKWAEIRGGH
FT                   IERFRTFVTGEIYATLADHSFLSKVATAERDHAADAFAEGVALAQEESTRAGGLLTRLF
FT                   AVRTGWLAGAIAPDEMKSRLSGLIIGWEFVEARTGGWFKEGDTIAVVGDDDLVEVYGRV
FT                   AENFGVKLAPAPADAAIRGALTIWRRHRLAAK"
FT   gene            381959..382921
FT                   /locus_tag="SMa0707"
FT   CDS_pept        381959..382921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0707"
FT                   /product="dihydrodipicolinate synthase family protein"
FT                   /note="A member of the class I aldolases, which use an
FT                   active-site lysine which stablilzes a reaction intermediate
FT                   via Schiff base formation, and have TIM beta/alpha barrel
FT                   fold; The dihydrodipicolinate synthase family comprises
FT                   several pyruvate-dependent class I aldolases that use the
FT                   same catalytic step to catalyze different reactions in
FT                   different pathways and includes such proteins as
FT                   N-acetylneuraminate lyase, MosA protein,
FT                   5-keto-4-deoxy-glucarate dehydratase, trans-o-
FT                   hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-
FT                   carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-
FT                   deoxy- gluconate aldolase; The family is also referred to
FT                   as the N-acetylneuraminate lyase (NAL) family, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65031"
FT                   /db_xref="GOA:Q92ZS6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS6"
FT                   /protein_id="AAK65031.1"
FT                   /translation="MVHNIEIKSHNMDRLMRLTGILPVLPTPFTETGVDLDAMRRIVRF
FT                   ALDAGVAGVVFPGFASEVEALTGEERQALLKVVATEVGDRVPIVAGASAPTVDEVVAYG
FT                   RQALGLGITRLMIQPPKSIGAGAGAVTAFLAAAAAQLPEVEIILQNAPAPRGSDLAPEA
FT                   VLEVVRRVAAVRYVKEETLPAGPAITAILANAPEHMLGVIGGGGARYILDEYDRGACAA
FT                   MPALEIADLHAALDRSYRDGRGSEARALYVKSLPLLVLQAVYRMRLTKHVLGLRGVLDN
FT                   PIVRAPTPDLDALAVRDIERCFQECGLGSVGADKWRRTK"
FT   gene            382918..384087
FT                   /locus_tag="SMa0708"
FT   CDS_pept        382918..384087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0708"
FT                   /product="enolase"
FT                   /note="MR_like, Mandelate racemase (MR)-like subfamily of
FT                   the enolase superfamily; Enzymes of this subgroup share
FT                   three conserved carboxylate ligands for the essential
FT                   divalent metal ion (usually Mg2+), two aspartates and a
FT                   glutamate, and conserved catalytic residues, a Lys-X-Lys
FT                   motif and a conserved histidine-aspartate dyad; Members of
FT                   the MR subgroup are mandelate racemase, D-glucarate/L-
FT                   idarate dehydratase (GlucD), D-altronate/D-mannonate
FT                   dehydratase, D-galactonate dehydratase (GalD), D- gluconate
FT                   dehydratase (GlcD), and L-rhamnonate dehydratase (RhamD),
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65032"
FT                   /db_xref="GOA:Q92ZS5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:2PPG"
FT                   /db_xref="PDB:4H1Z"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS5"
FT                   /protein_id="AAK65032.1"
FT                   /translation="MSDRVKKIESFTLTLPRETPYLGKPRPGEEPNGRGYLVRKANRTV
FT                   YPTFDRSVLVRIETENGAVGWGETYGLVAPRATMEIIDDLLADFTIGRDPFDAAAIHDD
FT                   LYDLMRVRGYTGGFYVDALAAIDIALWDLAGKLAGLPVCKLLGGQRRDRIAAYISGLPE
FT                   DTRAKRAELAAAWQAKGFSSFKFASPVADDGVAKEMEILRERLGPAVRIACDMHWAHTA
FT                   SEAVALIKAMEPHGLWFAEAPVRTEDIDGLARVAASVSTAIAVGEEWRTVHDMVPRVAR
FT                   RALAIVQPEMGHKGITQFMRIGAYAHVHHIKVIPHATIGAGIFLAASLQASAALANVDC
FT                   HEFQHSIFEPNRRLLVGDMDCLNGEYVVPTGPGLGVEPSKEAQGLLKKH"
FT   gene            384120..385385
FT                   /locus_tag="SMa0709"
FT   CDS_pept        384120..385385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0709"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Most similar to the UgpB-type sugar transporters;
FT                   Belongs to pfam01547, SBP_bac_1, Bacterial extracellular
FT                   solute-binding protein; This family also includes the
FT                   bacterial extracellular solute-binding protein family
FT                   POTD/POTF, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0709"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65033"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS4"
FT                   /protein_id="AAK65033.1"
FT                   /translation="MKTIGKYAVAATVTAMLACTASAVPASAEVLKFVSWQKDEKGIGD
FT                   WWGSVIKEWEAKHPGNTIEWTKVERSAYSDTMTTLFAGGTPPDIVHLASFEFQTFANNG
FT                   WLEDLGPWVEKTGLDLDGWSGQDICKFQDTTVCIMMLYYGTIFGYNEEMLKQAGVDVPT
FT                   NYEEFLAAARATTKDLNGDGIVDQFGTGHETKGGGGQYIAEIASYLFDAGARFTSAEGE
FT                   VTIDTPEMVEGLTRWKTVVKENLTPRDLSAGEVRKLFADGKIALKVDGPWIYSIMQQGA
FT                   AKDKLKLASVPFDPPLGGSSNILAMPSEISEEKKQLVWDFIAIATSDKFQTSFATLAAS
FT                   TPPSPRADLTEAKAQIPHFHLMAQSQKAAAEHKIDRIPIGLEIQFNEFSKMIQEEAQRM
FT                   IIEDLDPAAVAKTMHEKAEALQ"
FT   gene            385360..386373
FT                   /locus_tag="SMa0710"
FT   CDS_pept        385360..386373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0710"
FT                   /product="ABC transporter, permease"
FT                   /note="best similarity to sugar transporters, but is also
FT                   similar to those transporting Fe3+, spermidines, sulfate,
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65034"
FT                   /db_xref="GOA:Q92ZS3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS3"
FT                   /protein_id="AAK65034.2"
FT                   /translation="MRRPRRFNRRLPPSAHKGKPGAPYVASGPRKKQEAIMSLRFLDLA
FT                   RPSRQHWLGYLLLLPAVALVALIIVYPLFVSLDLSFQKIGMATLSAPRKPFTLENYHKL
FT                   FASPDFWNSCWVTIKLVVVVSAACFAVGLGTALLVNNRFKGRTLARLFVALPWAVPEVI
FT                   AVVIFAWIFDSSFGLMNWLFIKLGITSQMINWFSEPTAAFWVVAITMIWKGYPFVSIMT
FT                   LAGLQSIPEDFYNAAKVDGANAFQRFWYITIPVLMPVLGVTSVLVVLWVFRDFSIIKVL
FT                   TDGGPLKATQTLSIMTYDQAFGFFNMGYASAIGIVTLVLCVVASLLMLGRKSQAMY"
FT   gene            386385..387215
FT                   /locus_tag="SMa0711"
FT   CDS_pept        386385..387215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0711"
FT                   /product="ABC transporter, permease"
FT                   /note="best similarity to sugar transporters, but is also
FT                   similar to those transporting Fe3+, spermidines, sulfate,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0711"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65035"
FT                   /db_xref="GOA:Q92ZS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS2"
FT                   /protein_id="AAK65035.1"
FT                   /translation="MQRTTLQTLSLYAGLAVVCGVLLFPIYWLFVTALSTLAEIRQLPP
FT                   SFWPAEPQWSTFAKVGTERPIFLWLWNSTLAALGSVALSMVVSVFAGYSLSRFSVKGGR
FT                   SLGLFILTAKMLPATLLVIPLFGIFRSMGLIGSLWSLVLAHATLIIPFTTWMLKGYFDT
FT                   IPRELEQAAMVDGCSPLGALFRVVLPVATPGLAATALYAFVLSWADYAYARTFLTNAQG
FT                   SWTANLGITTMKGEYVTDWNEISAAAVFIALPIILIYLFLERYLVGGLTAGAEK"
FT   gene            387217..387810
FT                   /locus_tag="SMa0713"
FT   CDS_pept        387217..387810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0713"
FT                   /product="ABC transporter, ATP-binding protein, amino
FT                   terminus"
FT                   /note="possible truncated protein, hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65036"
FT                   /db_xref="GOA:Q92ZS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS1"
FT                   /protein_id="AAK65036.1"
FT                   /translation="MAGISIQNVYKDYGALNVLKEFSLEIADGEFVVLVGPSGCGKSTM
FT                   LKILAGLEPASGGKIMIGDRDVTDLAPGDRDIAMVFQNYALYPHLTVGQNMGFGLKMRG
FT                   MPKAEIDRRVRAAAKILAVDHLLDRRPKALSGGQRQRVALGRAIVREPRAFLMDEPLPT
FT                   STPSCASIRAPRSARFTSASASRRSMSRTIRSRR"
FT   gene            387807..388304
FT                   /locus_tag="SMa0714"
FT   CDS_pept        387807..388304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0714"
FT                   /product="ABC transporter, ATP-binding protein, carboxyl
FT                   terminus"
FT                   /note="possible truncated protein, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65037"
FT                   /db_xref="GOA:Q92ZS0"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZS0"
FT                   /protein_id="AAK65037.1"
FT                   /translation="MTMADRVVIMRDGAIQQIADPDTLFAKPENLFVAGFIGSPGMNFL
FT                   RARIEAGKLTLFGQTFNAAVGVGAGEIIVGIRPEHLALGPGDVTFTVKPTLVESLGSEK
FT                   YVYFEPGEHAYRADARDEERGKGLIARIAHAGPIREGEELVLSFNASEVHLFDAKTEKA
FT                   VN"
FT   gene            388306..389286
FT                   /locus_tag="SMa0715"
FT   CDS_pept        388306..389286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0715"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /note="Most similar to UDP-glucose epimerases; NAD-
FT                   dependent epimerase/dehydratase family, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65038"
FT                   /db_xref="GOA:Q92ZR9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR9"
FT                   /protein_id="AAK65038.1"
FT                   /translation="MKVLVTGSAGRVGAFVVRRLIAGGHQVRGFDLRSAGIEDGGFDEV
FT                   IGAFDDREAAIRACEGTDAVLHLGAFMSWLASDRDKLFRANVEGTRIVLEAAAAAKVGR
FT                   FVFASSGEVYPENKPEFQPITEDHPKKPLSPYGLTKLLGEELVTFQGRVSSMETVILRF
FT                   SHTQNASELLDPESFFSGPRFFLRPKIEQQENFGNKAAADLLRAADPGRPALVLTRNEE
FT                   GRPFRMHITDTRDMAQGVLLALTHQKAAGGIFNLGATEPVDFAQILPVMAQMTGLPLLT
FT                   VDLPGAGVWYHTSNQRIRETLGFEPDWPIMRMLDEAVAEWTIRQA"
FT   gene            389265..390974
FT                   /locus_tag="SMa0717"
FT   CDS_pept        389265..390974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0717"
FT                   /product="conserved hypothetical protein"
FT                   /note="N-terminus contains a helix-turn-helix domain
FT                   similar to IclR, a bacterial transcriptional regulator;
FT                   This family of bacterial transcriptional regulators
FT                   includes the glycerol operon regulatory protein and acetate
FT                   operon repressor both of which are members of the iclR
FT                   family; The C-terminus has similarity to senescence marker
FT                   protein-30 (SMP-30)also known as regucalcin and to
FT                   gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65039"
FT                   /db_xref="GOA:Q92ZR8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR8"
FT                   /protein_id="AAK65039.1"
FT                   /translation="MDDKAGLGGLEDRGAPAGAAALAKGLALLDLIAEAPKPLRFADLQ
FT                   KMSGVPKPTLARMLKTLMVFRLIRQDETTGAYLLGHRFVELSHRVWDKFDLVSAAIPEL
FT                   DRLASELGETVALCRLDGQRVVYLEERSSGGLGVLIEVGRRVPVHCTAAGKVLLAFQEP
FT                   SFARSLAGQITYDRFTPNTITDSQALEADLVLTRARGYAVSYEEHLAGVNSVAAPIAGR
FT                   DGVPLGALVVLGPASRLDSSAIHPAGRELMAAARRITGTVGAVAISSGPRPRTRSGGFS
FT                   DVQCVLPWGAQLGEAPVWVEREKRLYWVDILHPAVHRFDPVTGKNESCNVAKLVSAVLP
FT                   TRNEGLIVASQDGVEHFDFDRGDFNPFAEPEPGLPENRLNDAKVDPSGRLWVGSMRLDV
FT                   SRPTGSLYRLTSAGEVTRAGSGFTVANGLAWSPDSSTFYFVDTVPGIIYAYDFDAREGS
FT                   IANRRVFVTVPEAEGRPDGLAVDADGGVWCAIWDGWRVNRYRPDGRLDRAVELPVPRPT
FT                   SVAFGGDELATLFITSARTRLPASTLTEAPLSGGIFACNPGARGLPTSLFGV"
FT   gene            391032..391751
FT                   /locus_tag="SMa0719"
FT   CDS_pept        391032..391751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0719"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="similarity to gluconate dehydrogenase, 3-oxoacyl-
FT                   acyl carrier protein reductase, 3-ketoacyl-ACP/CoA
FT                   reductase, acetoacetyl-CoA reductase, 2-
FT                   hydroxycyclohexanecarboxyl-CoA dehydrogenase, NodG-type
FT                   reductase, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65040"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR7"
FT                   /protein_id="AAK65040.1"
FT                   /translation="MTGSSRGIGASIAQAYAAYGARVVLHGQRPGATAEIEKAIRAAGG
FT                   DAVSIHRELSPPSAGRDLIAAAEGAAGPLDILVINASAQINGALHDVTPEDFATQIDVN
FT                   LRSTVEMLQAALPAMAERGWGRVVNIGSINQLRPKSIVSIYAATKAAQHNLIQSLARDY
FT                   ASRGVLLNTLAPGLIDTDRNAARRDGDPEAWSNYVRTLNWIGRAGRPDEMVGAALFLAS
FT                   DACSFMTGEAVVLSGGF"
FT   gene            391850..392461
FT                   /locus_tag="SMa0722"
FT   CDS_pept        391850..392461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0722"
FT                   /product="transposase, fragment"
FT                   /note="best similarity to those of IS3 family, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65041"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR6"
FT                   /protein_id="AAK65041.1"
FT                   /translation="MRFDRWNTAFCDMDFQILSLSYRTHRVTAGTQEPRSNELRSRSVE
FT                   VISGEDRFRIDADAIRSASWMKRIAGIVGRADAQAPRPGRITFRVRNHGWTEESPLSFM
FT                   HERVGGWSYVIATDGQCVEMLEDDYQQLPIGLVGRHRRCRYDPASKNRLVAACLEPFAS
FT                   AARLALEHRVNANLLCKRIKKRAEPASRPVLITGDYPSSV"
FT   gene            392499..393287
FT                   /locus_tag="SMa0723"
FT   CDS_pept        392499..393287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0723"
FT                   /product="conserved hypothetical protein"
FT                   /note="carboxyl half of protein shares similarity with
FT                   lyases including those conferring bleomycin & fosfomycin
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65042"
FT                   /db_xref="GOA:Q92ZR5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR5"
FT                   /protein_id="AAK65042.1"
FT                   /translation="MAAADLAGTCDGVRGSALEKSCAFSSPTTVSASLPNGVMLECGHV
FT                   DALMAVIGALGVHFALAMLTLGGGASRPKKKQLSVITGPLTVGASAAMLCRRKDSAKLD
FT                   VPSHYFTGELLVKPRISVLTLGVADLERSLAFYRDGLGLHTPGIVGREFEHGAVAFFDL
FT                   SNGVKLAIWDQDDLAHDSGLTKAPASSTSFSIGHNVSQRSEVDEVMEQAREAGAAIVKP
FT                   AQETFYGGYAGYFTDPDGHLWEIVWNPGNLAERTDLSPLP"
FT   gene            393877..394269
FT                   /locus_tag="SMa0726"
FT   CDS_pept        393877..394269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65044"
FT                   /db_xref="GOA:Q92ZR3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR3"
FT                   /protein_id="AAK65044.2"
FT                   /translation="MGSRARPYLPPDFTDSSVVPIGEDGKAIGFLTYDCGRESWDITLS
FT                   YVDPEHRRKHIHTALFNALRDKAKEQGNVVSITCVTHATRRKPHSWPEQQTVTNGHWVR
FT                   LSPRRLRLGHQAPEANRTHFMLGTSR"
FT   gene            394691..394891
FT                   /locus_tag="SMa0728"
FT   CDS_pept        394691..394891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0728"
FT                   /product="hypothetical protein"
FT                   /note="contains a short stretch of similarity to SMc01555"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65045"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR2"
FT                   /protein_id="AAK65045.1"
FT                   /translation="MQVKQWFGFVPDFIITLDAEYCRACGAPVFTIRGHNVEEFVGVVR
FT                   RYGANAAGVRAIVDAAPARQR"
FT   gene            395232..395579
FT                   /locus_tag="SMa0731"
FT   CDS_pept        395232..395579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0731"
FT                   /product="hypothetical protein"
FT                   /note="Amino terminus is similar to a region found in a
FT                   group of conserved hypothetical proteins; This group is
FT                   COG5556, uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65046"
FT                   /db_xref="InterPro:IPR018738"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR1"
FT                   /protein_id="AAK65046.1"
FT                   /translation="MAKAKLSDEVKTYIVQALACFDSPSVVAAAVKKEFGVDVSRQLVQ
FT                   SHEPNKKAESGRAPPQNHAVPALARPIWRADDGAGRGRRAVPCCYAGNSIINWDRDFFV
FT                   MDESGKKARRV"
FT   gene            395775..396098
FT                   /locus_tag="SMa0734"
FT   CDS_pept        395775..396098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65047"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZR0"
FT                   /protein_id="AAK65047.1"
FT                   /translation="MSGQETLVAINGEAPKTVGAGVVHQMMGSDPMTPDLKYVSSTCSG
FT                   TQKHEDAIEKQKEAAVMAGAGMFEQEKSTQESGEARRLRFARETANLMSVSQVSVLHCS
FT                   SVA"
FT   gene            396113..396385
FT                   /locus_tag="SMa0736"
FT   CDS_pept        396113..396385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65048"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZQ9"
FT                   /protein_id="AAK65048.1"
FT                   /translation="MKGLDDADIVVAPPKDLLDSTMSAADFAQLFGVYTQGGMSWETFY
FT                   ERGQADGIFRLSGTRKTNTPSSILRAQRTSGRQPSSDLEHSWPFV"
FT   gene            complement(396650..396853)
FT                   /gene="cspA6"
FT                   /locus_tag="SMa0738"
FT   CDS_pept        complement(396650..396853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA6"
FT                   /locus_tag="SMa0738"
FT                   /product="CspA6 cold shock protein"
FT                   /note="Contains a cold shock DNA binding domain (pfam00313)
FT                   or RNA-binding domain (smart00357, CSP)that functions as a
FT                   RNA-chaperone in bacteria and is involved in regulating
FT                   translation in eukaryotes; Contains sub- family of
FT                   RNA-binding domains in the Rho transcription termination
FT                   factor, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65049"
FT                   /db_xref="GOA:Q92ZQ8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZQ8"
FT                   /protein_id="AAK65049.1"
FT                   /translation="MATGTVKFFAQDKGFGFITPDNGGPDVFVHISALGFGGSLQDGQK
FT                   VSYELGQDRKTGKSKAENVSIL"
FT   gene            complement(396954..397382)
FT                   /locus_tag="SMa0739"
FT   CDS_pept        complement(396954..397382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0739"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein SMb20913 of
FT                   Sinorhizobium meliloti 1021"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65050"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZQ7"
FT                   /protein_id="AAK65050.1"
FT                   /translation="MTKTEDKTAEFREARVMRTLEDGVGTAIEVDLAVMHPRQRRTYAG
FT                   PEQYRGPVEVRGVQELAKELPNPADLCYLRCRDGVAVSGDRAIRYADALLRSRLSCGGP
FT                   PATATGGKQKARRYHFEPLKHVGASRHPNWEQAFEQNT"
FT   gene            397665..398045
FT                   /locus_tag="SMa0740"
FT   CDS_pept        397665..398045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65051"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZQ6"
FT                   /protein_id="AAK65051.1"
FT                   /translation="MFKSSGSHLAGKLEIAAPNVNARRPSCLLRTRIRAMAVPDPVQSI
FT                   AALDEPPIYFAAVGAKTDTDEPLISIALSDVAPDGRDAARIDQARLPRPFRTDRCRHLR
FT                   LSIFANFPAHLHRAAHTVACDF"
FT   gene            complement(398183..398623)
FT                   /locus_tag="SMa0742"
FT   CDS_pept        complement(398183..398623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65052"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZQ5"
FT                   /protein_id="AAK65052.1"
FT                   /translation="MRGGRYAERDICSKSQGRSRAVKTLISHRGTKPAVTLVARSRVSG
FT                   RMESGPFDGRYKPPQALANTPQIVQLLRVICLRYIFEIVDDEGQSRAYVASHMYRKADK
FT                   LIVLHRGAEVGIDICRICDWCAVDEDEAQRAGTAQTGWLHDC"
FT   gene            complement(399043..400680)
FT                   /gene="groEL2"
FT                   /locus_tag="SMa0744"
FT   CDS_pept        complement(399043..400680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL2"
FT                   /locus_tag="SMa0744"
FT                   /product="groEL2 chaperonin"
FT                   /EC_number="1.3.1.-"
FT                   /note="Chaperonins are involved in productive folding of
FT                   proteins; They share a common general morphology, a double
FT                   toroid of 2 stacked rings, each composed of 7-9 subunits;
FT                   The symmetry of type I is seven-fold and they are found in
FT                   eubacteria (GroEL) and in organelles of eubacterial descent
FT                   (hsp60 and RBP); With the aid of cochaperonin GroES, GroEL
FT                   encapsulates non-native substrate proteins inside the
FT                   cavity of the GroEL-ES complex and promotes folding by
FT                   using energy derived from ATP hydrolysis, high confidence
FT                   in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65053"
FT                   /db_xref="GOA:Q92ZQ4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZQ4"
FT                   /protein_id="AAK65053.1"
FT                   /translation="MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGA
FT                   KAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILL
FT                   HEKKLSNLQAMLPVLEAVVQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKS
FT                   DIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDA
FT                   LNATRAAVQEGIVPGGGVALLRSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAG
FT                   DEASIVVGKILEKNTDDFGYNAQTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITT
FT                   EAMIAELPKKDAPAMPGGMGGMGGMDMM"
FT   gene            complement(400756..401052)
FT                   /gene="groES2"
FT                   /locus_tag="SMa0745"
FT   CDS_pept        complement(400756..401052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES2"
FT                   /locus_tag="SMa0745"
FT                   /product="groES2 chaperonin"
FT                   /note="Chaperonin 10 Kd subunit (cpn10); Cooperates with
FT                   chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the
FT                   folding and assembly of proteins and is found in
FT                   eubacterial cytosol, as well as in the matrix of
FT                   mitochondria and chloroplasts; It forms heptameric rings
FT                   with a dome-like structure, forming a lid to the large
FT                   cavity of the tetradecameric cpn60 cylinder and thereby
FT                   tightly regulating release and binding of proteins to the
FT                   cpn60 surface, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0745"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65054"
FT                   /db_xref="GOA:Q92ZQ3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZQ3"
FT                   /protein_id="AAK65054.1"
FT                   /translation="MASTDFRPLHDRVVVRRVESEEKTKGGVIIPDTAKEKPQEGEIVA
FT                   VGSGARDESGKVVPLDVKAGDRILFGKWSGTEVKINGEDLLIMKEADIMGVIG"
FT   gene            401607..401768
FT                   /locus_tag="SMa0747"
FT   CDS_pept        401607..401768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0747"
FT                   /product="hypothetical protein"
FT                   /note="has weak similarity to small region in class II
FT                   transposases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0747"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65055"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZQ2"
FT                   /protein_id="AAK65055.1"
FT                   /translation="MRLPGLSLSEKVPAAKDKPAKLAQKDRDARWTVKYSKVNATDENA
FT                   VIWRDQAV"
FT   gene            402138..402587
FT                   /locus_tag="SMa0748"
FT   CDS_pept        402138..402587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0748"
FT                   /product="Transcriptional regulator, MucR family"
FT                   /note="Belongs to MucR/Ros family of transcriptional
FT                   regulators, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0748"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65056"
FT                   /db_xref="GOA:Q92ZQ1"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZQ1"
FT                   /protein_id="AAK65056.2"
FT                   /translation="MTESHSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGK
FT                   TSEPTKTPATVEEQRPAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREK
FT                   WKLPADYPMVAPNYARKRSELARATGLGKKSAANLSPSLQAVRSA"
FT   gene            complement(402820..403107)
FT                   /locus_tag="SMa5003"
FT   CDS_pept        complement(402820..403107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5003"
FT                   /product="hypothetical protein"
FT                   /note="Has weak similarity to short length of sequence
FT                   found in carboxy-terminus of transposases; Probable protein
FT                   fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07974"
FT                   /db_xref="GOA:B3KLX6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX6"
FT                   /protein_id="ACF07974.1"
FT                   /translation="MGMNRVVGGGGVQGWWRSTSRWSAMARGGTIHRAALACDQIRGGL
FT                   YHAYKTVPEALAGIGRYLTFYNRRHPHSSLDRQTPDQAYFNTLTPMMAAA"
FT   gene            complement(403178..404056)
FT                   /locus_tag="SMa0750"
FT   CDS_pept        complement(403178..404056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0750"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Contains a LysR-type HTH and substrate binding
FT                   domain, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0750"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65057"
FT                   /db_xref="GOA:Q92ZQ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZQ0"
FT                   /protein_id="AAK65057.1"
FT                   /translation="MPRPYEFSSMTALVCFEAAARNASFKKAAQEMNVTPAAISHQIKA
FT                   LEMDLKCSLFLRHHRGVELTEKGALLFVVIQRGFETISETLTQIRERPETVDVTIGATT
FT                   AFSSLWLTPKISAFWKIHPSITVSQVVSDVPGMTSRCDLTIHYGNPQENGVEYRKLFQD
FT                   HIIALGTTRFAAEHRIARLEDLLKAPLIHSSSNETGWTAWDDWFAVLGCPAPKGRSFYV
FT                   NNYMIALQAAQDDVGAVLGWDGLVGSLVNEGRLVKLVQESIPSPVGFHLRIHRRATAKA
FT                   RLFADWLVEAT"
FT   gene            404204..405442
FT                   /locus_tag="SMa0751"
FT   CDS_pept        404204..405442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0751"
FT                   /product="Ring-hydroxylating dioxygenase"
FT                   /function="Phenylpropionate dioxygenase and related ring-
FT                   hydroxylating dioxygenases, large terminal subunit"
FT                   /note="Likely required for utilization of stachydrine,
FT                   specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65058"
FT                   /db_xref="GOA:Q92ZP9"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="PDB:3VCA"
FT                   /db_xref="PDB:3VCP"
FT                   /db_xref="PDB:4QUP"
FT                   /db_xref="PDB:4QUQ"
FT                   /db_xref="PDB:4QUR"
FT                   /db_xref="PDB:5HL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP9"
FT                   /protein_id="AAK65058.1"
FT                   /translation="MTANPTSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWL
FT                   YAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKL
FT                   VCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFA
FT                   QLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEV
FT                   AGVQADGGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAV
FT                   SRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVE
FT                   GVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAAS
FT                   LERALAPRQVAAE"
FT   gene            405447..406508
FT                   /locus_tag="SMa0752"
FT   CDS_pept        405447..406508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0752"
FT                   /product="oxidoreductase"
FT                   /function="Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1"
FT                   /note="Likely required for utilization of stachydrine;
FT                   Similar to flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1; Contains FAD and NAD(P)-binding
FT                   domains and a 2Fe-2S iron-sulfur cluster binding domain,
FT                   function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0752"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65059"
FT                   /db_xref="GOA:Q92ZP8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP8"
FT                   /protein_id="AAK65059.1"
FT                   /translation="MTQFKQLSFWSDAEPLECVTRTPEAPNVVTFSFQSPSGALFNHDP
FT                   GQFVTLELPAPGGPLYRTYTISSAPSRPTALTITVKAQDGSTGTRWMLDNLHKGMRIRA
FT                   IGPAGKFSIVHHPADKYLFISAGSGITPMVAMTTWLYDSGREPDVVFINCARRPSEIIL
FT                   RDRMELMASRIVGIDLKWVVEEPDPFRSWTGYRGMFNQIMLGLMAQDYLEREVFCCGPE
FT                   PFMRAVREALAGLGYDMSRYHQESFTAEPGHAEDVPEDVIPDEQNHAEIAFALSGVTTR
FT                   CSETDTILAAAKAAGLVIPSGCSMGICGTCKVRKTEGQVHMVHNGGITDEDVEDGYILA
FT                   CCSKPLRRVSVEA"
FT   gene            406804..407496
FT                   /locus_tag="SMa0753"
FT   CDS_pept        406804..407496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0753"
FT                   /product="oxidoreductase"
FT                   /note="Contains an amino terminal flavin reductase like
FT                   domain; This is a flavin reductase family consisting of
FT                   enzymes known to be flavin reductases as well as various
FT                   oxidoreductase and monooxygenase components; Similar to S;
FT                   meliloti SMa0758, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0753"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65060"
FT                   /db_xref="GOA:Q92ZP7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP7"
FT                   /protein_id="AAK65060.1"
FT                   /translation="MKADVFDPRALREAFGAFPTAVTVITASDPAGRPVGFTANSFTSV
FT                   SLDPPLLLVCVAKTARDYSTMTAAEHFAINILSEAQKDVSIKFARPLEDRFAAVDWARA
FT                   PNGCPIFAQVAAWFECSMHDVIEAGDHVMMVGRVTAFKSSGLNGLGYARGGYFAPSVAA
FT                   KANSSAAGGEIGAVAVLERHAALFPLGDQNLSLPRYSAAGGDPAKTLASQLERSGLSVH
FT                   DWLSLLDL"
FT   gene            407780..408106
FT                   /locus_tag="SMa0754"
FT   CDS_pept        407780..408106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0754"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65061"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP6"
FT                   /protein_id="AAK65061.1"
FT                   /translation="MRVPRSSIWIERHKRAAGFWLAEDYFTGTKCIGVILRAGGEVLRN
FT                   RDCAGQGHSARQPRDYRSGEEVTSARQADWEKLRRMPADDTLVAPGWWFRSHQVWYLQA
FT                   RGRW"
FT   gene            409254..410186
FT                   /gene="nodD2"
FT                   /locus_tag="SMa0757"
FT   CDS_pept        409254..410186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodD2"
FT                   /locus_tag="SMa0757"
FT                   /product="NodD2 nod box-dependent transcription activator"
FT                   /note="belongs to the LysR family of transcriptional
FT                   regulators, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0757"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65062"
FT                   /db_xref="GOA:P08719"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08719"
FT                   /protein_id="AAK65062.1"
FT                   /translation="MRFRGLDLNLLVALDALMTERKLTAAARRVKLSQPAMSAAIARLR
FT                   TYFGDELFSMQGRELIPTPRAEALAPAVRDALLHIQLSVIAWDPINPAQSDRRFRIILS
FT                   DFMTLVFFERVVERLAREAPGVSFELLPLDDDPYELLRRGDVDFLVLPDLFMSSAHPKA
FT                   KLFAEALVCVGCPTNEQLLGELSFEKYMSMGHVAAQFGRALKPSFEQWLLLEHGFKRRV
FT                   ELVVPGFTLIPPLLPHTNRIAIIPLRLVKYFEQTIPLRIVKHPLPPLWFTEAVQWPALH
FT                   NKDPGNIWMREILLQEASRSEFQGETSLE"
FT   gene            411107..411682
FT                   /locus_tag="SMa0758"
FT   CDS_pept        411107..411682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0758"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family;
FT                   This family consists of enzymes known to be flavin
FT                   reductases as well as various oxidoreductase and
FT                   monooxygenase components; Similar to SMA0753 of S; meliloti
FT                   pSyma"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0758"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65063"
FT                   /db_xref="GOA:Q92ZP5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP5"
FT                   /protein_id="AAK65063.2"
FT                   /translation="MKADVFDARALREAFGAFPTAVTAITASDPAGRPVGFTANSFTSV
FT                   SLDPPLLLVCVAKTARDYSTMTAAEHFAINILSEAQKDVSIKFARPLEDRFAAVDWARA
FT                   PNGCPIFAQVAAWFECSMHDVIEAGDHVMMVGRVTAFKSSGLNGLGYARGGYFAPSVAA
FT                   KANSSAAGGEIGAVAVLERHAALFPLGD"
FT   gene            411913..412314
FT                   /locus_tag="SMa0759"
FT   CDS_pept        411913..412314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0759"
FT                   /product="hypothetical protein"
FT                   /note="partial, weak similarity to response regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65064"
FT                   /db_xref="GOA:Q92ZP4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP4"
FT                   /protein_id="AAK65064.1"
FT                   /translation="MVVEVKKAGAVDFIEKPFENTVIIEVIERASEHLVVPQADADEVN
FT                   DIRARLQTLSERERQVLSAVVADLPNKSIAYDLDIQSSLRRGASRERHGQNEGEEPSPP
FT                   RANGSHRWLRSFLSRRVDLAQCGALPQAA"
FT   gene            412363..412710
FT                   /gene="fixT2"
FT                   /locus_tag="SMa0760"
FT   CDS_pept        412363..412710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixT2"
FT                   /locus_tag="SMa0760"
FT                   /product="FixT2 anti-kinase protein"
FT                   /note="FixT prevents transcription of the intermediate key
FT                   regulatory genes nifA and fixK by counteracting the
FT                   activity of the FixLJ two-component system under otherwise
FT                   inducing microoxic conditions; FixT acts as an inhibitor of
FT                   the sensor hemoprotein kinase FixL, preventing the
FT                   production or the accumulation of its phosphorylated form,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0760"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65065"
FT                   /db_xref="GOA:Q92ZP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP3"
FT                   /protein_id="AAK65065.1"
FT                   /translation="MLDGKTIIVVAADQGLRRSVAFALEVEGYSTESYDTVQKAEASSG
FT                   EALCTILDDEILKSETVAATQLLKNLGRRAILLVDGLSAPQPPADYTTLTKPFSGADLL
FT                   GVINSPTEAAK"
FT   gene            412790..413425
FT                   /gene="fixK2"
FT                   /locus_tag="SMa0762"
FT   CDS_pept        412790..413425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixK2"
FT                   /locus_tag="SMa0762"
FT                   /product="FixK2 transcriptional regulator"
FT                   /note="Belongs to the Crp/Cap family of transcriptional
FT                   activators; Transcription of fixK is activated by FixJ
FT                   during symbiotic or microaerobic conditions; FixK then
FT                   activates transcription of a large group of genes including
FT                   fixNOQP, fixT2 and fixM, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0762"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65066"
FT                   /db_xref="GOA:Q92ZP2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP2"
FT                   /protein_id="AAK65066.1"
FT                   /translation="MYAAAQAKPQSIEVEHLGPAPMSGPHLVATYKPGREIYAQGDLND
FT                   KCYQVSTGAVRVYRLLSDGRRQVVSFHLPGEMFGFEAGSNHSFFAEAITETTLAIFGRR
FT                   NMQERSRELLALALTGMARAQQHLLVIGRQCAVERIAAFLVDLCERQGGGRQLRLPMSR
FT                   QDIADYLGLTIETVSRVVTKLKERSLIALRDARTIDIVRLEALRSLCS"
FT   gene            413437..414084
FT                   /locus_tag="SMa0763"
FT   CDS_pept        413437..414084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0763"
FT                   /product="hypothetical protein"
FT                   /note="Contains a domain similar to those found in flavin-
FT                   nucleotide-binding proteins; Has local similarity to
FT                   SMA1151 and SMA1223 of S; meliloti pSyma"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0763"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65067"
FT                   /db_xref="GOA:Q92ZP1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP1"
FT                   /protein_id="AAK65067.1"
FT                   /translation="MRAQPSPRVAAADRAWWEQGKKRCSYGRFLVLNVTDSRRWRSGAI
FT                   GLLQGRPALHRADHVRALGQLHLLFFYVRPENRLDAQQSKMSLQIAEFASNRQWKSVVV
FT                   TGRYQELPATQGCHHERIHAWSLREKKPNWWKPGGHKPVAKPSAHIFVCVVMDEIAGRA
FT                   ASAAVAGVLRAELASRPQRARVTGPAKGPGCRVSDVAVTPVSEARAATLPLS"
FT   gene            414187..415806
FT                   /gene="fixN2"
FT                   /locus_tag="SMa0765"
FT   CDS_pept        414187..415806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixN2"
FT                   /locus_tag="SMa0765"
FT                   /product="FixN2 cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="Cytochrome cbb3 oxidase subunit I; Cytochrome cbb3
FT                   oxidase, the terminal oxidase in the respiratory chains of
FT                   proteobacteria, is a multi-chain transmembrane protein
FT                   located in the cell membrane; Like other cytochrome
FT                   oxidases, it catalyzes the reduction of O2 and
FT                   simultaneously pumps protons across the membrane; Found
FT                   mainly in proteobacteria, cbb3 is believed to be a modern
FT                   enzyme that has evolved independently to perform a
FT                   specialized function in microaerobic energy metabolism;
FT                   Subunit I contains a heme-copper binuclear center (the
FT                   active site where O2 is reduced to water) formed by a high-
FT                   spin heme and a copper ion; It also contains a low-spin
FT                   heme, believed to participate in the transfer of electrons
FT                   to the binuclear center; The cbb3 operon contains four
FT                   genes (fixNOQP), high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0765"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65068"
FT                   /db_xref="GOA:Q92ZP0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZP0"
FT                   /protein_id="AAK65068.1"
FT                   /translation="MKHTVEMVVLAVGAFLALVGAGLAQDRLFGAHMWVLFFVLLGGTL
FT                   VLMRRVDFRPAAAGRRAGETEYFDEVVKYGVIATVFWGVVGFLVGVVVALQLAFPDLNV
FT                   EPWFNFGRVRPLHTSAVIFAFGGNALIATSFYVVQRTSRARLFGGDLGWFVFWGYQLFI
FT                   VLAATGYLLGITQSREYAEPEWYVDLWLTIVWVAYLAVFLGTVLMRKEPHIYVANWFYL
FT                   AFIVTIAMLHIVNNLAVPVSFMGSKSYSAFAGVQDALTQWWYGHNAVGFFLTAGFLAMM
FT                   YYFIPKQVNRPVYSYRLSIIHFWALIFMYIWAGPHHLHYTALPDWAQTLGMVFSIMLWM
FT                   PSWGGMINGLMTLSGAWDKIRTDPVVRMMVMAVAFYGMATFEGPMMSIKTVNSLSHYTD
FT                   WTIGHVHSGALGWNGLITFGAVYYLVPKLWNRERLYSLQMVNWHFWLATLGIVVYAATM
FT                   WVAGIQQGLMWREYDDQGFLVYSFAESVAAMFPYYVMRAAGGALFLAGALVMAFNVTMT
FT                   ILGRVRDEAAALDAAPLPAPAE"
FT   gene            415818..416549
FT                   /gene="fixO2"
FT                   /locus_tag="SMa0766"
FT   CDS_pept        415818..416549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixO2"
FT                   /locus_tag="SMa0766"
FT                   /product="FixO2 cytochrome c oxidase subunit"
FT                   /EC_number="1.9.3.1"
FT                   /note="FixO is a membrane bound mono-heme constituent of
FT                   the fixNOPQ complex; Cytochrome cbb3 oxidase, the terminal
FT                   oxidase in the respiratory chains of proteobacteria, is a
FT                   multi-chain transmembrane protein located in the cell
FT                   membrane; Like other cytochrome oxidases, it catalyzes the
FT                   reduction of O2 and simultaneously pumps protons across the
FT                   membrane; Found mainly in proteobacteria, cbb3 is believed
FT                   to be a modern enzyme that has evolved independently to
FT                   perform a specialized function in microaerobic energy
FT                   metabolism; The cbb3 operon contains four genes (fixNOQP),
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0766"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65069"
FT                   /db_xref="GOA:Q92ZN9"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN9"
FT                   /protein_id="AAK65069.1"
FT                   /translation="MSILDKHALLERNATLLLVGSLLVVSIGGIVEIAPLFYLENTIEK
FT                   VEGMRPYSPLELAGRDIYVREGCYVCHSQMIRPFRDEVERYGHYSLAAESMYDHPFQWG
FT                   SKRTGPDLARVGDRYSNEWHVQHMIEPRSVVPESVMPSYAFLKDTPLEVTNIAMNLEAN
FT                   RAVGVPYTDEMIDNATADLKAQADPDADASGVEARYPKAKLGDFDGDPQRLSEMDALIA
FT                   YLQMLGTLVDFSTYDDTTGYR"
FT   gene            416561..416713
FT                   /gene="fixQ2"
FT                   /locus_tag="SMa0767"
FT   CDS_pept        416561..416713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixQ2"
FT                   /locus_tag="SMa0767"
FT                   /product="FixQ2 nitrogen fixation protein"
FT                   /EC_number="1.9.3.1"
FT                   /note="Cytochrome cbb3 oxidase, the terminal oxidase in the
FT                   respiratory chains of proteobacteria, is a multi-chain
FT                   transmembrane protein located in the cell membrane; Like
FT                   other cytochrome oxidases, it catalyzes the reduction of O2
FT                   and simultaneously pumps protons across the membrane; Found
FT                   mainly in proteobacteria, cbb3 is believed to be a modern
FT                   enzyme that has evolved independently to perform a
FT                   specialized function in microaerobic energy metabolism; The
FT                   cbb3 operon contains four genes (fixNOQP); FixQ is a single
FT                   transmembrane helix protein; It has been shown to protect
FT                   the core complex from proteolytic degradation by serine
FT                   proteases, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0767"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65070"
FT                   /db_xref="GOA:Q92ZN8"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN8"
FT                   /protein_id="AAK65070.1"
FT                   /translation="METYTAMRHFADSWGLLAMTLFFLGVVLFIFRPGAKKSAAQASAI
FT                   PLNED"
FT   gene            416717..417580
FT                   /gene="fixP2"
FT                   /locus_tag="SMa0769"
FT   CDS_pept        416717..417580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixP2"
FT                   /locus_tag="SMa0769"
FT                   /product="FixP2 Diheme c-type cytochrome"
FT                   /EC_number="1.9.3.1"
FT                   /note="Cytochrome cbb3 oxidase, the terminal oxidase in the
FT                   respiratory chains of proteobacteria, is a multi-chain
FT                   transmembrane protein located in the cell membrane; Like
FT                   other cytochrome oxidases, it catalyzes the reduction of O2
FT                   and simultaneously pumps protons across the membrane; Found
FT                   mainly in proteobacteria, cbb3 is believed to be a modern
FT                   enzyme that has evolved independently to perform a
FT                   specialized function in microaerobic energy metabolism; The
FT                   cbb3 operon contains four genes (fixNOQP), high confidence
FT                   in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0769"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65071"
FT                   /db_xref="GOA:Q92ZN7"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN7"
FT                   /protein_id="AAK65071.1"
FT                   /translation="MTDKHIDEISGVETTGHEWDGIRELNNPLPRWWVYSFYATIIWAI
FT                   GYAVAYPSWPMLTESTKGVLGYSSRAEVSAELAEAKAAQAGNLERIASSAVEDIMANPE
FT                   LKQFAITIGASAFKVNCAQCHGSGTAGGKGFTNLNDDEWLWGGKPEEIYQTIAHGIRYS
FT                   GDGETRVSEMPAFTDTLAPREVRATAAYVASLTGTPSNPALVEPGKQLFAENCASCHGA
FT                   DAKGTREFGAPNLADAIWLNGEGEQAIIDQMKSPKHGVMPAWLQRIGDPVVKELAVFVH
FT                   SLGGGE"
FT   gene            417769..418242
FT                   /locus_tag="SMa0771"
FT   CDS_pept        417769..418242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0771"
FT                   /product="hypothetical protein"
FT                   /note="Contains very short region (; 50 amino acids) with
FT                   similarity to FixI"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0771"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65072"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN6"
FT                   /protein_id="AAK65072.1"
FT                   /translation="MHHHHRDGVAGKIQVEQSKRARVNLSTRRVSIVWKEEVAGKRSDP
FT                   GELVRAISERGHETHIFTHGEGEGDAVGEPISVSSGDAVEAGTLNLTGPLVAPGDGKRA
FT                   QLLPCRDHGADGGGRRREGAKLVSSTARIKVIQTIDFTNHQVCSIGDKAKEFK"
FT   gene            418345..418896
FT                   /gene="nodL"
FT                   /locus_tag="SMa0772"
FT   CDS_pept        418345..418896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodL"
FT                   /locus_tag="SMa0772"
FT                   /product="NodL Nod factor acetyltransferase"
FT                   /note="Similar to acetyltransferases (belongs to the
FT                   isoleucine patch superfamily), high confidence in function
FT                   and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0772"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65073"
FT                   /db_xref="GOA:P28266"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28266"
FT                   /protein_id="AAK65073.1"
FT                   /translation="MTRTQKEKMLAGEMYNAADPEIQADLLAAGAWLKRYNSTLGDSAE
FT                   QWHLFLREGLGEVGPGAVIRPPFHCDYGFNISIGAHAYMNFNCVILDVAKVTIGDGTAI
FT                   GPAVQIYTADHPDDPEQRQAGLQLGRPVRIGKHVWIGGGAIILPGVTIGDHAVVGAGSV
FT                   VTRDVPPGAKVMGSPARVRG"
FT   gene            419284..420714
FT                   /gene="noeA"
FT                   /locus_tag="SMa0773"
FT   CDS_pept        419284..420714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="noeA"
FT                   /locus_tag="SMa0773"
FT                   /product="NoeA host specific nodulation protein"
FT                   /note="Host specific nodulation protein; Required for
FT                   nodulation of Medicago littoralis; Has weak similarity to
FT                   PrmA, Ribosomal protein L11 methyltransferase, function
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0773"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65074"
FT                   /db_xref="GOA:Q52892"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q52892"
FT                   /protein_id="AAK65074.1"
FT                   /translation="MARMADSKLVAAAPRPGRVAGSFRDPSGQVFHFQDRILRTMDSAA
FT                   AIEFASAERVMRQLVDEGRLVDFSDAEPSLHQLFQGSIARVLQHPLLEQITYPYEWSFA
FT                   GLKAAALFHLQLQLDLLDQGFCLSDATAYNVQFEGSRPTFIDHLSIKPYRDGQLWYGHK
FT                   QFCEQFLVPLLLRSVFDITHHSWYRGNLEGVPSADFVKLLSTRHWFSHKLFMHIILPAK
FT                   LQSSRTSQTKVDLGDSRARRLPKDAFRAMLAQLYSWISGLKVDVGKQSVWQGYAANNTY
FT                   TATQRSDKGQYVAEFVAQHKPRTIIDLGCNTGDFSYVALENGAEKAIGFDFDPHALDAA
FT                   FDRSVQTSKNFLPLYLDARNPSPSQGWGERERQGFSSRFSADAVLALAFEHHLAIAHNV
FT                   PLAEVVAWVTQVAPKGIIEFVPKEDETVRRMLAGREDIFSDYNEEAFASALSQKARVVN
FT                   KHLIPGSKRTLYTFERSE"
FT   gene            420721..422382
FT                   /gene="noeB"
FT                   /locus_tag="SMa0774"
FT   CDS_pept        420721..422382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="noeB"
FT                   /locus_tag="SMa0774"
FT                   /product="NoeB host specific nodulation protein"
FT                   /note="Host specific nodulation protein; Required for host
FT                   specific nodulation of Medicago littoralis, function
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0774"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65075"
FT                   /db_xref="GOA:Q52893"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q52893"
FT                   /protein_id="AAK65075.1"
FT                   /translation="MKRIVLLLSPLVILLSPIIDAFQGVYIDPRSDAGYAVIACVAIIG
FT                   LALGMIATFCYKRGAVGNVVTAGTLAVTLFLFGDLSYGVFWRLADHIGMEGAAALAFAG
FT                   LVVLILILFKLMAAVPRMMAAFAVALLGSTVLDRGLITEASAEEPAPAVIYIVTDEMIG
FT                   ISGIDTRLPHGAEAKAALSRVFQKHGFRLHSKAFSRHILTQVSVPAALNMDYSYNFPGD
FT                   RSHYAYPGEVTKFKVLSLFNLWHRQGLSVNVFQSAHLDFCKTEALVDCHTFASFDGSRF
FT                   IQRQRTEGGPYRDVPPASASLADVKALVEGNRQSLAMAAVGFVASNLLETKETALQEWH
FT                   PRSYDQLAFPYWLGQFQNMILDKGRGNAFFAHFLFPHSPSVYNKDCKPTNRWVERSYLT
FT                   EVRGLAGQELDEARVKEYGFYFAQTLCLAKQLDKFFNAVLSDKRFQDATIVVHGDHGSR
FT                   ISAGRNVETMSPRDYVDNYSALYAVRKPGVATGTDYKLHSVQWLNASLFRGNVSEVAPT
FT                   VVGSIQGKSDDPAVYAPITDPDHVAIMPMHDFDASH"
FT   gene            complement(422708..423034)
FT                   /locus_tag="SMa0775"
FT   CDS_pept        complement(422708..423034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0775"
FT                   /product="hypothetical protein"
FT                   /note="weak similarity in central region to a region in S;
FT                   meliloti SMa2049"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0775"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65076"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN5"
FT                   /protein_id="AAK65076.1"
FT                   /translation="MLLSEVLLVRSEHVVSSAHDVFERIVESLDPLAGGRTPSFAEEKM
FT                   PNETQSASVPGNTTLSGLIISVPETAGGPFPPLPLENKGEFVDVDSCAVERTVATQTCF
FT                   SLLR"
FT   repeat_region   complement(423316..424975)
FT                   /rpt_family="ISRm23 fragment"
FT                   /note="Sma4004; 96% identical over length to ISRm23 of S.
FT                   meliloti pSyma"
FT   gene            complement(423440..424177)
FT                   /locus_tag="SMa0776"
FT   CDS_pept        complement(423440..424177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0776"
FT                   /product="TRm23b IS ATP-binding protein"
FT                   /note="This protein contains an ATP/GTP binding P-loop
FT                   motif; It is found associated with IS21 family insertion
FT                   sequences; The function of this protein is unknown, but it
FT                   may perform a transposase function, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0776"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65077"
FT                   /db_xref="GOA:Q92ZN4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN4"
FT                   /protein_id="AAK65077.1"
FT                   /translation="MLAHPTLDKLNAMGLAGMAKAFGELVANGEAEHLSHAEWLGLLLE
FT                   REWSSRYDRKLAARLRFAKLRHQATPEDVDYRADRGLDRALFMKLLGGDWINAHDNLAI
FT                   CGPSGVGKSWLACALGHKACRDDRSVLYQRVPRLFAQLALARGDGRYARLQRTLGHVQL
FT                   LILDDWGLEPLNEQARHDLLEILEDRYGRRSTIITSQLPVSAWHSVIGDPTYADAILDR
FT                   LVHNAHRVELSGDSLRRNLPRKA"
FT   gene            complement(424190..425086)
FT                   /locus_tag="SMa0779"
FT   CDS_pept        complement(424190..425086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0779"
FT                   /product="transposase, fragment"
FT                   /note="Possible truncated transposase TRm23a, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0779"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65078"
FT                   /db_xref="GOA:Q92ZN3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN3"
FT                   /protein_id="AAK65078.1"
FT                   /translation="MACRQNEALSAPRMERVRNLKLYAGLSVSTNCSPGLERRRKWKLR
FT                   FVSSNVGCWAGCAIAHSIVWPRSMRRLANCSMISMISAFCAVSAPPAANCSRSLIVRPL
FT                   RPLPVERYVFAEWRIRRAGLDYHVEIERHYYSVPYRFAREQVEARITANTIEIFHKGER
FT                   IAAHRRSSGNGKHTTIPDHMPSAHRRFADWTIERIEREASAMGPDVALLCERILADRPH
FT                   PEQGFRACLGIIRLNKSFGRDRVNAACGRALEIGARTYGSVRSILDNHLDRTAASNGAA
FT                   PHEPIHHANIRGPRYYH"
FT   gene            424904..425281
FT                   /locus_tag="SMa5028"
FT   CDS_pept        424904..425281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5028"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to hypothetical proteins from
FT                   Rhizobium sp; NGR234 plasmid pNGR234a and partial
FT                   similarity to ISRm30 transposase of S; meliloti; Possible
FT                   truncated ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5028"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07975"
FT                   /db_xref="InterPro:IPR035315"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX7"
FT                   /protein_id="ACF07975.1"
FT                   /translation="MCDGAAGPTANVRRYEPQLPLSPSFKSRTAVRTDAQARIEFEVTH
FT                   PFHPWRGQRFVLSTRQQNWGEDRVMFYDAQGRLRSLPASWTDVNEADLFSQVAAGRSFS
FT                   RPDDLSALASLIDRIKRRQEE"
FT   repeat_region   424972..428289
FT                   /rpt_family="ISRm30"
FT                   /note="SMa4015; nucleotide sequence is 99% identical to a
FT                   region on the S. meliloti chromosome (SMc04870)"
FT   gene            425462..425911
FT                   /locus_tag="SMa0781"
FT   CDS_pept        425462..425911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0781"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identical to S; meliloti chromosomal protein
FT                   Smc02302"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0781"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65079"
FT                   /db_xref="GOA:Q925W8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q925W8"
FT                   /protein_id="AAK65079.1"
FT                   /translation="MTKEGKPDRLRQMGALNPKPEGVRAPWFREAGFFDPLDLVQVKYE
FT                   MLRHAREEGTNKADAAALFGLSRQTYYQAEAAFERDGMSGLLPRTRGPKSAHKLTGEVM
FT                   RLVEEHLDANGQLQARSLADLVHARLGISVHPRSIERAVARKKKR"
FT   gene            425934..426203
FT                   /locus_tag="SMa0783"
FT   CDS_pept        425934..426203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0783"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to two small hypothetical proteins in
FT                   Rhizobium spp; NGR234"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0783"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65080"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN2"
FT                   /protein_id="AAK65080.1"
FT                   /translation="MSESGKDVYEALRADVICGTACARRMGAIVFHGLWRGLAVLIAPH
FT                   QSAVARQQSAPRFKTTSMVAHDRQLVHMLANMVLAAETGGSHVY"
FT   gene            426193..428277
FT                   /locus_tag="SMa0785"
FT   CDS_pept        426193..428277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0785"
FT                   /product="Recombinase"
FT                   /note="Has domain similar to those found in PinR, Site-
FT                   specific recombinases, DNA invertase Pin homologs, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0785"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65081"
FT                   /db_xref="GOA:Q925Y8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q925Y8"
FT                   /protein_id="AAK65081.1"
FT                   /translation="MSTDNAMKISADHLRRDAFLYVRQSSLRQVFENTESTKRQYALRD
FT                   RAVALGWPIERVHVIDNDLGLSGAQSQDRDGFQRLVTEVAMGHAGIVLGLEVSRLARNN
FT                   ADWHRLLELAAMSRTLIMDEDGVYDAASFNDRMLLGLKGTMSEAELHILKSRLQGGILN
FT                   KARRGELELPLPIGLVYTPDMRVVLDPDRQIQDTVRMLFDTFREVGSACAVVRRLRSEK
FT                   ILFPRRIRRGIGKGDVLWSEIDHSRVIQILHNPRYAGAFAYGRTRTIYNAKLKSVQQKM
FT                   PRSDWQVLIPQAHEGYISWDEFERNQTSLEQNAVGFSPGLRGRMPRQGNGLLQGRVLCG
FT                   RCGARMRVHYEQFEGNLRPYYICNEAVVRHAGKACQWARGPAIDEAVSALLLEAMAPTA
FT                   IEVALAVQEEISQRVEQAASLRDKQLQRARYEAELARRRYLKVDPDNRLVADALEADWN
FT                   GKLRDLDTLQREHERRNETDQSLLDGAMQERIRALAADFPGIWNNERTSPVERKRMLGL
FT                   LIEDVTLLVDEQINMHIRWRGGRTQSLAVARPRPMAVIRKTPEAVVALINELLETDNDQ
FT                   QIASRLNALGHRNWRGEAFTLKKVMLVRRAYGLKTRFERLRESGMLTGEEVARRFGVSA
FT                   TTVHQLGRDGVLKRHRYATNHRYLYEPPGNVRLAKGVGGRYGSRKPRLIDAQPIQQGAS
FT                   "
FT   gene            complement(428239..429057)
FT                   /locus_tag="SMa0787"
FT   CDS_pept        complement(428239..429057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0787"
FT                   /product="transposase, fragment"
FT                   /note="Possible truncated transposase TRm23a, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0787"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65082"
FT                   /db_xref="GOA:Q92ZN1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN1"
FT                   /protein_id="AAK65082.1"
FT                   /translation="MPAERLEMRRVREILRYRFEQGLGHKSIAVRVGAAPSTVRETLRR
FT                   AAIAELSWPLGDDVSDAVLEAALYKAAGTKTGHRRSPEPDWTQVHRELKRKHMTLQILW
FT                   DEYISRYPEGYRYSRFCDLYRGWAMKLPVTMRQDHAAGDKLFVDYAGDTVTVVVDRLSG
FT                   KTRQAHLFVAVLGASSLSYAQARWSETLPDWIECHILALEFFGGAPALLVPDNAKVAII
FT                   KACHFDPQVNRTYCGMAAHYGSAVLPTRPRRPRDKEQTSRCTLLDWLSVN"
FT   repeat_region   complement(428282..429227)
FT                   /rpt_family="ISRm23 fragment"
FT                   /note="Sma4005; 98% identical over length to ISRm23 of S.
FT                   meliloti pSyma"
FT   gene            429441..430136
FT                   /locus_tag="SMa0789"
FT   CDS_pept        429441..430136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0789"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0789"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65083"
FT                   /db_xref="GOA:Q92ZN0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZN0"
FT                   /protein_id="AAK65083.2"
FT                   /translation="MNDALAGNAIRVERPTKTLRELALDKVRDAIVDGYFRPGDRLVER
FT                   DLCAQLGVSRTIVREVLRHLESEGLVANLPNKGPIVARLDLNEAKQIYEIRGALEGMAA
FT                   RLCAERNDSTIVAALEASLEGIRQSYAAKDMPAVLNHTSAFYQTLFTKVDRHVAWGVVS
FT                   LLTVRINHLRSMTIKTRNRDVEGPAQMEKIVEAIRKGDGEAAYKAALDHVARASVIAEA
FT                   VLSAQQTGD"
FT   gene            430599..431201
FT                   /locus_tag="SMa0791"
FT   CDS_pept        430599..431201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0791"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0791"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65085"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZM8"
FT                   /protein_id="AAK65085.1"
FT                   /translation="MPVQIRKTLLQMETTLIEGGKAAPRPLKLFSAVAVVKNPWAGHGF
FT                   VEDLRPEIHRAAPVLGELLTRMIIDAVGSAEAVEAYGKAAVVGIDGEIEHASALIHTLR
FT                   FGNHYRQAVGAKSYLAFCNTRGPANAPIMIPLMDKNDEGRRSHYLTIQTAVPDAPAADE
FT                   IVVALGASTGGRPHHRIGDRYEDLKELGQDVTNPAGV"
FT   gene            431220..432053
FT                   /locus_tag="SMa0792"
FT   CDS_pept        431220..432053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0792"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains an alpha/beta hydrolase fold; This
FT                   catalytic domain is found in a very wide range of enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0792"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65086"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZM7"
FT                   /protein_id="AAK65086.1"
FT                   /translation="MQTVTSHTSGEGGASLPRKTTARGTAYFEAGNGETLILIHGVGMR
FT                   LEAWAPQIEAFAKTHRVFALDMPGHGASEKIPAGSTVRDYVAWFGCFLEDLSIARASIA
FT                   GHSMGALISGGAVATFSDRITRVAYLNGVYRRDAAAKAAVLARAEAIRKNGVDAEGPLE
FT                   RWFGEDPESQRARELTRTWLEMVDPEGYAIAYAAFAGGDEIYADCWPSVECPALFLTGS
FT                   GDPNSTPEMAKQMASVTPKGWARIVDGHRHMVNLTAPEIVNALMSEWLTSREKPR"
FT   gene            432050..432985
FT                   /locus_tag="SMa0793"
FT   CDS_pept        432050..432985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0793"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved protein/domain typically associated with
FT                   flavoprotein oxygenases, DIM6/NTAB family; Contains a
FT                   flavin reductase like domain; This is a flavin reductase
FT                   family consisting of enzymes known to be flavin reductases
FT                   as well as various oxidoreductase and monooxygenase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0793"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65087"
FT                   /db_xref="GOA:Q92ZM6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="PDB:3RH7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZM6"
FT                   /protein_id="AAK65087.2"
FT                   /translation="MTAEVFDPRALRDAFGAFATGVTVVTASDAAGKPIGFTANSFTSV
FT                   SLDPPLLLVCLAKSSRNYESMTSAGRFAINVLSETQKDVSNTFARPVEDRFAAVDWRLG
FT                   RDGCPIFSDVAAWFECSMQDIIEAGDHVIIIGRVTAFENSGLNGLGYARGGYFTPRLAG
FT                   KAVSAAVEGEIRLGAVLEQQGAVFLAGNETLSLPNCTVEGGDPARTLAAYLEQLTGLNV
FT                   TIGFLYSVYEDKSDGRQNIVYHALASDGAPRQGRFLRPAELAAAKFSSSATADIINRFV
FT                   LESSIGNFGIYFGDETGGTVHPIANKDAHS"
FT   gene            432982..434022
FT                   /locus_tag="SMa0794"
FT   CDS_pept        432982..434022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0794"
FT                   /product="Monoxygenase"
FT                   /note="Belongs to the family of flavin-utilizing
FT                   monoxygenases, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0794"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65088"
FT                   /db_xref="GOA:Q92ZM5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZM5"
FT                   /protein_id="AAK65088.1"
FT                   /translation="MKFSLFVHMERLDASQDHKTLYEEFIKLCEIADKGGMHAIWTGEH
FT                   HGMEFTIAPNPFVTIADLARRTKTARLGTGTVIAPFWHPIKLAGEAAMTDLICEGRLDI
FT                   GIARGAYSFEYERLLPGLDAWSAGQRMRELIPAVKGIWAGDYAHDGEFFKFPATTSSPK
FT                   PLQKPHPPIWVAARDPNSHEFAVANGCNVQVTPLWQDDEEVRSLMARFNDACAKDPEVP
FT                   RPKIMLLRHTYVGSDEADIAQAAHEMSVYYNYFFAWFKNERPIRQGLIDRIPEEEIAAN
FT                   AMLSGEAMRRNNVVGAADEVIARIKSYEAMGYDEYSFWIDTGMTFERKKASLERFIADV
FT                   MPAFAE"
FT   gene            434028..435491
FT                   /locus_tag="SMa0796"
FT   CDS_pept        434028..435491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0796"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="This family of dehydrogenases act on aldehyde
FT                   substrates; Members use NAD or NADP as a cofactor; The
FT                   family includes the following members: The prototypical
FT                   members are the aldehyde dehydrogenases EC:1.2.1.3;
FT                   Succinate-semialdehyde dehydrogenase EC:1.2.1.16;
FT                   Lactaldehyde dehydrogenase EC:1.2.1.22; Benzaldehyde
FT                   dehydrogenase EC:1.2.1.28; Methylmalonate-semialdehyde
FT                   dehydrogenase EC:1.2.1.27; Glyceraldehyde-3-phosphate
FT                   dehydrogenase EC:1.2.1.9; Delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase EC: 1.5.1.12; Acetaldehyde dehydrogenase
FT                   EC:1.2.1.10; Glutamate-5-semialdehyde dehydrogenase
FT                   EC:1.2.1.41; This family also includes omega crystallin, an
FT                   eye lens protein from squid and octopus that has little
FT                   aldehyde dehydrogenase activity, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0796"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65089"
FT                   /db_xref="GOA:Q92ZM4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZM4"
FT                   /protein_id="AAK65089.1"
FT                   /translation="MQRFQCYINGEFADGEARFESIDPTTGRAWAEMPEAREADVNRAV
FT                   EAARIALHDQPWSTLTATQRGKLLYKLADLVAENAGRLAELETRDTGKIIRETSSQIAY
FT                   VADYYRYYAGIADKIEGSYLPIDKPDMDVWLRREPIGVVAMVVPWNSQLFLSAVKIGPA
FT                   LAAGCTMVVKASEDGPAPLLEFARLVHAAGFPAGVVNIVTGFGPSCGAALSRHPQVDHI
FT                   AFTGGPETARHIVRNSAENLASTSLELGGKSPFIVFADADLESAANAQIAGIFAATGQS
FT                   CVAGSRLIVEKSVKDRFLQILKAKAETIRIGSPLEMSTEVGPLATERQSNHVKTLVARS
FT                   LAAGAKLVTGGTAPEGAGFYYRPTILDCDGSASPSLENEFFGPVLSVLSFETEAEALHL
FT                   ANDSRFGLAAGVFTQNLTRAHRLMKGIRAGIVWVNTYRAVSPVAPFGGFGLSGHGREGG
FT                   LEAALDYTRSKTVWLRTSDDPIPDPFVMR"
FT   gene            435497..435823
FT                   /locus_tag="SMa0797"
FT   CDS_pept        435497..435823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0797"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0797"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65090"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZM3"
FT                   /protein_id="AAK65090.1"
FT                   /translation="MFYEIRTYRLRNGAIPTYLKVVEEEGIAIQRKHLGELVGYFFSEI
FT                   GPINEIVHIWAYPSLDERERRRAALMNDAAWRDFLPKVRDLIEVAENKIMKAARFSPTG
FT                   AVAS"
FT   gene            435861..436871
FT                   /locus_tag="SMa0799"
FT   CDS_pept        435861..436871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0799"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0799"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65091"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZM2"
FT                   /protein_id="AAK65091.2"
FT                   /translation="MNRIFVLAATAATIATAMPATAADLVFTSWGGTTQDAQKIAWAEK
FT                   FTEKTGINVLQDGPTDYGKLKAMVEANAVTWDVVDVEGDYAAQAGKKGLLEKLDFSVID
FT                   KSKLDPRFVTDYSVGSFYYSFVIGCNKDAVDACPKTWADLFDAQKFPGMRAFYKWSAPG
FT                   VIEAALLADGVSPDKLYPLDLDRAFKKLDTIKSDIIWWSGGAQSQQLLASAEAPFGSVW
FT                   NGRMTALAQSGINVETSWEQNITAADALVVPKGSRNKEAAMQFIALATSPEAQADLAKI
FT                   TGYAPINLDSPKMMDPELANTLPDAQTASQVNADMNYWAENRDAIGERWYAWQAK"
FT   gene            436964..437839
FT                   /locus_tag="SMa0800"
FT   CDS_pept        436964..437839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0800"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to the PotB, ABC-type
FT                   spermidine/putrescine transport system, permease component,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0800"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65092"
FT                   /db_xref="GOA:Q92ZM1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZM1"
FT                   /protein_id="AAK65092.1"
FT                   /translation="MVSQTETGSGRPYSPAQVRRLTDFDLTLPALGLLILFFVLPVAML
FT                   LTRSVTEPVPGLGNYAELLGSSTYLRIFANTFIVSSLVTLVSLLIGFPVAWALAIMPSR
FT                   AASIVFAILLLSMWTNLLARTYAWMVLLQRTGVINKMLLGMGLIDTPLPLVNNLTGVTI
FT                   GMTYIMLPFIILPLYGVIRKIDPAILQAAALCGANRWQSLVRVLLPLAMPGMAAGALMV
FT                   FVMSLGYFVTPALLGGTSNMMLAELIAQFVQSLVNWGMGGAAALVLLVVTLALYAVQLR
FT                   FFGTNRIGGR"
FT   gene            437841..438641
FT                   /locus_tag="SMa0802"
FT   CDS_pept        437841..438641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0802"
FT                   /product="ABC transporter, permease"
FT                   /note="Most similar to PotC, ABC-type spermidine/putrescine
FT                   transport system, permease component II, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0802"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65093"
FT                   /db_xref="GOA:Q92ZM0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZM0"
FT                   /protein_id="AAK65093.1"
FT                   /translation="MLLNFDRLGWWKLVLIGITLLTTAFLLLPILFIAVLSFGSSQWLI
FT                   FPPPGWTLRWYQELLEDPRWLDSAWTSFRIAIIVTVLSVLLGLVTSFGLNRGRFLFREA
FT                   LKALFLTPMILPVVVLAVALYAFFLQIGLNGTLTGFVISHLVLALPFSILSITNALEGF
FT                   DKSIEDAAVLCGASPFEAKIRVTLPAISHGVFSAAIFSFLTSWDEVVVAIFMASPTLQT
FT                   LPVKVWSTLRQDLTPVVAAASTLLILLTVLLMVLVAIVRKGLKS"
FT   gene            438638..439717
FT                   /locus_tag="SMa0803"
FT   CDS_pept        438638..439717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0803"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Most similar to PotA, ABC-type spermidine/putrescine
FT                   transport systems, ATPase components; PotA has two domains
FT                   with the N-terminal domain containing the ATPase activity
FT                   and the residues required for homodimerization with PotA
FT                   and heterdimerization with PotB, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0803"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65094"
FT                   /db_xref="GOA:Q92ZL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL9"
FT                   /protein_id="AAK65094.1"
FT                   /translation="MNRPFLQIRGIRKEYGPVTAVQDVTLDVAQGEFLTFLGPSGSGKS
FT                   TTLYILAGFENPTRGDILLNGETLLATPSHKRNIGMVFQRYTLFPHLSVGENIAFPLKV
FT                   RRLPKAEIDAKVRAMLKLVRLEGFEDRKPAQMSGGQQQRVALARALAYDPPVLLMDEPL
FT                   SALDKKLREEIQHEIRRIHQQTEVTILYVTHDQEEALRLSDRIAVFSKGVIDQIGTGPE
FT                   LYANPATRFVAEFIGDSDFLPCDVVSTVNGRAEIAVCGSMTFSNIPLHGTASLGSKAAL
FT                   MLRPERLLLSKTKSDIGLPVTVSDITFLGNNVHVATKTRKGNDLSVRLPFGHEAISGLN
FT                   RGDAVWLRFDAGSAHVFGQ"
FT   gene            439799..441271
FT                   /gene="gabD4"
FT                   /locus_tag="SMa0805"
FT   CDS_pept        439799..441271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD4"
FT                   /locus_tag="SMa0805"
FT                   /product="GabD4 succinate-semialdehyde dehdyrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="Belongs to the aldehyde dehydrogenase family; This
FT                   family of dehydrogenases act on aldehyde substrates;
FT                   Members use NADP as a cofactor, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0805"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65095"
FT                   /db_xref="GOA:Q92ZL8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL8"
FT                   /protein_id="AAK65095.1"
FT                   /translation="MTISETLLVKLKDPSLAVDKGLIGAEWLDRSDSGKTFDVSNPATG
FT                   EVIAILPDMSRSETARAIDAAHAAQRAWAEKTGKERAAVLRNLYDLVVANADDLATILT
FT                   MEMGKPLTEAKGEILYGASYVEWFGEEAKRVYGDTIPGHQPDKRIIVLKQPIGVVAAIT
FT                   PWNFPNAMLARKLAPAAAAGCAVVSKPAAETPLSALALALLAERAGLPAGVFNVILSTD
FT                   SAEVGKEMCANDKVRKLTFTGSTNVGKILMRQGADQIMKLGLELGGNAPFIVFDDADLD
FT                   AAVEGAMVAKYRNNGQTCVCANRIFVQAGIYDAFAARLTAKVSEMTIGDGFEPDVDAGP
FT                   LISEKALAKVEEHIRDAVTKGADLVLGGNARGGLFFEPTVLTGATMDMKIAGEETFGPV
FT                   APLFKFETENEVVSMANKTEFGLASYFYSKDVSKVFRVAEALEYGMVGINTGLISTEVA
FT                   PFGGVKQSGQGREGSKYGIDDYVETKYLCLSI"
FT   gene            441631..442086
FT                   /gene="syrB3"
FT                   /locus_tag="SMa0806"
FT   CDS_pept        441631..442086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="syrB3"
FT                   /locus_tag="SMa0806"
FT                   /product="SyrB3 regulator"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0806"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65096"
FT                   /db_xref="GOA:P58346"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58346"
FT                   /protein_id="AAK65096.1"
FT                   /translation="MVDESNAGPVAPAVVADAEVKAPTGKKRSSSRPQKAPPEPAQPKM
FT                   PAAKRRGYSEQERSEKLRLIETKVSEGNTLKDAIKSAGISEQTYYHWKGAAKSAAREDI
FT                   ERTRPLSAGDEFAELVQLEEENQRLRKQLAEKLRTENTELRKRLGLD"
FT   gene            442329..442967
FT                   /locus_tag="SMa0809"
FT   CDS_pept        442329..442967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0809"
FT                   /product="hypothetical protein"
FT                   /note="Similar to SMa01697; Very short stretch of
FT                   similarity to Y4aO of Rhizobium spp; NGR234"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0809"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65097"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL7"
FT                   /protein_id="AAK65097.2"
FT                   /translation="MKRPQQTFVVEKKTKRRQPNAQTKSIWGDTDLKALAREVEDMASL
FT                   PFNSNEGRGTFGSRETRLVDPINAEPLNGRVEVALPEIQRANGTKVEISQHRVADTPTE
FT                   AVAQTKERHTPSQRLSTSGTARNRTKRLHDLKVGHEGRKAQTRTVDDPISLDELAALGA
FT                   DNKLLKRLLAELLLAQNLWLKKMLERFDAERDVAPLASGRKAREPEFRG"
FT   gene            complement(443587..443793)
FT                   /gene="fixU"
FT                   /locus_tag="SMa0810"
FT   CDS_pept        complement(443587..443793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixU"
FT                   /locus_tag="SMa0810"
FT                   /product="FixU nitrogen fixation protein"
FT                   /note="FixU has some similarity to NifT; pfam06988, NifT,
FT                   NifT/FixU protein; This family consists of several NifT and
FT                   FixU bacterial proteins; The function of NifT is unknown
FT                   although it is thought that the protein may be involved in
FT                   biosynthesis of the FeMo cofactor of nitrogenase although
FT                   perturbation of nifT expression in K; pneumoniae has only a
FT                   limited effect on nitrogen fixation, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0810"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65098"
FT                   /db_xref="GOA:Q92ZL6"
FT                   /db_xref="InterPro:IPR009727"
FT                   /db_xref="InterPro:IPR024044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL6"
FT                   /protein_id="AAK65098.1"
FT                   /translation="MKVTIRITGDALSAYIPKKDLEEPIISVANEDLWGGSILLRNGWR
FT                   LALPHLPQDTRLPVTVEANIRRH"
FT   gene            complement(443981..444175)
FT                   /gene="fdxN"
FT                   /locus_tag="SMa0811"
FT   CDS_pept        complement(443981..444175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxN"
FT                   /locus_tag="SMa0811"
FT                   /product="FdxN ferredoxin"
FT                   /note="Similar to 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0811"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65099"
FT                   /db_xref="GOA:P12712"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12712"
FT                   /protein_id="AAK65099.1"
FT                   /translation="MAFKIIASQCTQCGACEFECPRGAVNFKGEKYVIDPTKCNECKGG
FT                   FDTQQCASVCPVSNTCVPA"
FT   gene            complement(444206..445678)
FT                   /gene="nifB"
FT                   /locus_tag="SMa0814"
FT   CDS_pept        complement(444206..445678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifB"
FT                   /locus_tag="SMa0814"
FT                   /product="NifB FeMo cofactor biosynthesis protein"
FT                   /note="NifB belongs to a family of iron-molybdenum cluster-
FT                   binding proteins that includes NifX, and NifY, all of which
FT                   are involved in the synthesis of an iron-molybdenum
FT                   cofactor (FeMo-co) that binds the active site of the
FT                   dinitrogenase enzyme as part of nitrogen fixation in
FT                   bacteria; This domain is sometimes found fused to a N-
FT                   terminal domain (the Radical SAM domain) in nifB-like
FT                   proteins, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0814"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65100"
FT                   /db_xref="GOA:P09824"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09824"
FT                   /protein_id="AAK65100.1"
FT                   /translation="MSTPMILRESRTSTTFSDQLLENAKSVGCSPPSTAPGDIDPGTWD
FT                   KIKNHPCFSEEAHHYFARMHVAVAPACNIQCNYCNRKYDCANESRPGVASEKLTPDQAV
FT                   RKVIAVANEVPQLSVLGIAGPGDACYDWKKTRATFERVAREIPDIRLCISTNGLSLPDH
FT                   VDELAEMNVDHVTITINMVDPRVGVKIYPWIYYGQRRHTGIDAARILHERQMLGLEMLA
FT                   ERGILTKVNSVMIPGVNDEHLIEVNKVVKGRGALLHNVMPLISNRIHGTYYGLTGQRGP
FT                   EAFELQALQDRLEGTKLMRHCRHCRADAIGLLGDDRGHEFTLAEIPDEITYDASKRQAY
FT                   RQLVARERGDHLVAKNEANRTVMSVEYGGSLLIAVATKGGGRINEHFGHAKEFHVYTVS
FT                   QRGIKLAGRRRVEQYCLGGWGEVATLDHIVVALEGIDILLCVKIGDYPRKQLTQAGLRA
FT                   TEAYGHDYIESALGALYAAEFGIEPPVKTATA"
FT   gene            complement(445895..447520)
FT                   /gene="nifA"
FT                   /locus_tag="SMa0815"
FT   CDS_pept        complement(445895..447520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifA"
FT                   /locus_tag="SMa0815"
FT                   /product="NifA transcriptional activator"
FT                   /note="Sigma54-dependent activator of nitrogen fixation
FT                   genes; Expression of nifA is FixJ-dependent, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0815"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65101"
FT                   /db_xref="GOA:P03028"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010113"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03028"
FT                   /protein_id="AAK65101.2"
FT                   /translation="MRKQDKRSAEIYSISKALMAPTRLETTLNNFVNTLSLILRMRRGG
FT                   LEIPASEGETKITAATRNSGSPSAADYTVPKAAIDQVMTAGRLVVPDVCNSELFKDQIK
FT                   WRGIGPTAFIAAAVEVDHETGGMLWFECAEESDYDYEEEVHFLSMAANLAGRAIRLHRT
FT                   ISRRERTFAEEQQEQQNSRDEQSQSSARQRLLKNDGIIGESTALMTAVDTAKVMAETNS
FT                   IVLLRGETGTGKECFAKLIHQHSTRQKKPFIKFNCPALSESLLESELFGHEKGAFTGAI
FT                   AQRVGRFESANGGTLLLDEIGEIPPAFQAKLLRVIQEGEFERVGGTKTLKVDVRLIFAT
FT                   NKDLEMAVQNGEFREDLYYRISGVPLILPPLRHRDGDIPLLARAFLQRFNEENGRDLHF
FT                   APSALDHLSKCKFPGNVRELENCVRRTATLARSKTITSSDFACQTDQCFSSRLWKGVHC
FT                   SHGHIEIDAPAGTTPLLGAPANDVPPKEPGSAGVASNLIERDRLISALEEAGWNQAKAA
FT                   RILEKTPRQVGYALRRHGVDVRKL"
FT   gene            complement(447740..448036)
FT                   /gene="fixX"
FT                   /locus_tag="SMa0816"
FT   CDS_pept        complement(447740..448036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="SMa0816"
FT                   /product="FixX ferredoxin-like protein"
FT                   /note="Required for nitrogen fixation; Expression is NifA-
FT                   dependent; Has weak, partial similarity to electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0816"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65102"
FT                   /db_xref="GOA:P09822"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09822"
FT                   /protein_id="AAK65102.1"
FT                   /translation="MKTAIAERIEDKLYQNRYLVDAGRPHITVRPHRSPSLNLLALTRV
FT                   CPAKCYELNETGQVEVTADGCMECGTCRVLCEANGDVEWSYPRGGFGVLFKFG"
FT   gene            complement(448049..449356)
FT                   /gene="fixC"
FT                   /locus_tag="SMa0817"
FT   CDS_pept        complement(448049..449356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="SMa0817"
FT                   /product="FixC oxidoreductase"
FT                   /note="Similar to quinone oxidoreductase; Probably forms a
FT                   membrane complex with FixAB; Required for symbiotic
FT                   nitrogen fixation; Probably responsible for electron
FT                   transfer to nitrogenase; Expression is NifA-dependent, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0817"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65103"
FT                   /db_xref="GOA:P09820"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09820"
FT                   /protein_id="AAK65103.1"
FT                   /translation="MTKEKFDAIVVGAGMSGNAAAYAMASRGLKVLQLERGEYPGSKNV
FT                   QGAIMYANMLEAIIPDFRNDAPLERHLVEQRFWIMDDTSHTGMHYRSDDFNEVTPNRYT
FT                   IIRAQFDKWLSRKVCEAGGTVLCETTATGLEWDSAGKAIGVRTDRAGDVVLADVVVLAE
FT                   GVNGLLGTRAGLREMPKSKNVALAVKELHFLPEEVIAERFGLTGDEGCVIEAGGTISRG
FT                   MAGLGFLYTNKESISLGIGCLISNFAETMERPYALLDAFKRHPSIQPLIAGSEVKEYAA
FT                   HLIPEGGFNAIPRLCGNGWVVVGDAAQLNNAVHREGSNLAMASGRMAGEAISIIKSRGG
FT                   VMDKASLSLYKTMLDKSFVVEDLSKQKDMPSLLHTNSPNFFTTYPQLISHAAQNFVRVD
FT                   GTPKIEREIATTAAFLRARSRWGLVSDAVRLASAWR"
FT   gene            complement(449368..450429)
FT                   /gene="fixB"
FT                   /locus_tag="SMa0819"
FT   CDS_pept        complement(449368..450429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="SMa0819"
FT                   /product="FixB electron transfer flavoprotein alpha chain"
FT                   /note="Belongs to the family of electron transfer
FT                   flavoproteins (eft); Required for symbiotic nitrogen
FT                   fixation; Probably responsible for electron transfer to
FT                   nitrogenase; Expression is NifA-dependent, high confidence
FT                   in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0819"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65104"
FT                   /db_xref="GOA:P09819"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09819"
FT                   /protein_id="AAK65104.1"
FT                   /translation="MKKGLPKQFQDYRNVWVFIELEHGQVHPVSIELLGEGRKLADKLG
FT                   VHLAGVVIGPPGGQGTANAIADAFAYGADLSYLVESPLLAHYRNEPFTKALTDLVLANK
FT                   PEILLLGATTLGRDLAGSVATTLKTGLTADCTELNVDSDGSLAATRPTFGGSLLCTIYT
FT                   LKCRPQMATVRPSVMATPQRVNRPTGSIIRHDLKMLEEEIATKVLAFFSDCDSTIANLA
FT                   YADVVVAGGLGLGAVQNLQLLKDLARTLGGDFGCSRPLVQKGWMPFDRQIGQTGNTIRP
FT                   KLYIAAGISGAVQHRVGVEGSDLIVAINTDPNAPIFDFAHLGVVADAISFLPALTEVFT
FT                   KRLEPRNLEKFVQ"
FT   gene            complement(450461..451339)
FT                   /gene="fixA"
FT                   /locus_tag="SMa0822"
FT   CDS_pept        complement(450461..451339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="SMa0822"
FT                   /product="FixA electron transfer flavoprotein beta chain"
FT                   /note="Belongs to the family of electron transfer
FT                   flavoproteins (eft); Required for symbiotic nitrogen
FT                   fixation; Probably responsible for electron transfer to
FT                   nitrogenase; Expression is NifA-dependent, high confidence
FT                   in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0822"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65105"
FT                   /db_xref="GOA:P09818"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09818"
FT                   /protein_id="AAK65105.1"
FT                   /translation="MHLVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPHDLAALEEA
FT                   LKLCDTYGGEVTVVTMGPKMAEDALRKALTFGAHRAVLLTDRHFAGSDTLATSFALAQA
FT                   IAEIGETFGTPDVVFTGKQTIDGDTAQVGPGIAKRLDLQQLTYVAKILSIDAASREITV
FT                   ERRAEGGSQILRTGLPCLVTMLDGADAIRRGRLDDALRAARTKVVKWSAADAGIAEPAN
FT                   CGLRGSPTVVKRVFAPTSREQKARQIDTTNKPLREIADGLIAAIFADRPALKHDLGSTG
FT                   QQGAPDVDRES"
FT   gene            452858..453325
FT                   /locus_tag="SMa0824"
FT   CDS_pept        452858..453325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0824"
FT                   /product="hypothetical protein"
FT                   /note="Amino terminus has similarity to very short region
FT                   of sigma-54 regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0824"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65106"
FT                   /db_xref="GOA:Q92ZL5"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL5"
FT                   /protein_id="AAK65106.1"
FT                   /translation="MLLDDDIVDVLKKTGVDIARRTVAKYRGAMNIHPLSKAAARSVHC
FT                   RGPPDSEGCRQPASTLEQAGPVLLERDCDISRPVFWAALFCSPAAGRHSRSQQLSICGR
FT                   NSVVPDREEGPKRSRYPEQPVQRHRLSSGHSACRRPVTRASTHGGNSLSDF"
FT   gene            453556..454449
FT                   /gene="nifH"
FT                   /locus_tag="SMa0825"
FT   CDS_pept        453556..454449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifH"
FT                   /locus_tag="SMa0825"
FT                   /product="NifH nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="FUNCTION: The key enzymatic reactions in nitrogen
FT                   fixation are catalyzed by the nitrogenase complex, which
FT                   has 2 components: the iron protein and the molybdenum-iron
FT                   protein, CATALYTIC ACTIVITY: 3 reduced ferredoxin + 6 H(+)
FT                   + N(2) + n ATP = 3 oxidized ferredoxin + 2 NH(3) + n ADP +
FT                   n phosphate, COFACTOR: Binds one 4Fe-4S cluster per dimer,
FT                   SUBUNIT: Homodimer, SIMILARITY: Belongs to the nifH / bchL
FT                   / chlL family, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0825"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65107"
FT                   /db_xref="GOA:P00460"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00460"
FT                   /protein_id="AAK65107.1"
FT                   /translation="MAALRQIAFYGKGGIGKSTTSQNTLAALVDLGQKILIVGCDPKAD
FT                   STRLILNAKAQDTVLHLAATEGSVEDLELEDVLKVGYRGIKCVESGGPEPGVGCAGRGV
FT                   ITSINFLEENGAYNDVDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALYAAN
FT                   NIAKGILKYAHAGGVRLGGLICNERQTDRELDLAEALAARLNSKLIHFVPRDNIVQHAE
FT                   LRKMTVIQYAPNSKQAGEYRALAEKIHANSGRGTVPTPITMEELEDMLLDFGIMKSDEQ
FT                   MLAELHAKEAKVIAPH"
FT   gene            454549..456051
FT                   /gene="nifD"
FT                   /locus_tag="SMa0827"
FT   CDS_pept        454549..456051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifD"
FT                   /locus_tag="SMa0827"
FT                   /product="NifD nitrogenase molybdenum-iron protein alpha
FT                   chain"
FT                   /function="Nitrogenase molybdenum-iron protein, alpha and
FT                   beta chains"
FT                   /EC_number="1.18.6.1"
FT                   /note="FUNCTION: The key enzymatic reactions in nitrogen
FT                   fixation are catalyzed by the nitrogenase complex, which
FT                   has 2 components: the iron protein and the molybdenum-iron
FT                   protein, CATALYTIC ACTIVITY: 3 reduced ferredoxin + 6 H(+)
FT                   + N(2) + n ATP = 3 oxidized ferredoxin + 2 NH(3) + n ADP +
FT                   n phosphate, SUBUNIT: Tetramer of two alpha and two beta
FT                   chains that binds 30- 32 Fe, 2 Mo, and inorganic sulfur,
FT                   SIMILARITY: Belongs to the nifD/nifK/nifE/nifN family, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0827"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65108"
FT                   /db_xref="GOA:Q92ZL4"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL4"
FT                   /protein_id="AAK65108.1"
FT                   /translation="MSLDYENDNALHEKLIEEVLSHYPDKAAKRRKKHLSVAKNKQETA
FT                   EEGQVVSECDVKSNIKSIPGVMTIRGCAYAGSKGVVWGPIKDMVHISHGPVGCGQYSWS
FT                   QRRNYYVGTTGIDAFVTMQFTSDFQEKDIVFGGDKKLEKIIDEIEELFPLNNGVTVQSE
FT                   CPIGLIGDDIEAVSRKKAEEYKTTIVPVRCEGFRGVSQSLGHHIANDAIRDWVFDTTEV
FT                   AYEAGRYDVNVIGDYNIGGDAWASRILLEEIGLHVVGNWSGDATLAEIERAPTAKLNLI
FT                   HCYRSMNYICRHMEEKYGVPWMEYNFFGPSQIEASLRQIAKHFGPEIEERAERVIAKYS
FT                   GLTDAVIDKYWPRLHGKRVMLYVGGLRPRHVITAYEDLGMEIVGTGYEFAHNDDYQRTG
FT                   HYVKEGTLIYDDVTGYELEKFIERIRPDLVGSGIKEKYSVQKMGIPFRQMHSWDYSGPY
FT                   HGYDGFAIFARDMDLAVNNPVWDLYDAPWQKVTMPAASGAAE"
FT   gene            456142..457683
FT                   /gene="nifK"
FT                   /locus_tag="SMa0829"
FT   CDS_pept        456142..457683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifK"
FT                   /locus_tag="SMa0829"
FT                   /product="NifK nitrogenase molybdenum-iron protein beta
FT                   chain"
FT                   /function="Nitrogenase molybdenum-iron protein, alpha and
FT                   beta chains"
FT                   /EC_number="1.18.6.1"
FT                   /note="FUNCTION: The key enzymatic reactions in nitrogen
FT                   fixation are catalyzed by the nitrogenase complex, which
FT                   has 2 components: the iron protein and the molybdenum-iron
FT                   protein, CATALYTIC ACTIVITY: 3 reduced ferredoxin + 6 H(+)
FT                   + N(2) + n ATP = 3 oxidized ferredoxin + 2 NH(3) + n ADP +
FT                   n phosphate, SUBUNIT: Tetramer of two alpha and two beta
FT                   chains that binds 30- 32 Fe, 2 Mo, and inorganic sulfur,
FT                   SIMILARITY: Belongs to the nifD/nifK/nifE/nifN family, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0829"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65109"
FT                   /db_xref="GOA:Q92ZL3"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="InterPro:IPR024564"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL3"
FT                   /protein_id="AAK65109.1"
FT                   /translation="MPQSAEKVLDHAPLFREPEYRKMLAEKKRNFERPYPDRTVTDQRE
FT                   FTKTWHYREINLAREALVVNPAKACQPLGAVFAAAGFERTMSFVHGSQGCVAYYRSHLS
FT                   RHFKEPSSAVSSSMTEDAAVFGGLKNMVDGLANTYKLYDPKMIAVSTTCMAEVIGDDLH
FT                   GFIENAKDEGAVPHDFDVPFAHTPAFVGSHVDGYDSMVKGVLENFWKGEQRTVNPGSIN
FT                   IIPGFDGFCVGNNRELKRLLNLMGVSYTFIQDASDQFDTPSDGEFRMYDGGTKIEDVRA
FT                   ALNAEATVSLQQYNTRRTLEYCKAAGQSTVSFHYPLGVKATDEFLVKVSEISGREIPEA
FT                   IRLERGRLVDAMADSQSWLHGKKYAIYGDPDFVYAVARFIMETGGEPTHCLATNGTPAW
FT                   EAEMKMLLASSPLGNDAQVWASKDLWAMRSLLFTEPVDLLIGNSYGKYLERDTGTPLIR
FT                   LMFPIFDRHHHHRFPLMGYQGGLRVLTTILDKIFDRLDRETMQVGVTDYSYDLTR"
FT   gene            457737..459167
FT                   /gene="nifE"
FT                   /locus_tag="SMa0830"
FT   CDS_pept        457737..459167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifE"
FT                   /locus_tag="SMa0830"
FT                   /product="NifE nitrogenase molybdenum-cofactor synthesis
FT                   protein"
FT                   /function="Nitrogenase molybdenum-iron protein, alpha and
FT                   beta chains"
FT                   /EC_number="1.18.6.1"
FT                   /note="NifE forms an alpha2beta2 tetramer with NifN; NifE
FT                   and NifN are structurally homologous to nitrogenase MoFe
FT                   protein alpha and beta subunits respectively; NifEN
FT                   participates in the synthesis of the iron-molybdenum
FT                   cofactor (FeMoco) of the MoFe protein; NifB-co (an iron and
FT                   sulfur containing precursor of the FeMoco) from NifB is
FT                   transferred to the NifEN complex where it is further
FT                   processed to FeMoco; The NifEN bound precursor of FeMoco
FT                   has been identified as a molybdenum-free, iron- and sulfur-
FT                   containing analog of FeMoco, high confidence in function
FT                   and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0830"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65110"
FT                   /db_xref="GOA:Q92ZL2"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZL2"
FT                   /protein_id="AAK65110.1"
FT                   /translation="MPSLSAKNQAFFNEPACERNRSKDFKVRKKGCSQPPMPGAAAGGC
FT                   AFDGAKVALQPITNVAHLIHAPLACEGNSWDNRGTASSSHMLWRTSFTTDVTEFDVVMG
FT                   HSERKLFKAIREINEAYAPAAVFVYATCVTALIGDDIDAVCRRAAEKFGLPVVPVNAPG
FT                   FVGSKNLGNKLAGEALLDHVIGTVEPDDARSSDINILGEFNLSGEFWQVRPLLDKLGVR
FT                   VRACIPGDSRYLDIATAHRARAAMMVCSTALINLARKMLERWDIPFFEGSFYGITDTSE
FT                   ALRQIAGLLVKQGAGPDLISRTEALIVEEEARAWRRLEVYRPRLQGKRVLLNTGGVKSW
FT                   SVAHALMEIGLEIVGTSIKKSTDNDKERLKQMLTNDSRMSGATTPRELYSALSDHKADI
FT                   MLSGGRTQFIALKAKMPWLDINQERQHSYAGYHGVVELARQIDLSIHNPIWAQVREAAP
FT                   WEMAPARGEEMSEEEALL"
FT   gene            459663..460163
FT                   /gene="nifX"
FT                   /locus_tag="SMa0831"
FT   CDS_pept        459663..460163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifX"
FT                   /locus_tag="SMa0831"
FT                   /product="NifX iron-molybdenum cluster-binding protein"
FT                   /note="NifX belongs to a family of iron-molybdenum cluster-
FT                   binding proteins that includes NifB, and NifY, all of which
FT                   are involved in the synthesis of an iron-molybdenum
FT                   cofactor (FeMo-co) that binds the active site of the
FT                   dinitrogenase enzyme, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0831"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65111"
FT                   /db_xref="GOA:Q92ZL1"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR013480"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL1"
FT                   /protein_id="AAK65111.1"
FT                   /translation="MISIRRLSLVSDQSQREISDRPVGALRIAIATEDMKGLNAHFGSA
FT                   KRFAIYDVTAHKSQFMEAIEFDDASDESGRHRTEGDGRIRSRVSALKGCQLLFCLAIGG
FT                   PSAAKVISAKIHPIKAQQAVSMSQVLSSVETMLQTAPPPWLRKMLADAGAAKKRADFED
FT                   ETE"
FT   gene            460706..460846
FT                   /locus_tag="SMa0833"
FT   CDS_pept        460706..460846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0833"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains similarity to partial domain of unknown
FT                   function, DUF683 (Pfam5082) This group of conserved
FT                   proteins are often found in nitrogen fixation operons"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0833"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65112"
FT                   /db_xref="InterPro:IPR007774"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZL0"
FT                   /protein_id="AAK65112.1"
FT                   /translation="MMELHDLAEDLPSKWTEIMAVAEKAFRAFAELDAVKRELAESENA
FT                   Q"
FT   gene            460843..461160
FT                   /gene="fdxB"
FT                   /locus_tag="SMa0834"
FT   CDS_pept        460843..461160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxB"
FT                   /locus_tag="SMa0834"
FT                   /product="FdxB ferredoxin III"
FT                   /note="Expression is NifA-dependent; Similarity to NapF-
FT                   type ferredoxin is rather weak, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0834"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65113"
FT                   /db_xref="GOA:Q92ZK9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK9"
FT                   /protein_id="AAK65113.1"
FT                   /translation="MISSFVTRDGSRWMPKYLSAIDGATCIGCGRCFKVCSREVMHLHG
FT                   IDDVGEILGPFDGEEDDFGGELNRMIMVVDSRGRCIGCGACARVCPRDCQTHVAADILA
FT                   A"
FT   gene            461132..461632
FT                   /locus_tag="SMa5036"
FT   CDS_pept        461132..461632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5036"
FT                   /product="Hypothetical protein"
FT                   /note="Region from amino acid 58 to 154 has some similarity
FT                   to dioxygenases; If expressed, SMa5036 may be a truncated
FT                   or nonfunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5036"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07976"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX8"
FT                   /protein_id="ACF07976.1"
FT                   /translation="MSRLTYLPRDRTEEPVERRCHSKLSNRWAFLCTLRPNCVDGDPSM
FT                   STLTTTIDLEQIHILGDHAIRALPELTEVTTKWLINKDPVEGCSTIRSRISRMSGRKPM
FT                   TGTGRSSRKLPLASTLRPMNRALIRLKTRAASCNFGEWYSKFMLERLQGGLKTHAFDYT
FT                   PGA"
FT   gene            461770..462060
FT                   /locus_tag="SMa0835"
FT   CDS_pept        461770..462060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0835"
FT                   /product="hypothetical 10.5 kDa ORF"
FT                   /note="This ORF is located between a SyrM-dependent
FT                   transcription start site and the SyrA coding sequence;
FT                   Beta-glucuronidase gene fusions in this ORF show a SyrM-
FT                   dependent pattern of expression, hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0835"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65114"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D4L0"
FT                   /protein_id="AAK65114.1"
FT                   /translation="MTVMTSHSSTASPLTRAQDFCGSWKRGGPAELMSQLRRDAALTSP
FT                   RRRRIDSAVETQYLYAEGGPPSQGAREPSVNPPIAISRRTRANATYAQTTV"
FT   gene            462211..462456
FT                   /gene="syrA"
FT                   /locus_tag="SMa0838"
FT   CDS_pept        462211..462456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="syrA"
FT                   /locus_tag="SMa0838"
FT                   /product="SyrA protein involved in EPS production"
FT                   /note="Expression is activated by SyrM; Overexpression of
FT                   syrA results in increased production of EPSI; Sequence
FT                   similarity to msi274 of Mesorhizobium loti and Y4xQ of
FT                   Rhizobium spp; NGR234; Subtle sequence similarity to ExoX
FT                   of S; meliloti and to Psi of R; leguminosarium and R; etli,
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0838"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65115"
FT                   /db_xref="GOA:O87908"
FT                   /db_xref="InterPro:IPR024239"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87908"
FT                   /protein_id="AAK65115.1"
FT                   /translation="MSFRFVCLILWLLLCASSLAIYFALQPCPGFIVTTLACLLLFQLA
FT                   YFGSVLLLVCLAAIAQLSARLRIFGIFSENRNHSSK"
FT   gene            complement(462751..463692)
FT                   /gene="nodD3"
FT                   /locus_tag="SMa0840"
FT   CDS_pept        complement(462751..463692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodD3"
FT                   /locus_tag="SMa0840"
FT                   /product="NodD3 nod box-dependent transcriptional
FT                   activator"
FT                   /note="transcription regulator; LysR family; Two other
FT                   possible translation starts lie upstream; the one chosen
FT                   aligns best with the NodD1 and NodD2 start sites; Helix-
FT                   Turn-Helix motif in N-terminal portion; Expression
FT                   activated by SyrM, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0840"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65116"
FT                   /db_xref="GOA:P23190"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23190"
FT                   /protein_id="AAK65116.1"
FT                   /translation="MRFKGLDLNLLVALDALMTKRSVTAAARSINLSQPAMSSAIARLR
FT                   SYFQDELFRMQGRELITTPRAEALAPAIRDALLHIQFSIISWDMFNPAQSDRCFRIILS
FT                   DFMTLVFFEKVVERVAREAPGVSFELLPPDDNPDELLRRGEVDFLIFPDVFMSSVHPKA
FT                   KLFDQTLVSVGCLTNEQLLGDLSFERYMSMGHVAAQFGRALKPSVEQWLLLEHGYKRRI
FT                   ELVVPGFNLIPPLLSGTKRIAIIPLRLANHFAKSIPLRIVKHPLPLLSFTEAVQWPALH
FT                   NKDQASIWMREILLDEAARIAAPRETAGCLGR"
FT   gene            464353..464802
FT                   /locus_tag="SMa0841"
FT   CDS_pept        464353..464802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0841"
FT                   /product="transposase, fragment"
FT                   /note="ORF in SyrM-NodD3 intergenic region, partial
FT                   similarity to IS3 family transposases, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0841"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65117"
FT                   /db_xref="GOA:Q92ZK8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK8"
FT                   /protein_id="AAK65117.1"
FT                   /translation="MATLVATGQPTPCKVRIPSCALGMVEDSLPRDANRQHRRRDLPRV
FT                   IFSGRTHRRSRDLRKSRLLHAEGAGGRAKVAELCRKHGISEATFYNWKAKHGGMEVSEA
FT                   KRLKALEEENAKLKKMLSGQMLGAAALRELLQCYGLPPGVKPSPI"
FT   repeat_region   464520..465432
FT                   /rpt_family="ISRm7 relic"
FT                   /note="Sma4006; region has similarity to IS3 family of
FT                   insertion sequence. Lack of inverted repeats and several
FT                   frameshifts in transposase open reading frames indicate
FT                   that this sequence is a nonfunctional insertion sequence."
FT   gene            464811..465101
FT                   /locus_tag="SMa5004"
FT   CDS_pept        464811..465101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5004"
FT                   /product="transposase, fragment"
FT                   /note="ORF in SyrM-NodD3 intergenic region, partial
FT                   similarity to IS3 family transposases, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5004"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07977"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLX9"
FT                   /protein_id="ACF07977.1"
FT                   /translation="MGLSERRACQIISADRKMVRYRSCRPPEVELRARLRELANERRRF
FT                   GYRRLFVLLRREKSRPGSTASIGCTARKRFRFANGSQTACRRHASADPRQG"
FT   gene            465166..465342
FT                   /locus_tag="SMa5029"
FT   CDS_pept        465166..465342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5029"
FT                   /product="transposase, fragment"
FT                   /note="Very short ORF fragment with transposase similarity,
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5029"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07978"
FT                   /db_xref="GOA:B3KLY0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLY0"
FT                   /protein_id="ACF07978.1"
FT                   /translation="MLYIVDDVTRECLAAIPDTSIARRRVAREVTALLERRGKPGMIVS
FT                   DHGMEFTSEAILA"
FT   gene            465363..465620
FT                   /locus_tag="SMa0846"
FT   CDS_pept        465363..465620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0846"
FT                   /product="transposase, fragment"
FT                   /note="ORF in SyrM-NodD3 intergenic region, partial
FT                   similarity to IS3 family transposases, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0846"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65118"
FT                   /db_xref="GOA:Q92ZK7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK7"
FT                   /protein_id="AAK65118.1"
FT                   /translation="MALHRTGKADVRHGYVERCNGRMRDELLNESLFFGLSHASRAISK
FT                   WSTTAIRSGRTRRSDTAPRQPILGSSPQPSQLVYRKRSRL"
FT   gene            465944..466360
FT                   /locus_tag="SMa0848"
FT   CDS_pept        465944..466360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0848"
FT                   /product="hypothetical protein"
FT                   /note="This ORF is not predicted by Critica or Glimmer; It
FT                   is located between syrM promoter and translational start
FT                   site; No similarity in database"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0848"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65119"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK6"
FT                   /protein_id="AAK65119.1"
FT                   /translation="MTVMRKRDFSCLAECHYKNVRYNRRAEVGSEINSDRLLCNESMIC
FT                   DQGLRCVEAVFFSKFQAGPLWRDHFVACSLALKYDVSRQFLESILDQRVFDIHQARPAR
FT                   PGGRHSQVLLINGKSRRFPFVGGPGKSLARTPIL"
FT   gene            466418..467398
FT                   /gene="syrM"
FT                   /locus_tag="SMa0849"
FT   CDS_pept        466418..467398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="syrM"
FT                   /locus_tag="SMa0849"
FT                   /product="SyrM transcriptional regulator"
FT                   /note="LysR family; SyrM activates nod gene expression
FT                   through NodD3 and increases EPSI production through SyrA,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0849"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65120"
FT                   /db_xref="GOA:P18561"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18561"
FT                   /protein_id="AAK65120.1"
FT                   /translation="MDQPTWKRPHRAKFAGVSDAAQQRQMPNLASIDLNLLVDLEALLQ
FT                   YRHITQAAQHVGRSQPAMSRALSRLRGMLKDDLLVAGSRGLVLTPLAECLTQMLPSVLD
FT                   AIRQMMNLSLAPAQRRWKVTMAMPDHQAVVLLPHLLPRLHERAPHLDIVTDPLLGGALG
FT                   LLEQGEIDVVVGQMGAAPLGYLRRRLYADSFTCVLRHNHPALAQEWTIEAFAALRHVAI
FT                   ASEPDELFGQIYDRLTKLGLQRGDPMVVSTVLTAAVLIAATDSVLVVPSRVATRVAAML
FT                   SLAVIPPPVELRPYEVALIWHERCHRDPEHRWLRGEIAAAASTAG"
FT   gene            complement(467700..468065)
FT                   /locus_tag="SMa0850"
FT   CDS_pept        complement(467700..468065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0850"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65121"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK5"
FT                   /protein_id="AAK65121.1"
FT                   /translation="MHLATMGTLSSCRFTPGRTVSLGRSQERYCVLDGADRPKYGWRAA
FT                   ERAPLKRPVPPRAPHGFSIVKTLLRVQFPTPRRNAAAKHSSVSADRSPRWRRGATDGTP
FT                   TFGAGSRIVIGSDERSI"
FT   gene            complement(468199..468942)
FT                   /gene="nodH"
FT                   /locus_tag="SMa0851"
FT   CDS_pept        complement(468199..468942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodH"
FT                   /locus_tag="SMa0851"
FT                   /product="NodH sulfotransferase"
FT                   /EC_number="1.8.4.8"
FT                   /note="TRANSFERS ACTIVATED SULFATE (PAPS) TO NOD FACTOR,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0851"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65122"
FT                   /db_xref="GOA:P06236"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06236"
FT                   /protein_id="AAK65122.1"
FT                   /translation="MTHSTLPPQPFAILAMPRTGTHYLEELVNEHPNVLSNGELLNTYD
FT                   TNWPDKERLLLSDRELLERAFLRYPPHSDKKVTHVGCKINEPQFQERPSFFAELTAWPG
FT                   LKVILVIRRNTLESLRSFVQARQTRQWLKFKSDSSAPPPPVMLPFATCEAYFKAADDFH
FT                   ARVVYAFDSSRIRLIEYERLLRDPVPCVATVLDFLGAPALQLADRGILRRQETRPLDQT
FT                   VRNFHELRVHFANGPYARFFELAND"
FT   gene            469631..469912
FT                   /gene="nodF"
FT                   /locus_tag="SMa0852"
FT   CDS_pept        469631..469912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodF"
FT                   /locus_tag="SMa0852"
FT                   /product="NodF acyl carrier protein"
FT                   /note="synthesizes Nod Factor fatty acyl chain, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0852"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65123"
FT                   /db_xref="GOA:P06232"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06232"
FT                   /protein_id="AAK65123.1"
FT                   /translation="MVDQLESEIIGIIKNRVESEGGDGETALIVGDLTAATELTALGVD
FT                   SLGLADIIWDVEQAYGIRIEMNTAEAWSDLQNVGDIVGAIRGLLTKGA"
FT   gene            469913..471121
FT                   /gene="nodE"
FT                   /locus_tag="SMa0853"
FT   CDS_pept        469913..471121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodE"
FT                   /locus_tag="SMa0853"
FT                   /product="NodE beta ketoacyl ACP synthase"
FT                   /note="Synthesizes Nod factor fatty acyl chain, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0853"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65124"
FT                   /db_xref="GOA:P06230"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06230"
FT                   /protein_id="AAK65124.1"
FT                   /translation="MDRRVVITGMGGLCGLGTDTTSIWKWMREGRSAIGPLLNTELHGL
FT                   KGIVGAEVKALPDHNIDRKQLVSMDRISVLAVIAAHEAMRQAGLSCNEGNALRFGATVG
FT                   VGLGGWDATEKAYRTLLVDGGTRTEIFTGVKAMPSAAACQVSMSLGLRGPVFGVTSACS
FT                   SANHAIASAVDQIKCGRADVMLAGGSDAPLVWIVLKAWEAMRALAPDTCRPFSAGRKGV
FT                   VLGEGAGMAVLESYEHATARGATILAEVAGVGLSADAFHITAPAVHGPESAMRACLADA
FT                   GLNAEDVDYLNAHGTGTKANDQNETTAIKRVFGDHAYSMSISSTKSTHAHCIGAASALE
FT                   MIACVMAIQEGVVPPTANYREPDPDCDLDVTPNVPRERKVRVAMSNAFAMGGTNAVLAF
FT                   KQV"
FT   gene            471615..472352
FT                   /gene="nodG"
FT                   /locus_tag="SMa0854"
FT   CDS_pept        471615..472352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodG"
FT                   /locus_tag="SMa0854"
FT                   /product="NodG 3-oxoacyl-(acyl carrier protein) reductase"
FT                   /note="Modifies Nod factor fatty acyl chain; Similar to
FT                   short-chain dehydrogenases/reductases; Similar to S;
FT                   meliloti FabG, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0854"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65125"
FT                   /db_xref="GOA:P06234"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06234"
FT                   /protein_id="AAK65125.1"
FT                   /translation="MFELTGRKALVTGASGAIGGAIARVLHAQGAIVGLHGTQIEKLET
FT                   LATELGDRVKLFPANLANRDEVKALGQRAEADLEGVDILVNNAGITKDGLFLHMADPDW
FT                   DIVLEVNLTAMFRLTREITQQMIRRRNGRIINVTSVAGAIGNPGQTNYCASKAGMIGFS
FT                   KSLAQEIATRNITVNCVAPGFIESAMTDKLNHKQKEKIMVAIPIHRMGTGTEVASAVAY
FT                   LASDHAAYVTGQTIHVNGGMAMI"
FT   gene            472764..473663
FT                   /gene="nodP1"
FT                   /locus_tag="SMa0855"
FT   CDS_pept        472764..473663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodP1"
FT                   /locus_tag="SMa0855"
FT                   /product="NodP1 ATP-sulfurylase small subunit"
FT                   /EC_number="2.7.7.4"
FT                   /note="Activates sulfate for transfer to Nod factor; PAPS
FT                   reductase family, CysD subfamily, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0855"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65126"
FT                   /db_xref="GOA:P13441"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13441"
FT                   /protein_id="AAK65126.1"
FT                   /translation="MSLPHLRRLEAEAIHVIREVVATFSNPVVLYSIGKDSSVLLHLAM
FT                   KAFYPAKPPFPFLHVDTKWKFREMIEFRDRMARELGFDLLVHVNQDGVEQGIGPFTHGS
FT                   NVHTHVMKTMGLRQALEKYGFDAALAGARRDEEKSRAKERIFSIRSAQHGWDPQRQRPE
FT                   MWKTYNTRVGQGETMRVFPLSNWTEFDIWQYILREEIPIVPLYFAARRPVVKREGMLIM
FT                   VDDDRMPIQPEEEVTEQLVRFRTLGCYPLTGAVESDAVTVPEILREMLTVRTSERQSRL
FT                   IDTDEVGAMEKKKREGYF"
FT   gene            473663..475588
FT                   /gene="nodQ1"
FT                   /locus_tag="SMa0857"
FT   CDS_pept        473663..475588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodQ1"
FT                   /locus_tag="SMa0857"
FT                   /product="NodQ1 ATP-sulfurylase large subunit-APS kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="PROVIDES ACTIVATED SULFATE FOR TRANSFER TO NOD
FT                   FACTOR; APS KINASE CATALYZES SYNTHESIS OF ACTIVATED
FT                   SULFATE; ATP + SULFATE = DIPHOSPHATE + ADENYLYLSULFATE; ATP
FT                   + ADENYLYLSULFATE = ADP + 3'-PHOSPHOADENYLYLSULFATE;
FT                   SIMILARITY TO GTP-EFTu FAMILY, high confidence in function
FT                   and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0857"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65127"
FT                   /db_xref="GOA:P13442"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13442"
FT                   /protein_id="AAK65127.1"
FT                   /translation="MSYVQSIPPHDIEAHLAEHDNKSILRFITCGSVDDGKSTLIGRLL
FT                   YDAKLVFEDQLANLGRVGSPGAANGKEIDLALLLDGLEAEREQGITIDVAYRYFATSKR
FT                   KFIVADTPGHEEYTRNMVTGASTADLAIILIDSRQGILQQTRRHSYIASLLGIRHVVLA
FT                   VNKIDLVDFKQQVYEEIVADYMAFAKELGFASIRPIPISARDGDNVISASANTPWYRGA
FT                   ALLEYLETVELDPTDQAKPFRFPVQMVMRPNADFRGYAGQISCGRISVGDPVVVAKTGQ
FT                   RTSVKAIVTYDGELATAGEGEAVTLVLSDEVDASRGNMLVAPGARPFVADQFQAHVIWF
FT                   DANPMMPGRSYILRTETDSVSATVTTLKHQVNINSFIREAAKSLQMNEVGVCNISTQAP
FT                   IAFDAYNDNRATGNFIIVDRVTNATVGAGLIDFPLRRADNVHWHALEVNKSARSAMKNQ
FT                   LPAVLWFTGLSGSGKSTIANELDRILHAQGKHTYLLDGDNVRHGLNRDLGFTEEDRVEN
FT                   IRRVAEVAKLMADAGLIVLVSFISPFRDERRMARELMEEGEFIEIFVDTPLDECARRDP
FT                   KGLYEKALAGKIANFTGVSSCYEAPENPELHIRTVGHQPNDLALAIEEFLDRRIGGQMT
FT                   PLQRPT"
FT   repeat_region   475589..476766
FT                   /rpt_family="ISRm8 fragment"
FT                   /note="Sma4007; region has similarity to IS66 family of
FT                   insertion elements."
FT   gene            475959..476840
FT                   /locus_tag="SMa0861"
FT   CDS_pept        475959..476840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0861"
FT                   /product="transposase, fragment"
FT                   /note="Has partial similarity to transposase of the IS66
FT                   family, hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0861"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65128"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK4"
FT                   /protein_id="AAK65128.2"
FT                   /translation="MAQAANAQAMLSDSEALIASLELAIEKLKRELRGLRSGRTALIDQ
FT                   MELQLEELVMAVTEDEVAAQAAAAKTSSVRSFTRKRPVRKPWPEDIERERVVIDPPVAY
FT                   ACCGGSRLSKLGEDVTETLKEIPRRFKVIETVREKFTCRDCEAISQPPAPFHATPRGFI
FT                   GPHLLATIPLRQVWNAYAAHPPEHPVQMRGPRAFDLDAGRPGRVWNGRAPATRGAQNPA
FT                   ALLGWLPSLALVPATTTCTEAESASWPPSSTSSPSTMGPNAQRRPGIPRGVRPKLQQSG
FT                   QWKYHQRRNQCR"
FT   gene            complement(477142..477930)
FT                   /gene="nodJ"
FT                   /locus_tag="SMa0863"
FT   CDS_pept        complement(477142..477930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodJ"
FT                   /locus_tag="SMa0863"
FT                   /product="NodJ ABC transporter, permease"
FT                   /note="Similarity to permease components of ABC
FT                   transporters; Cotranscribed with nodABC, yet NodJ substrate
FT                   is unknown, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0863"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65129"
FT                   /db_xref="GOA:O52619"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005981"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/Swiss-Prot:O52619"
FT                   /protein_id="AAK65129.1"
FT                   /translation="MWKLYVAALPANGWNWIAVWRRNYLAWKKVALASILGNLADPLIY
FT                   LFGLGAGLGMMVGRVDGVSYIAFLSAGMVATSAMTASTFETIYATFARMRAQRTWEAIL
FT                   HTQVTIGDIVLGELAWAATKASLAGTGIGVVAATLGYTEWVSLLYALPVIALTGLAFAS
FT                   LAMIVTALAPSYEYFIFYQTLVITPMLFLSGAVFPVNQLPGAFQHVTRILPLAHSIDVI
FT                   RPIMLGSPLVHVGLHIGALCCYAVVPFFLSTALLRRRLMP"
FT   gene            complement(477934..479001)
FT                   /gene="nodI"
FT                   /locus_tag="SMa0864"
FT   CDS_pept        complement(477934..479001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodI"
FT                   /locus_tag="SMa0864"
FT                   /product="NodI ABC transporter, ATP-binding protein"
FT                   /note="Similarity to ATP-binding components of ABC
FT                   transporters; Cotranscribed with nodABC, yet NodI substrate
FT                   is unknown, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0864"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65130"
FT                   /db_xref="GOA:O52618"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005978"
FT                   /db_xref="InterPro:IPR015851"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O52618"
FT                   /protein_id="AAK65130.1"
FT                   /translation="MTGNGRVLRQEAENQLSDREMAQEAPRWLEPSPFEWKDQTGLAVK
FT                   TAIPGAKPTVAIDVASVTKSYGDKPVINGLSFTVAAGECFGLLGPNGAGKSTITRMILG
FT                   MTTPGTGEITVLGVPVPSRARLARMRIGVVPQFDNLDLEFTVRENLLVFGRYFRMSTRE
FT                   IEAVIPSLLEFARLENKADARVSDLSGGMKRRLTLARALINDPQLLILDEPTTGLDPHA
FT                   RHLIWERLRSLLARGKTILLTTHIMEEAERLCDRLCVLEAGHKIAEGRPHMLIDEKIGC
FT                   QVIEIYGGDPHELSALVSPHARHIEVSGETVFCYASDPEQVRVQLDGRAGVRFLQRPPN
FT                   LEDVFLRLTGRELKD"
FT   gene            complement(479009..480289)
FT                   /gene="nodC"
FT                   /locus_tag="SMa0866"
FT   CDS_pept        complement(479009..480289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodC"
FT                   /locus_tag="SMa0866"
FT                   /product="NodC N-acetylglucosaminyltransferase"
FT                   /note="Catalyzes synthesis of Nod Factor backbone from N-
FT                   acetylglucosamine monomers; Has localized similarity to
FT                   glycosyltransferase and chitin synthase families, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0866"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65131"
FT                   /db_xref="GOA:P04341"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026463"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04341"
FT                   /protein_id="AAK65131.1"
FT                   /translation="MYLLDTTSTAAISIYALLLTAYRSMQVLYARPIDGPAVAAEPVET
FT                   RPLPAVDVIVPSFNEDPGILSACLASIADQDYPGELRVYVVDDGSRNREAIVRVRAFYS
FT                   RDPRFSFILLPENVGKRKAQIAAIGQSSGDLVLNVDSDSTIAFDVVSKLASKMRDPEVG
FT                   AVMGQLTASNSGDTWLTKLIDMEYWLACNEERAAQSRFGAVMCCCGPCAMYRRSALASL
FT                   LDQYETQLFRGKPSDFGEDRHLTILMLKAGFRTEYVPDAIVATVVPDTLKPYLRQQLRW
FT                   ARSTFRDTFLALPLLRGLSPFLAFDAVGQNIGQLLLALSVVTGLAHLIMTATVPWWTIL
FT                   IIACMTIIRCSVVALHARQLRFLGFVLHTPINLFLILPLKAYALCTLSNSDWLSRYSAP
FT                   EVPVSGGKQTPIQTSGRVTPDCTCSGE"
FT   gene            complement(480304..480957)
FT                   /gene="nodB"
FT                   /locus_tag="SMa0868"
FT   CDS_pept        complement(480304..480957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodB"
FT                   /locus_tag="SMa0868"
FT                   /product="NodB chitooligosaccharide deacetylase"
FT                   /note="Removes acetyl group from subunit of Nod Factor
FT                   backbone prior to addition of fatty acid moiety; In
FT                   addition to NodB, this family of polysaccharide
FT                   deacetylases includes chitin deacetylase from yeast, and
FT                   endoxylanases which hydrolyses glucosidic bonds in xylan,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0868"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65132"
FT                   /db_xref="GOA:P02963"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR026402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02963"
FT                   /protein_id="AAK65132.1"
FT                   /translation="MKHLDYIHEVPSNCDYGTEDRSIYLTFDDGPNPHCTPEILDVLAE
FT                   YGVPATFFVIGTYAKSQPELIRRIVAEGHEVANHTMTHPDLSTCGPHEVEREIVEASEA
FT                   IIAACPQAAVRHIRAPYGVWSEEALTRSASAGLTAIHWSADPRDWSRPGANAIVDAVLD
FT                   SVRPGAIVLLHDGCPPDESGALTGLRDQTLMALSRIVPALHERGFAIRPLPPHH"
FT   gene            complement(480954..481544)
FT                   /gene="nodA"
FT                   /locus_tag="SMa0869"
FT   CDS_pept        complement(480954..481544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodA"
FT                   /locus_tag="SMa0869"
FT                   /product="NodA N-acyltransferase"
FT                   /note="N-acyltransferase required for Nod factor synthesis,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0869"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65133"
FT                   /db_xref="GOA:P02962"
FT                   /db_xref="InterPro:IPR003484"
FT                   /db_xref="InterPro:IPR020567"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02962"
FT                   /protein_id="AAK65133.1"
FT                   /translation="MSLKVQWKLCWENQLERADHQELSEFFRKSYGPTGAFHAKPFEGG
FT                   RSWAGARPERRAIAYDSVGIASHMGVLRRFIKVGETDLLVAELGLYAVRPDLERMGIAH
FT                   SVGALTPTLRELGVPFAFGTVRHAMRNHVERYCQNGMASILTGVRVRSSIAEVNADLPS
FT                   TRTEDPLVVIFPVGRPLNEWPPGTLIERNGSEL"
FT   gene            481810..482736
FT                   /gene="nodD1"
FT                   /locus_tag="SMa0870"
FT   CDS_pept        481810..482736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodD1"
FT                   /locus_tag="SMa0870"
FT                   /product="NodD1 nod-box dependent transcriptional
FT                   activator"
FT                   /function="Transcriptional regulator"
FT                   /note="flavonoid-activated regulator, HTH domain, lysR
FT                   family, positive control of nod, nol, noe genes, PMID:
FT                   16085895, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0870"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65134"
FT                   /db_xref="GOA:P03031"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03031"
FT                   /protein_id="AAK65134.1"
FT                   /translation="MRFRGLDLNLLVALDALMTERKLTAAARRINLSQPAMSAAIARLR
FT                   TYFGDELFSMQGRELIPTPRAEALAPAVRDALLHIQLSVIAWDPLNPAQSDRRFRIILS
FT                   DFMILVFFARIVERVAREAPGVSFELLPLDDDPHELLRRGDVDFLIFPDVFMSSAHPKA
FT                   KLFDEALVCVGCPTNKKLLGNISFETYMSMGHVAAQFGREMKPSVEQWLLLEHGFNRRI
FT                   ELVVPGFTLIPRLLSGTNRIATLPLRLVKYFEQTIPLRIVTSPLPPLFFTEAIQWPALH
FT                   NTDPGNIWLREILLQEASRIDPQSDTC"
FT   gene            483424..483756
FT                   /locus_tag="SMa0872"
FT   CDS_pept        483424..483756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0872"
FT                   /product="hypothetical protein ORF 110"
FT                   /note="No similarity in databases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0872"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65135"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D4K9"
FT                   /protein_id="AAK65135.1"
FT                   /translation="MSRLGETAFCGRRRFGEFFSQSTHRLTACRPKGSHRGNALDRKCN
FT                   GVDQNGGEATASKRQANPSHHRRRKVLVGLDVDRHERRWHDGQEIGANPELGHQADHEG
FT                   RETEES"
FT   gene            483756..485081
FT                   /gene="nifN"
FT                   /locus_tag="SMa0873"
FT   CDS_pept        483756..485081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifN"
FT                   /locus_tag="SMa0873"
FT                   /product="NifN Nitrogenase Fe-Mo cofactor biosynthesis
FT                   protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="NifN forms an alpha2beta2 tetramer with NifE; NifN
FT                   and nifE are structurally homologous to nitrogenase MoFe
FT                   protein beta and alpha subunits respectively; NifEN
FT                   participates in the synthesis of the iron-molybdenum
FT                   cofactor (FeMoco) of the MoFe protein, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0873"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65136"
FT                   /db_xref="GOA:P12781"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12781"
FT                   /protein_id="AAK65136.1"
FT                   /translation="MVRILSQTKWATINPLKSSQPLGGALAFLGVGGAIPLFHGSQGCT
FT                   SFALVLLVRHFKEAIPLQTTAMDDVAIVLGGAGHLEQAILNLKIRAKPKLIGICTTALV
FT                   ETRGEDLAGDLASIKLERAEELTGTDVVLANTPDFDGAMEEGWAKAVTAMIKAITRIGE
FT                   QERQSRTIAILPGWNLTIADIEQLRDIVESFGLKPIILPDLSGSLDGIVPDDRWVPTTY
FT                   GGISVEEIRELGTAAQCIAIGEHMRGPAEEMKTLTGVPYVLFQSLTGLNAVDRFVSLLS
FT                   SISGRPAPAKVRRRRAQLQDALLDGHFHSAGKKIAIAAEPDQLYQLATFFICLGAEIVA
FT                   AVTTKGASKILHKVPVEIIQVGDLGDLESLATHADLLVTHSHGQHASARLGTPLMRVGF
FT                   PVFDQLGSQHKLTILYHGTRDLIFEVSNIFQSHSLAPTHRGT"
FT   gene            complement(485169..485654)
FT                   /gene="nodN"
FT                   /locus_tag="SMa0874"
FT   CDS_pept        complement(485169..485654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodN"
FT                   /locus_tag="SMa0874"
FT                   /product="NodN dehydratase"
FT                   /note="NodN (nodulation factor N) contains a single hot dog
FT                   fold similar to those of the peroxisomal Hydratase-
FT                   Dehydrogenase-Epimerase (HDE) protein, and the fatty acid
FT                   synthase beta subunit; Involved in root hair deformation
FT                   factor on Medicago, however the role played by NodN is
FT                   unclear, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0874"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65137"
FT                   /db_xref="GOA:P25200"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25200"
FT                   /protein_id="AAK65137.1"
FT                   /translation="MHEISLSDVSSLVGQELGTSKWITIDQAMINLFADATHDHQFIHV
FT                   DPNRAAAESPFGGAIAHGFLTLALLSVMNFSGMPKFREQTMGINYGFDRVRFISPVRTG
FT                   SRVHGRFVLSDCRLRRASILMTAYNVTVEIENENKPALTANWIAIAQFNPKDRPKAG"
FT   gene            complement(485661..488858)
FT                   /gene="nolG"
FT                   /locus_tag="SMa0875"
FT   CDS_pept        complement(485661..488858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nolG"
FT                   /locus_tag="SMa0875"
FT                   /product="NolG efflux transporter"
FT                   /note="Belongs to AcrB/AcrD/AcrF family of efflux pumps;
FT                   Members of this family are integral membrane proteins; Some
FT                   are involved in drug resistance, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0875"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65138"
FT                   /db_xref="GOA:P25197"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25197"
FT                   /protein_id="AAK65138.1"
FT                   /translation="MFLTRISINHPVFATMMMVMILVLGLFSYGRLGVDHYPETDLPVV
FT                   VVATTYTGASPESVESEISRPIEAALNTIGGIDTITSESYEGRSIVVVQFEVDVDSQDA
FT                   AQEVRDRVARLETKFPDGVATPQVTRYKPEGQAILSVAVSSTSRTLPEITTLATRVINN
FT                   RLSVISGVGQVSLIGSSERQVLVVVDPDRLGAYGLAVSTVIEAIRGENQDRAAGTLISG
FT                   INQRIVTVEGRIANTSGFNRIIVAQRNGYPVYLSEVATILDTGAEVTSLANYQGQTTLG
FT                   LHIVKVQGANTVEVASAVRREVSALNAELTKDNVQLTITRDNSRPIASQVSQVQRTLVE
FT                   GGVLSVLIVFIFLNSWRSTVITGLTLPISVIGTFAAIYALGFTLNIMTLMALSLSIGIL
FT                   IDDAIVVRENITRHLQMGKDPVRAALDGTNEIGLAVLSTTLCIVAVFLPVAFMGGLIGR
FT                   FFLQFGVTVAVAVVISLFVSFTLDPMLSSVWCDPQSQKTAKRGFFGQLIERFDQWFEGL
FT                   ASRYRSVIYFTFDYRKTTIAIVLGMFVVSLLLVPRIGTEFLPPPDQGEVSISLEANEGA
FT                   SLDYMAAKVGQIERALREFNYVSSTYSTINSGEMRGFNKALVAVQLVHSSQRRLKTAET
FT                   LGPIRRRLSRIAGLEISVGQRSEVVGSIKPLQLSILGDGDEELRRISDHITSVLAAIPG
FT                   ATEIESSIEKLRPTLAVRVRREAASDLGVSIATIGDTLRSLVAGDAISVWNSPDGETHD
FT                   VVVRLPAAGRENAAQLRNLPIATARMDDNGKPIMVLLDQVADVVESTAPAQITRKDLSR
FT                   DIRISSNIEGRTLGDVVADLKAAMTKMDIPVGFRISFGGDAENLTESTAYALQSLAMAV
FT                   IFIYIILASQFGSFIQPIAIIMTMPLSLMGVLLGLLFTGSTLNMFSMIGIMMLMGLVTK
FT                   NAILLVDYSNLGVREGKSLRQSLADAGAVRLRPIVMTTLAMIFGMLPTALGLGEGGAQR
FT                   APMAHAIIGGLISSTLLSLVFVPVVLTYLDAFAGRVRRWVPSPTGSNASAQHDGSDKTK
FT                   TPACALTSQDQLGTTIM"
FT   gene            complement(488862..489965)
FT                   /gene="nolF"
FT                   /locus_tag="SMa0876"
FT   CDS_pept        complement(488862..489965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nolF"
FT                   /locus_tag="SMa0876"
FT                   /product="NolF secretion protein"
FT                   /note="Involved in Medicago-specific Nod Factor
FT                   biosynthesis; Belongs to EmrA family of membrane fusion
FT                   proteins, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0876"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65139"
FT                   /db_xref="GOA:P25196"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25196"
FT                   /protein_id="AAK65139.1"
FT                   /translation="MTISAQCNLQKLAFATTLAVTIVLSQGRAIGQVKHGSPIELAKAD
FT                   VSTAVRQDMANEVRIVGSLTPIRRSTLTSRVSSTIIELPVQIGDVVNAGDLLVRFERGA
FT                   LESAVTGRKAEADALSAQTELAEAVLERNTRLGERGAASEATRLAALADVLDLRAQLRS
FT                   KQAEVSDAERSLSHAEVRAEFGGVIAARSVEEGQTVPLNTQLMTIVELNRLEVDAGVPT
FT                   SRIPLIRLKQSVELTVEGFPGRTFSGEVARISPTADAGSRAVRVFIAVDNEEGLLRGGM
FT                   FTIGDLRVDDQKDVIALPAASIRHDADGFFVLKVEAGVLQRRPVGLGRSWSDRDLVQVS
FT                   GVSEGDVIVTAPLPDLVVNTPVIIEGI"
FT   gene            complement(490023..491849)
FT                   /gene="nodM"
FT                   /locus_tag="SMa0878"
FT   CDS_pept        complement(490023..491849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodM"
FT                   /locus_tag="SMa0878"
FT                   /product="NodM Glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /note="Synthesizes subunits of core Nod factor; Belongs to
FT                   GlmS family; Contains amidotransferase and phosphosugar
FT                   isomerase domains; Strong similarity to GlmS of S;
FT                   meliloti, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0878"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65140"
FT                   /db_xref="GOA:Q92ZK3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZK3"
FT                   /protein_id="AAK65140.1"
FT                   /translation="MCGIVGIVGNQPVSERLVEALKRLEYRGYDSAGVATIDAGTLQRR
FT                   RAEGKLVNLESRLREEPLAGTIGIAHTRWATHGAPTERNAHPHFTEGVAVVHNGIIENF
FT                   AELKDELAAGGAEFQTETDTEVVAHLLTKYRRDGLGRREAMHAMLKRVKGAYALAVLFE
FT                   DDPSTIMAARNGPPLAIGHGSGEMFLGSDAIALAPFTNEITYLIDGDWAVIGKTGVHIF
FT                   DFDGNVVERPRQISTAAAFLVDKGNHRHFMEKEIYEQPEVIAHALGHYVNFIENRVVPI
FT                   SDAIDFGKVPSLAISACGTAYLAGLIGKYWFERYARLPVEIDVASEFRYREIPLSPQSA
FT                   ALFISQSGETADTLASLRYCKEHGLKIGAVVNARESTIARESDAVFPILAGPEIGVAST
FT                   KAFTCQLAVLAALAVGAGKARGTISGEEEQALVKSLAEMPRIMGQVLNSIQPKIESLSR
FT                   ELSKCHDVLYLGRGTSFPLAMEGALKLKEISYIHAEGYAAGELKHGPIALIDENMPVIV
FT                   IAPHDRFFDKTVSNMQEVAARGGRIILITDEKGAAASKLDTMHTIVLPEVDEIIAPMIF
FT                   SLPLQLLAYHTAVFMGTDVDQPRNLAKSVTVE"
FT   gene            complement(492523..493113)
FT                   /locus_tag="SMa0882"
FT   CDS_pept        complement(492523..493113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0882"
FT                   /product="conserved hypothetical protein"
FT                   /note="Matches domain of unknown function, DUF159; Weak
FT                   similarity to SMa0882"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0882"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65141"
FT                   /db_xref="GOA:Q92ZK2"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK2"
FT                   /protein_id="AAK65141.1"
FT                   /translation="MCNDYRLMVDVASIVEDFADLKIKVRFGEGAPNLEPREDIKITDV
FT                   GPIVRTLDGAPDEVELVQRRWSWPGPNKRPVYNFRSEGREFNSNRCLIIADGFYEFTEP
FT                   KDPKKKRKDKWLFTKKDEPIFCIAGIWREMPGVGQAFTMLTMEPGPDIAPYHDRQIVIL
FT                   ERCAWADWLDPTVSAKSLIRPLPIRTLSVEQVG"
FT   gene            493138..493668
FT                   /locus_tag="SMa0883"
FT   CDS_pept        493138..493668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0883"
FT                   /product="conserved hypothetical protein"
FT                   /note="Matches domain of unknown function, DUF159; Weak
FT                   similarity to SMa0882"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0883"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65142"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK1"
FT                   /protein_id="AAK65142.1"
FT                   /translation="MWGCCSCYVLTMTSATVFQSDAPLDERRVIIRRHDGDVEMVELPW
FT                   GLRPRDGDARAVNVVRSKGRTFPTHRCLVPASEFRHRTFSFSLANGDWFYFAGIWRPAI
FT                   NDWPESYAILTIEANDDLAPFHDRQMVVLRREQRMAWFDGLVPEGEILRRLPAGTFRVT
FT                   RHSTSPVQPMLAV"
FT   gene            complement(493801..494535)
FT                   /locus_tag="SMa0886"
FT   CDS_pept        complement(493801..494535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0886"
FT                   /product="hypothetical protein"
FT                   /note="Has very weak partial, perhaps spurious match to
FT                   domain from DNA polymerase; Possible nonfunctional protein;
FT                   May contain frameshift; This predicted open reading frame
FT                   overlaps with the upstream SMa5005"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0886"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65143"
FT                   /db_xref="GOA:Q92ZK0"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZK0"
FT                   /protein_id="AAK65143.1"
FT                   /translation="MPRSDLRQTTFRSLQGHLVADPRDIRRVHADDRAAIARRGLSRCF
FT                   RNPGGHGDSHRHRPGNPGKDQSDDRAQRLRRHLYNKFLAKMASGQNKPDGQFVITPKNG
FT                   PAFVEQLPIKKFQGVGPATAEKMHRLGIETRADLKEQTLEFLVEHFGESGPCFYGIARG
FT                   IDNCQVKADRVRKSVGAEDTSSEDIHSFEAAREGLQPLIEKVWSYCEANEISAKTVPLK
FT                   VKYADFPDHPEQDGCGTFANDR"
FT   gene            complement(494139..494702)
FT                   /locus_tag="SMa5005"
FT   CDS_pept        complement(494139..494702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5005"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to a region found in DNA polymerase;
FT                   Possible nonfunctional protein; May contain frameshift;
FT                   This predicted open reading frame overlaps with the
FT                   downstream SMa0886"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07979"
FT                   /db_xref="GOA:B3KLY1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLY1"
FT                   /protein_id="ACF07979.1"
FT                   /translation="MDAFYASVEQRGNPDLRGLPVAVGYPAARGVVAAASYEARKFGVH
FT                   SAMASVTARRKCPDLIFVKPRFEVYKAISLQIRAIFAEYTPMIEPLSLDEAYLDVSEIL
FT                   EGMEIATVIAQEIRAKIKATTELSASAGISTTSSWRRWPPVRTSRTASSSSRRRTARPL
FT                   SSSFRSRSFRASGPPQPKRCIGLG"
FT   gene            494568..495134
FT                   /locus_tag="SMa0887"
FT   CDS_pept        494568..495134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0887"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0887"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65144"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ9"
FT                   /protein_id="AAK65144.1"
FT                   /translation="MNAELSRLVAGGRHHAAGGRIADGDRQAPQVGIAALFDRCVEGIH
FT                   VHMHDFARPLAAFVVCHGLASIRTICIAQTWEVRAAFVTLRRLYRLAAHRHAPADHSEG
FT                   HASAKRFHQQLALKRAVAMTWAQMNSTIGFRRFFSFGARSFIGCRGRMRKIPIPAIDLN
FT                   PLAEFSDGQCRSTSARHMRIDSCSL"
FT   gene            495196..496014
FT                   /locus_tag="SMa0888"
FT   CDS_pept        495196..496014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0888"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0888"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65145"
FT                   /db_xref="GOA:Q92ZJ8"
FT                   /db_xref="InterPro:IPR017026"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ8"
FT                   /protein_id="AAK65145.2"
FT                   /translation="MSAAVATSNPVLHELRGKIASLEGAGSRNRSILPFGVPELDAQLP
FT                   GGGLAFGALHEVAGGGNGSIDGAAAALFIGGIAARTTGKVVWCLTRFDLFFPALAKVGL
FT                   HPDRVIFVECYKEETVLASFEEALRYGGLGAVVAELVRLPMTASRRLQLAAEKSGTLGL
FT                   VIRRWRRQTEASDFGMPTAAATRWRISVLPSEPLPVPGVGRARWLAELMRVRAGEGGEF
FT                   IIGACDGQGRICLSSETANGPDQAGRSFAIGRKAAGGHRQERFEAMDFGS"
FT   gene            495968..497392
FT                   /locus_tag="SMa0890"
FT   CDS_pept        495968..497392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0890"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has domain similar to DinP, a
FT                   nucleotidyltransferase/DNA polymerase involved in DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0890"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65146"
FT                   /db_xref="GOA:Q92ZJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ7"
FT                   /protein_id="AAK65146.1"
FT                   /translation="MVIARSGSKRWISAADTAATKLGLRVGMPAAKAQALVQGLVMIDA
FT                   DTAADLAALERLALWAFSQYSPVVAMDPPDGIVMDTEGADHLQGGEDLMLSSLVNRFRG
FT                   RGLAARAAIADTWGAAHALARTTDRETVIVGRGDAARAANRLPLSSLRLPAETVQSLRT
FT                   LGFTTVGDLAATPRAPLTLRFGLEVGRRLDQMFGHIAEPIDPIRPAELVEVQKSFAEPI
FT                   GAPETIEKYVSRLVRQLCLELERRGLGVRRADLIVHRVDNTIQALRAGTAKPVRDIAWL
FT                   TKLFRDRIDRIEPGFGIEKLGLAAILAEPLIEAQSASSLIEEQVTDVTPLIDVLGNRGG
FT                   QRIFRVAPVASDVPERSVRRIAPIADEDGATWPLNWPRPPRLLARPELIEVIALLPDHP
FT                   PVSFTWRSKRRRVKRADGPERIFGEWWKHSSEWVAVRDYFVVEDDRGERFWIFRSGDGV
FT                   DAETGSHKWFMHGMFA"
FT   gene            497392..500655
FT                   /gene="dnaE3"
FT                   /locus_tag="SMa0892"
FT   CDS_pept        497392..500655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE3"
FT                   /locus_tag="SMa0892"
FT                   /product="DnaE3 DNA polymerase III alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="This protein is more similar to homologs from other
FT                   species than to the other S; meliloti DnaE proteins,
FT                   function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0892"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65147"
FT                   /db_xref="GOA:Q92ZJ6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZJ6"
FT                   /protein_id="AAK65147.1"
FT                   /translation="MRYAELQVTTHFSFLRAASSAEELFATARLMGIEALGVVDRNSLA
FT                   GIVRALEASRATGLRLVVGCRLDLQDGMSILVYPTDRAAYSRLTRLLTLGKGRGGKANC
FT                   IIHFDDVALYAEGLIGILVPDLADEVCAVQLRKIAEVFGDRAYVSLCLRRRPNDQLQLH
FT                   ELTNLAVKHRVKTIVTNDVLFHEHGRRQLQDVVTCIRTGMTIDDVGFERERHADRYLKP
FT                   PEEMARLFPAYPEALARTMEIVERCRFSLEELVYQYPEEALILGMTAQQSLQHYTWEGV
FT                   RARYPEGLPTHVEKTIRHELALIETMKYAPYFLTVFSIVRYARSQGILCQGRGSAANSA
FT                   VCYVLGITSIDPETNDLLFERFVSQERDEPPDIDVDFEHERREEVIQWIYKTYGHDKAA
FT                   LCSTVTRYRAKGAIRDVGKALDLPEDLIRTLSSGIWSWSETVGERQVRELGLNPDDRRL
FT                   TLTLRLAQQLMGAPRNLSQHPGGFVLTHDRLDDLVPIEPATMADRQVIEWDKDDIEALK
FT                   FLKVDVLALGMLTCMAKAFALISEHKHEDIDLATIPQEDPATYAMIRKADTLGTFQIES
FT                   RAQMSMLPRMKPRTFYDLVIQVAIVRPGPIQGDMVHPYLRRREGKEKVEYPTPELEAVL
FT                   HKTLGVPLFQESAMRVAMVCAGFTGGEADQLRKSMATFKFTGGVSRFKDKLVNGMIRNG
FT                   YTKEFAEKTFSQLEGFGSYGFPESHAASFALIAYASNYIKCYFPDVFCAALLNSQPMGF
FT                   YAPAQIVRDAREHGVEVRPICINRSRWDCMLEPIDGSGGHAVRLGMRLVRGLATADAAR
FT                   IVAARADEPFTSVDDMWRRSGVPVASLVELAEADAFLPSLSLERRDALWAIKALRDEPL
FT                   PLFTAAADREARAIAEQEEPEVELRQMTDGQNVVEDYSHTGLTLREHPLRFMRDDLAKR
FT                   RIVTCAQAMTAHDGQWLMAAGLVLVRQRPGSAKGVMFITIEDETGIANIVVWPKLFERS
FT                   RRVVLGASMMAINGRIQREGEVVHLVAQQLFDLSADLSSLAERDGAFRPPTGRGDEFAH
FT                   GSPGSADSRGKAPPGVRARDILVPDLHIDTLKIKSRNFQ"
FT   gene            500772..501068
FT                   /locus_tag="SMa0894"
FT   CDS_pept        500772..501068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0894"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0894"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65148"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ5"
FT                   /protein_id="AAK65148.1"
FT                   /translation="MVGAGSACLSRDRLEYLRWIFREDLRKEFIRAYGNDAVGKVAEIA
FT                   HVEVTMTVARQRLLPRQHSDPWDRSACPALFFPSFQPASGNASSMTVRILLPG"
FT   gene            501235..501954
FT                   /locus_tag="SMa0896"
FT   CDS_pept        501235..501954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0896"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0896"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65149"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ4"
FT                   /protein_id="AAK65149.1"
FT                   /translation="MRSCRPAKGYFSPHPLPAKLVRGMICGMLDPFDPDRFIVRAEVHI
FT                   LGIEPKISRTLELPITLNLAQLHEVLQAAFGWTDSHLHQFNIGGLIYGAPEFDEDGLSD
FT                   SRTFEATEVRIIDLQFPYDPEENPLTILYEYDFGDNWRHLLRLERVARQEGVKYPRCLA
FT                   GKRSGPPEDVGGTSGYADFLDAWLDPDHEEHKAMRRWVGRKFHREACNLDEINKAIGKA
FT                   LRASKGDYRFRRESHRD"
FT   gene            502545..503021
FT                   /locus_tag="SMa0900"
FT   CDS_pept        502545..503021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0900"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has domain similar to KlcA, the E; coli anti-
FT                   restriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0900"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65150"
FT                   /db_xref="InterPro:IPR004914"
FT                   /db_xref="InterPro:IPR042297"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ3"
FT                   /protein_id="AAK65150.1"
FT                   /translation="MERGLSGLNPVASLESTSMSTSVIAPQSATIVPEASRPEFLPTLF
FT                   GRSLLIVAENAVYSLMERLSPLDYGGGFWTFYEHEGKPLFLAPQSKSRFRITGEITGFQ
FT                   GEVPAEAAGIIATLFAFSHLSFQYQSEHLSEGYGRLYAYSADHPEAVEIFQAID"
FT   gene            503167..504357
FT                   /locus_tag="SMa0903"
FT   CDS_pept        503167..504357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0903"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0903"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65151"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ2"
FT                   /protein_id="AAK65151.2"
FT                   /translation="MNTMISSPPPVSSGFRVDISRGERIGRVSSEWFSRPDDERFLSLS
FT                   DLLCAVSARTDRARVRTVESAEIRVEATRDNAERLAMIVPGGREPIAPTHWSYGQLCSL
FT                   AGAPASYMRQLPAPLAAINLQHGLLNHKAELVKTLEMDDGRVELRAVTGPEYGRIWDKD
FT                   LVAAVMSIAGTGTGDTIWKVPGVLDWSTMTHNPFVDITKDTTTLYASDRDVFLFLVDDT
FT                   HPIEAGRLPNGEPDLYFRGFYAWNSEVGSKTLGIASFYLRAVCANRNLWGTENFEEITI
FT                   RHSKFAAQRFAHEAAPALTNFANSSPAPFIAGIRAARERVVARNDEDRSEFLRKRGFSK
FT                   AETGKIIETVLSEEGRPPESIFDFVQGITALARGKAHQDTRLELEGKARKLLESAA"
FT   gene            504447..504848
FT                   /locus_tag="SMa0905"
FT   CDS_pept        504447..504848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0905"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65152"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ1"
FT                   /protein_id="AAK65152.1"
FT                   /translation="MTNIEASIICHPPIPLAHITPLETLVLTNTLECREIEASLVPFTD
FT                   FGAMHPIRVRLHELIEAFRASAPHVDSALNIFIASRIIALLPARSGNADTAASVDIDLS
FT                   EFPWPFVVQGHRGAIIEPPRSGGEATAIF"
FT   gene            complement(504976..506214)
FT                   /locus_tag="SMa0907"
FT   CDS_pept        complement(504976..506214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0907"
FT                   /product="conserved hypothetical protein"
FT                   /note="Protein of unknown function (DUF1173); This family
FT                   contains a group of hypothetical bacterial proteins that
FT                   contain three conserved cysteine residues towards the N-
FT                   terminal; The function of these proteins is unknown, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0907"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65153"
FT                   /db_xref="InterPro:IPR009553"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZJ0"
FT                   /protein_id="AAK65153.1"
FT                   /translation="MKRCPCTFGRSKGRIEVRNFAIGDQTLDESSPEFRALLPHAYEQK
FT                   LRPMCMCKEPPVPMYIARLDDQYLIKRMPLSGRDHDPACPSYEPPYELSGLGPLIGNAI
FT                   QIGASGKADLKLDFSLTKRGPRSAPGTSAEAAEPGIRSEPKKLSLRAMLHYLWEAGELT
FT                   EWRSTWTGRRGWGRVRTSLINAASQMTARGGPLSDMIFVPEVFHPDDKDGIAARRAAAL
FT                   KSIQTTGSGTRKLMMIVAEVKEFAGAREGHRIVVRHLPFPLMIEDGAWRRLAGRYDTEL
FT                   ELWRSSEALHLIVIATFGVSTAGIASVDEVALMVVNEHWLPFEDTHELRLLEKLSHLKR
FT                   KSVKGLRFNLPRDAPIVSVTLPEQKPVPVAMFIVPASAGDEYEQALTNMIDARPEIAPW
FT                   IWRVAEGEMPRLP"
FT   gene            506549..507442
FT                   /locus_tag="SMa0909"
FT   CDS_pept        506549..507442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0909"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to several short regions from a group
FT                   of large conserved proteins (>1400 amino acids) with
FT                   similarity to methylases and helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0909"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65154"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI9"
FT                   /protein_id="AAK65154.1"
FT                   /translation="MNVTSFRAANAAAVPLAPSVRADRAGKNLVAGHQLLPFLERGQAI
FT                   GTTDLRATLTNVVGGSDAEGFWAWKDAFAASEVAQILFLRKLGAAISARANAPQAALIM
FT                   LKNVVGLILTHTRRSEESQQLQQFSTPLRLGLVAAHAAGVMAIVQPPRFRMIATNVKAE
FT                   RRFLSTIARRLDALDAITRGQRQTGGLSRLSRNFGLDQTEVINADQVWQSLLGGSSVVA
FT                   LAGDMPLRRVRLMSDHRVALSGSTDGMRDRLKAMSLFSETIAWKLRFFIPTSEGGSAIL
FT                   ARLIERHPIVDVTGPV"
FT   gene            507448..508479
FT                   /locus_tag="SMa0911"
FT   CDS_pept        507448..508479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0911"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0911"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65155"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI8"
FT                   /protein_id="AAK65155.2"
FT                   /translation="MLSASQLADRLARDAEAVCRHYLSAGHRAGNYWIVGDVANSKGKS
FT                   LYVHLSGPRAGRWTDAATSQHGDLLDLVRETCGLVDFRDVADEVRRFLSLPHPAPSHRG
FT                   DAHTDPPVDRPAGERARRLFRMTKPLAGTLADSYLRQRGILRGDLHQALRFHPSCFYRD
FT                   LVTGRTFSYPALIAAVTDPSGAITGVQRTWLDPGGDGKAKVDDPRRALGGLLGNAVRFW
FT                   FPAHGPVPVTAAGEGLESILSVAHVMPGMPMAAALTANHLAAFRLPDGCRRLYIAADAD
FT                   AAGRHGAERLSRRAQALGILPLVLAPELGDFNEDLLRLGSDRLTVHLRAQLAPEDAEAF
FT                   LPT"
FT   gene            508807..509748
FT                   /locus_tag="SMa0914"
FT   CDS_pept        508807..509748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0914"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0914"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65156"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI7"
FT                   /protein_id="AAK65156.1"
FT                   /translation="MSLTSSLDDAFEPHHASSPADRFIYEMQIYGHRPFQDEPDPRPLP
FT                   EEPVVQSALTAMFDAVFEMLGDTRLEPDLEDLLWSTVNLFHRAGERIQRELQRNEEAQR
FT                   AGQSEQDGSEVKSVELERLIAEGITLLERRNAFEFMRDYAADLFEAQTGSAWRPRTGSK
FT                   VSHANMTAAMIDSRDFLSARRRAETEVLIPAGTKIAFGGGIDYNDHERIWAKLDQALAK
FT                   HPDMVLLHGGSPKGAERIAACWAEARKVTQIAFKPNWTKHAKAAPFRRNDDMLSVMPSG
FT                   VVIFPGSGITENLADKARRLGIPVWQASGSGA"
FT   gene            509885..510211
FT                   /locus_tag="SMa0917"
FT   CDS_pept        509885..510211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0917"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0917"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65157"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI6"
FT                   /protein_id="AAK65157.1"
FT                   /translation="MPEEHRELFAAEIDRLARPRGMTMSREFLPGQVIAYPYLWAWQHE
FT                   HGETEGRKTRPDRVVVAVRDANDGLTHLALLAFTTQPPQADRIALEVSDIECRRAGLSD
FT                   RKRC"
FT   gene            510778..511137
FT                   /locus_tag="SMa5006"
FT   CDS_pept        510778..511137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5006"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weak similarity to a group of small conserved
FT                   hypothetical proteins of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5006"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07980"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLY2"
FT                   /protein_id="ACF07980.1"
FT                   /translation="MVAERRRGVRESARGLIGDLRTTSSSVPHPSWKLVKLRIGKLDAD
FT                   IEEILAILPGRGFDRLDITDAHLIALTALPLYHRDPFDLLMAQSVAEGAHFVFQDQNVA
FT                   HYGIPFVTCSDPVVS"
FT   gene            511757..512080
FT                   /locus_tag="SMa0922"
FT   CDS_pept        511757..512080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0922"
FT                   /product="conserved hypothetical protein"
FT                   /note="Protein of unknown function (DUF736); This family
FT                   consists of several uncharacterized bacterial proteins of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0922"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65159"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI4"
FT                   /protein_id="AAK65159.2"
FT                   /translation="MATTIATLTQKTDGILEGVFATIRVNAPIAIIPNASKSSEEAPDY
FT                   RVIHRKTGFEIGAGWNRIARQTGEEYLSVKLEAPEIGVIFGNLAPAPGGDPSKKVILWN
FT                   NPD"
FT   gene            complement(513088..515007)
FT                   /gene="traG"
FT                   /locus_tag="SMa0929"
FT   CDS_pept        complement(513088..515007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="SMa0929"
FT                   /product="TraG conjugal transfer protein"
FT                   /note="The TraG/TraD/VirD4 family are bacterial conjugation
FT                   proteins involved in type IV secretion; These proteins aid
FT                   the transfer of DNA from the plasmid into the host
FT                   bacterial chromosome; They contain an ATP binding domain,
FT                   high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0929"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65160"
FT                   /db_xref="GOA:Q92ZI3"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR014135"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI3"
FT                   /protein_id="AAK65160.1"
FT                   /translation="MALKAKPHPSLLVILFPVAVTAAAVYVVGWRWPGLAAGMSGKTAY
FT                   WFLRAAPVPALLFGPLAGLLAVWALPLHRRRPVAMASLACFLTVAGFYALREFGRLSPS
FT                   VESGALSWDRALSYLDMVAVVGAVVGFMAVAVSARISTVVPEPVKRAKRGTFGDADWLP
FT                   MAAAGKLFPPDGEIVIGERYRVDKDIVHELPFEPNDPATWGQGGKAPLLTYRQDFDSTH
FT                   MLFFAGSGGYKTTSNVVPTALRYTGPLICLDPSTEVAPMVVEHRTRVLGREVMVLDPTN
FT                   PIMGFNVLDGIEHSRQKEEDIVGIAHMLLSESVRFESSTGSYFQNQAHNLLTGLLAHVM
FT                   LSPEYAGRRTLRSLRQIVSEPEPSVLAMLRDIQERSASTFIRETLGVFTNMTEQTFSGV
FT                   YSTASKDTQWLSLDSYAALVCGNAFKSSDIVSGKKDVFLNIPASILRSYPGIGRVIIGS
FT                   LINAMIQADGSFKRRALFMLDEVDLLGYMRLLEEARDRGRKYGISMMLLYQSLGQLERH
FT                   FGRDGAVSWIDGCAFASYAAVKALDTARNISAQCGEMTVEVKGSSRNIGWDTKNSASRK
FT                   SENVNYQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKDMNEAAKANRFV
FT                   KAIP"
FT   gene            complement(514998..515237)
FT                   /gene="traD"
FT                   /locus_tag="SMa0930"
FT   CDS_pept        complement(514998..515237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="SMa0930"
FT                   /product="TraD conjugal transfer protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0930"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65161"
FT                   /db_xref="GOA:Q92ZI2"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI2"
FT                   /protein_id="AAK65161.1"
FT                   /translation="MTADRKNEAREKFRLGAIVVRAGLTKADRAFLLGGFIELARVTPG
FT                   SAEHRRLRDIGEEAFKAPALDGGSPGTGETAEWH"
FT   gene            complement(515227..515514)
FT                   /gene="traC"
FT                   /locus_tag="SMa0933"
FT   CDS_pept        complement(515227..515514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="SMa0933"
FT                   /product="TraC conjugal transfer protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0933"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65162"
FT                   /db_xref="GOA:Q92ZI1"
FT                   /db_xref="InterPro:IPR012930"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI1"
FT                   /protein_id="AAK65162.1"
FT                   /translation="MAAKSSIADIDAQIEKLRARRRSLIVKSAERFARAATKSGLAEME
FT                   ITEEELDRIFEEMAARFRKGEKKGVDHATASPHRPAAGATGTAAEVSHDG"
FT   gene            515693..520312
FT                   /gene="traA1"
FT                   /locus_tag="SMa0934"
FT   CDS_pept        515693..520312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traA1"
FT                   /locus_tag="SMa0934"
FT                   /product="TraA1 conjugal transfer protein"
FT                   /note="Belongs to the MobA/MobL family; This family
FT                   includes of the MobA protein from the E; coli plasmid
FT                   RSF1010, and the MobL protein from the Thiobacillus
FT                   ferrooxidans plasmid PTF1; These sequences are mobilisation
FT                   proteins, which are essential for specific plasmid
FT                   transfer, high confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0934"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65163"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041533"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZI0"
FT                   /protein_id="AAK65163.1"
FT                   /translation="MAIMFVRAQVISRGAGRSIVSAAAYRHRARMIDEQAGTSFSYRGG
FT                   ASELVHEELALPDDIPAWLRAAIDGRSVAKASEALWNAVEAHETRADAQLARELIIALP
FT                   EELTRAENIALVREFVRDNLTSKGMVADWVYHDKDGNPHIHLMTALRPLTEQGFGPKKV
FT                   PVLGEDGEPLRVITPDRPNGKIVYKLWAGDKETIKAWKIAWAETANRHLALAGHEIRLD
FT                   GRSYAEQGLDGIAQKHLGPEKAALARKGIAMYFAPADLARRQEMADRLLAEPGLLLKQL
FT                   GNERSTFDERDIAKALHRYVDDPVDFANIRARLMASDELVLLKPQQIDAETGKAKQPAV
FT                   FTTREMLRLEYAMARSAEVLSRRKGFGVSNARAAAAVRSIETADTEKPFRLDPEQVDAV
FT                   RHVTRDNAIAAVVGLAGAGKSTLLAAARAAWEGEGRRVIGAALAGKAAEGLEDSSGIRS
FT                   RTLASWELAWENGREQLNRGDVLVIDEAGMVSSQQMARVLKAVEDAGAKAVLVGDAMQL
FT                   QPIEAGAAFRAISERIGFAELAGVRRQRDAWARDASRLFARGKVEEGLDAYAQQGRIVE
FT                   TETRAEIVDRIVADWADARRDLLQKSADGEHPGRLRGDELLVLAHTNDDVRKLNEALRN
FT                   VMIGEGALAGAREFQTARGLREFAAGDRIIFLENARFVEPRARRLGPQYVKNGMLGTIV
FT                   STGDRRGDTLLSVRLDSGRDVVISQDSYRNVDHGYAATIHKSQGSTVDRTFVLATGMMD
FT                   QHLTYVAMTRHRDRADLYAAKEDFEAKPEWGRKPRVDHAAGVTGELVKEGMAKFRPNDE
FT                   DADESPYADIRTDDGTVQRLWGVSLPKALKDAGVAEGDTITLRKDGVERVKVQVPIVDA
FT                   QTGEKRFEERQVDRNVWSASQLETAAARQERIERESHRPQLFKQLVERLSRSGAKTTTL
FT                   DFEDEAGYQAQARDFARRRGLYHLSLVAAGMEAEVLRRWAGIAEKREQVAKLWERASVA
FT                   LGFAIERERRVAYNEERTETLSTGIPSDGKYLVPPTTTFSRSVAEDARLAQLSSQRWKE
FT                   REAIVHPVLAKIYRDPDGALAALNALASDAAIEPRKLAEDLGKAPDRLGRLRGSELVVD
FT                   GRAARDERTAATVALSELLPLARAHATEFRRNAERFGIREQQRRAHMALSVPALSKTAM
FT                   ARLVEIEAVREQGGDDAYRTAFTYAVEDRLLVQEVKAVNEALTARFGWSAFTAKADVIA
FT                   ERNIAERMPEDLAPERREKLTRLFAVIRRFAEEQHLAERQDRSKIVAGASVELGKETFA
FT                   VLPMLAAVTEFKTTVDEEARERALAAPHYAHHRAALVETATRVWRDPADAIGKIEDLIV
FT                   KGFAGERIAAAVSNDPAAYGALRGSDRIMDKLLAVGRERKGALQAVPEAASRIRSLGAS
FT                   YASALDAETRGITEERRRMAVAIPGLSPAAEDALKRLAAQIKNKDGKLDVAAGSLDPHI
FT                   AREFAKVSRALDQRFGRNAILRGETDVINRVSPAQRRAFEAMRDRLTILQQAVRVQSSQ
FT                   EIISERQRRVIDRARSVTR"
FT   gene            complement(520761..522920)
FT                   /locus_tag="SMa0937"
FT   CDS_pept        complement(520761..522920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0937"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to S; meliloti SMb21251; Has similarity to
FT                   region found in mechanosensitive ion channel family
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0937"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65164"
FT                   /db_xref="GOA:Q92ZH9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH9"
FT                   /protein_id="AAK65164.1"
FT                   /translation="MRPPAWVSRPSITGAKDWKQMSAVFKHGDRGLAAIVLCLQLVFGL
FT                   AATVAAQEPATATAPPAKVQQLIELLDDPEVRQWLTAKQAAAPAAATTPAGLASQWIAE
FT                   IRRHLGGIRNAVPRVVPEWMAARERIAAEMHQGTMPILRGFAFLLLAGYGAEFLLRYLL
FT                   RRSASRSLAQFGPGLDALLRIAPLVVFAIAAIAAFVLAGWPRRLEVAVAPLLIAWIAAR
FT                   LLVAIAAAVFKPAEDGRALEGGVSLTPGAAHFWHRRFVLFACSVAFLWAVIDVMQALAF
FT                   PADVRDLTAAALGLVVLGLAIDTVLRRPVAEMSAGRRIMRNALLIGFLVLLWLVWVAGM
FT                   KVLFWLGIYVLGLPPLLRFTSATTRTMLDAEAADNVRVMRNVLIDRGARFAIIGLAAAW
FT                   LAVVFRINGSAMMQDDVFNRIFRGLLAGVVILLAADLIWQLAKGFIDLHLRRASVNGAA
FT                   DSAQLARSMRLRTLLPILRNFLAVFIAVVAGMMVLSGLGVHVGPLIAGAGVFGVAIGFG
FT                   SQTLVKDILSGVFYMMDDAFRVGEYIQSGSYKGTVESFSIRSVKLRHHRGPVFTVPFGS
FT                   LGAVQNMSRDWVIDKFMINVSYDADVAKVKKVVKGIGAALLDDPELGPLIIETVKMKGV
FT                   EQFGDYGITLSFAMTTKPGHQTQIRRRAQAMIKDAFAANSIHFASPTVQVAGDEAQATA
FT                   AAAATRDAIAKRNAAAAQKGETAAE"
FT   gene            523213..525114
FT                   /locus_tag="SMa0939"
FT   CDS_pept        523213..525114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0939"
FT                   /product="Sensory histidine kinase"
FT                   /note="Most similar to S; meliloti SMa1684; Contains
FT                   HATPase_c and HisKA domains, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0939"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65165"
FT                   /db_xref="GOA:Q92ZH8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH8"
FT                   /protein_id="AAK65165.1"
FT                   /translation="MIARSQARFGKIRVSPSCLNASAFICLLLVVIFAATGICSAQGAG
FT                   PVPRVLILYPYDERIPATNIVGEAARTRLVEATSGKVEVFSEFLDLSRFPKKGHVDRIA
FT                   RYLAEKYSDGRPDLVIALGEESTRFIVANRNAIAPDAKIVFGGFGNATAEELRLPNDVV
FT                   GALTEFEIRKTVEMAIGLQPDARQVVVIAGSAEFDKAWIAAAQEDLIGLPSDIETTYLT
FT                   GLSIEEFVERVAALPPDTIVIVLTVLSDRTGRNFVPRNSLEKIAKAASAPVYGPYSTYL
FT                   DHGVVGGNAATFESTGTAVAGLAIDALAGKAITDITVPQSYMADSRQLRRWGLSEADLP
FT                   LGTAVLFKERSLWQEYWKEIIAISAFVAAQSLVILSLVLERRRRAAAEFQARHRLLEVI
FT                   HLNQSATAGALSASIAHELNQPLGAIRINAETAALMLERPNPDLKLIQQILADIRDDDQ
FT                   RAGDIIDRMRGLLRKRSEIDWQEFDLNDVVRSAIHILHPEAQRRDVTVSSVASAQGLPV
FT                   RADRVHVQQVILNLAINAMDAMLQAPTAERNLMFQTAMVERNEKVEVSISDTGSGIPSD
FT                   KLSNIFDAFYTTKPTGTGLGLSIARVIIEIYGGKLWADNRPQGGAVFRFVLPLARPG"
FT   gene            525119..525733
FT                   /locus_tag="SMa0940"
FT   CDS_pept        525119..525733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0940"
FT                   /product="Response regulator"
FT                   /note="Contains a Signal receiver domain; originally
FT                   thought to be unique to bacteria (CheY, OmpR, NtrC, and
FT                   PhoB), now recently identified in eukaroytes ETR1
FT                   Arabidopsis thaliana; this domain receives the signal from
FT                   the sensor partner in a two-component systems; contains a
FT                   phosphoacceptor site that is phosphorylated by histidine
FT                   kinase homologs; usually found N-terminal to a DNA binding
FT                   effector domain; forms homodimers; Contains a LuxR-type
FT                   helix-turn-helix domain, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0940"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65166"
FT                   /db_xref="GOA:Q92ZH7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH7"
FT                   /protein_id="AAK65166.2"
FT                   /translation="MGPTVHIVDDDKSFRAAVGRMLAASGFQIESYSSGEELLARLPRG
FT                   SGCILLDLQMPGLSGLELQARLADLAPLLPVVFLTGRGDIGITVRAMKAGAHDFLEKPA
FT                   SSAAVLEAVERALQLCETRRKEHDRAQALHTLLASLTPRESQVSDQIVRGKRNKQIAFE
FT                   LNTSERTVKAHRHKVMEKLGVRSLAEVVSMAERLGLLEKTT"
FT   gene            525854..526237
FT                   /locus_tag="SMa0941"
FT   CDS_pept        525854..526237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0941"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has response regulator domain"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0941"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65167"
FT                   /db_xref="GOA:Q92ZH6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH6"
FT                   /protein_id="AAK65167.2"
FT                   /translation="MGTRPRTVAVVEDNPSMRTSVERLLNACGLRTEGYSSAEAFLSHA
FT                   TPAKLGCVVLDMHLVDMSGMELRRRLKTAHSRLPVIFITAIDDDALELEARRVGCLAYL
FT                   QKPFAAASLIAAVKEALAGDAMD"
FT   gene            526469..528106
FT                   /locus_tag="SMa0943"
FT   CDS_pept        526469..528106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0943"
FT                   /product="arylsulfatase"
FT                   /note="AslA, Arylsulfatase A and related enzymes, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0943"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65168"
FT                   /db_xref="GOA:Q92ZH5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH5"
FT                   /protein_id="AAK65168.1"
FT                   /translation="MSDKHANSRRHPSRREVLLAGGSLLAVTALGSLTGAGAKAQTAGK
FT                   KPNILVIFGDDIGWWNTSAYNRGQMGYQTPNIDRIADEGAIFTDLYAQQSCTAGRAAFI
FT                   TGQSCFRTGLLKVGLPGAKEGLSDKDPTLAELLKPHGYATGQFGKNHLGDRNEFLPTVH
FT                   GFDEFFGNLYHLNAEEEPENPDYPKDPQFRAKFGPRGVLRCVASDTDDPTEDPRFGRVG
FT                   KQKIEDTGPLDKRRMETVDGEFLGAAMNFIDKNQKAGKPFFCWFNATRMHIYTHLKPES
FT                   QGKTGLGLVADGMTEFDGMVGQLLKQLDDLGIADNTIVLFTTDNGAEVFSWPDGGSTPF
FT                   HGEKNTNWEGGYRVPGVMRWPGVIKPGTEINDIVSHEDWVPTFVAAAGEPDVKQKLLTG
FT                   YEAAGKTFKVHLDGYNQRELLAGSGPSSRKEYFYWTDDGNLAALRYDRWKLVFMEQRAE
FT                   GLDVWQDPLITLRFPKLIDLRADPFEIAQHVAGDYDRWRVEHAFALVPAQAFVVRHLQT
FT                   YVDFPPRQTPGSFALNEVMAKLQEGGRH"
FT   gene            528169..528744
FT                   /locus_tag="SMa0945"
FT   CDS_pept        528169..528744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0945"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0945"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65169"
FT                   /db_xref="GOA:Q92ZH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH4"
FT                   /protein_id="AAK65169.1"
FT                   /translation="MKGRLMTIEKARPTATIAERAKRELKEYALLSVYLYVCFGALVLY
FT                   KMAILGSQGVHVSAFGVPIIKALILGKFILLGHAMKLGERYGRLRLVSVIAYKAGLYLL
FT                   LLIVLSIVEEAIVGLSNGRTIAATLSEVGGAKLPELLATSMVMLLILIPYLASREFAVA
FT                   LGEGRLWGLLLEYRDSLDHGGPAHVAKE"
FT   gene            529150..529464
FT                   /locus_tag="SMa0947"
FT   CDS_pept        529150..529464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0947"
FT                   /product="hypothetical protein"
FT                   /note="has similarity to central region of the acid
FT                   phosphatase family of proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0947"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65170"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH3"
FT                   /protein_id="AAK65170.1"
FT                   /translation="MANLRLCRSSCPRSGMTTDEFDRIVCAWTSGAKHPNTGQLCMKMV
FT                   YQPRLELLAYHQSQRFQDVHCVRWGIDSMRVFSEECIPPEQVIGSSERPTSKCATERPC
FT                   "
FT   gene            complement(529782..530855)
FT                   /locus_tag="SMa0950"
FT   CDS_pept        complement(529782..530855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0950"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="Extracellular solute-binding protein, family 1; Most
FT                   similar to AttC of Agrobacterium tumefaciens and to ABC
FT                   transporters that transport polyamines, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0950"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65171"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH2"
FT                   /protein_id="AAK65171.1"
FT                   /translation="MISPLSRSTTVLKTAIAGLLSLLPISLPALGAEKVIIASTGGAYD
FT                   KALREAWFDPFTKATGIEVVTVAATNSEMRAKAAAMVKTGNVNWDLYLDGEIQAASKAH
FT                   RKVTEDLTEFCRQFADREDLSVNACSAGGALLQSTATLLAYRTGKHGDSVPATWADMWD
FT                   TRKFPGERAFPNFDDPWRVMAAALLADGVTRDELFPLDIDRALAKLDQIKPSVSLWWKT
FT                   GDQSVQGFRNGEYSLGQIWLTRAKAMQSEGLPIAWSYKAAFLVGDRIALLKGAPHRDNA
FT                   LKLITFWLNSPAAQAKACEVLSCTPPSSDAIAMMSDEARKTMPQGDDVRDYVIIPDAEW
FT                   INANAAMMLQRWNEWIR"
FT   gene            complement(530886..531749)
FT                   /locus_tag="SMa0951"
FT   CDS_pept        complement(530886..531749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0951"
FT                   /product="ABC transporter, permease"
FT                   /note="Permease component II; Most similar to AttB of
FT                   Agrobacterium tumefaciens and to ABC transporters that
FT                   transport polyamines, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0951"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65172"
FT                   /db_xref="GOA:Q92ZH1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH1"
FT                   /protein_id="AAK65172.1"
FT                   /translation="MSIDHAQLPGRVPALMDIFASPTIRAYSRAMGIIAIGVGIGCILF
FT                   FLLLPTLIVLPMSLSETDYIEFPPQGLTLKWYSAYFNDPDWMTATWFSLKIALATTATA
FT                   TVVGTMAALAIVRGSLPFRSTLQALALGPMIVPHIILGVALYLSFTPLQLTGSFYGFLV
FT                   AHTVLAVPYVIITVTASLQRFDPTLELAALNCGANRLQAFFLVVLPNIVPGVAAAAVFA
FT                   FLASFDEATVAFFISDIGGKSIGRKMFEDIDFNLTPVIAAVSTVLVATSLLLMGTLHLM
FT                   NRKSRS"
FT   gene            complement(531739..532629)
FT                   /locus_tag="SMa0952"
FT   CDS_pept        complement(531739..532629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0952"
FT                   /product="ABC transporter, permease"
FT                   /note="Permease component I; Most similar to AttA2 of
FT                   Agrobacterium tumefaciens and to ABC transporters that
FT                   transport polyamines, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0952"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65173"
FT                   /db_xref="GOA:Q92ZH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZH0"
FT                   /protein_id="AAK65173.1"
FT                   /translation="MTRSLASLPHSVSFRRSSSARFYSPIASMALVTPLLAAMLAGFLY
FT                   PVARLIALSFSGGTFSHYRRIFTEPLHLEVLFSTIEVAFVVTVAGLLLGFPVAYLMARL
FT                   SRGLAMAVAACVFVPLWTSVLIRSYAWVVLLQRNGIVNKLLADTGVTEGPLKLIYTQGA
FT                   VILAMTHVLMPFMILPIYSALRALPPDYVRAARNLGAGPIRAFVTVTLPLSLPGIFAGS
FT                   VMCFVLALGFYITPALVGGPSSMLMATLIGQQTTVLLDWPFAAALSTVLLAVTLLFVLM
FT                   FRRTLSLSKGLNSVY"
FT   gene            complement(532626..533744)
FT                   /locus_tag="SMa0953"
FT   CDS_pept        complement(532626..533744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0953"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Most similar to AttA1 of Agrobacterium tumefaciens
FT                   and to ABC transporters that transport polyamines, function
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0953"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65174"
FT                   /db_xref="GOA:Q92ZG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG9"
FT                   /protein_id="AAK65174.1"
FT                   /translation="MIGQSLSLAGLQKRYGEALAVRELSLEIAAGEFVSLLGPSGSGKT
FT                   TALTMIAGFESPNAGKIAIGGRDVTFLAPNHRNIGMVFQKYALFPHLTIRQNVAFPLRM
FT                   RGRMQKTAIAQRVEEMLDLVQLSSYAERYPNQLSGGQQQRVALARALAFEPPVLLMDEP
FT                   LGALDNKLREAMQFEIKRLQERLGATVVYVTHDQDEAMTMSDRVAIMSNGGLIQVGTPT
FT                   ELYRQPKTEFVADFIGRMNFLDGDCLDCTAEQTVVRFSERTVLRLRAAANERARKYDVG
FT                   TALRVAIRPERMRLAKRGDGGADALPGVVDAAVFIGSTYIFLVRLADRPEVSLQVQVAA
FT                   DGLLPFQRDDEVDIVLDGAAMHVFPVAERCAA"
FT   gene            534018..534710
FT                   /locus_tag="SMa0955"
FT   CDS_pept        534018..534710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0955"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /note="Most similar to AtrA of Agrobacterium tumefaciens;
FT                   In A; tumefaciens, AtrA mutants are nonattaching and
FT                   avirulent, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0955"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65175"
FT                   /db_xref="GOA:Q92ZG8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG8"
FT                   /protein_id="AAK65175.1"
FT                   /translation="MADNSKESPDLERAPERLGDAAYREMKERIIRGVYRPGHKLTVRA
FT                   IAQDLEVSTTPARDAINRLTSEGALFYAGPKTVVVPVLDASALREITLTRLALEGLASE
FT                   QAAQHGTPAEVEKLKSLQKLINSALDEKRYAEALWHNKEFHFTVYRLAGLPQLVSMIES
FT                   LWLRIGPSLHNLYPEFAEEKYGVRNHEIAMEALAERDAASLRAAMENDIRDGYRRLKRA
FT                   NPERNAGQ"
FT   gene            534818..536179
FT                   /locus_tag="SMa0956"
FT   CDS_pept        534818..536179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0956"
FT                   /product="Aminotransferase, class III"
FT                   /note="Most similar to AtrB, glutamate-1-semialdehyde
FT                   aminotransferase, of Agrobacterium tumefaciens; In A;
FT                   tumefaciens, this protein may be involved in attachment,
FT                   function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0956"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65176"
FT                   /db_xref="GOA:Q92ZG7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG7"
FT                   /protein_id="AAK65176.1"
FT                   /translation="MLVQATNRLRQASARSRSKHLFDRAKGVFTDGTTRASVERDPFPI
FT                   YAQRGEGAYLVDVDGNRLLDLNNNFTTLIHGHGFAHVSEAVVDLLRLGTCFANPTEHEI
FT                   ALAELLTARIPAMERVRFVNSGTEAVMFAIKAARAFTARPAIARIEGAYHGAYDWAEAG
FT                   QGVSPGKDGWDPIPIPTPTYRGTPSSVADEVHLLRFNDVEGLERRLSAASDRIACVLID
FT                   PMPSRAGLLHPEPTFIEALSETAHKYGILIVADEVLNLRQGYAGASPRYGLKPDLVTAG
FT                   KIIGGGFPIGAIGGREEVMRVFGTENARPLLPQGGTFSANPVSMAAGLAAMEAMTPDAF
FT                   DRLEAMGERLRAGLRASIASRDARFSVTGAASLFRIHPKRVAPLEYRDAHLSAEEAWIM
FT                   RTMSRYFLEAGILLPYGAAACLSTPMVHSDIDRILSAFDEFLEAKIGPEKERAK"
FT   gene            536176..537888
FT                   /locus_tag="SMa0958"
FT   CDS_pept        536176..537888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0958"
FT                   /product="Thiamine pyrophosphate-requiring protein"
FT                   /note="Contains a TPP-binding module; found in many key
FT                   metabolic enzymes which use TPP (also known as thiamine
FT                   diphosphate) as a cofactor; These enzymes include, among
FT                   others, the E1 components of the pyruvate, the acetoin and
FT                   the branched chain alpha-keto acid dehydrogenase complexes;
FT                   Similar to AtrC, acetolactate synthase, of Agrobacterium
FT                   tumefaciens; AtrC has been implicated in attachment in A;
FT                   tumefaciens, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0958"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65177"
FT                   /db_xref="GOA:Q92ZG6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG6"
FT                   /protein_id="AAK65177.1"
FT                   /translation="MTQQNPNVTVAQRIANILRRHGVEFIFGQSLPSAVILAAEAIGIR
FT                   QIAYRQENMGGAMADGYARVSGKVGVVAAQNGPAATLLVPPLAEALKASVPIVALVQDV
FT                   ERDQTDRNAFQDLDQIALFQSCTKWVRRVTVPERIDDYVDAAFTAAASGRAGPAALLLP
FT                   ADLLRAEAKSPAVVRSKQLGHWPLDRVRPSDDALAEVASLIAAAHAPIIIAGGGVHCGG
FT                   ATHELAALQQEACLPVFTTNMGKGAVDEYHPLSAGVLGSLVGPRSLGRYSYGLVEDADL
FT                   VILIGTRTNQNGTDTWRQIPSSARVVHIDVDPVEIGRNYEAIRLVGDARESLAALRAAL
FT                   TRVDLTRRHGDRARLEECIAQYWKGFELDRHDVVTSRSRPIRPERVMAELQDLLTGDVT
FT                   VVADASYSSMWVLGQLRARASGMRFITPRGLAGLGWGVPLAIGAKVARPGKPVIAVVGD
FT                   GGFAHSWAELETMVRMKLPVTIVVLNNGILGFQRDAETVKFGTYTTACHFAEVDHAKLA
FT                   EACGCPAVRVEDPGELAFHLHRGMDQGPLLIEVMTDPAAHPPLSLFAKMDEAA"
FT   gene            537885..538661
FT                   /locus_tag="SMa0959"
FT   CDS_pept        537885..538661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0959"
FT                   /product="short chain alcohol dehydrogenase-related
FT                   dehydrogenase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0959"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65178"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG5"
FT                   /protein_id="AAK65178.1"
FT                   /translation="MSRGSTSTIAVVTGGTSGIGLATARHLLERGNRCAIFGQRPINVE
FT                   SAAEALSQDFGSERVFARSVDLAEPTQITSFFRELDERWGRAEILVCNAGISPKGPDGP
FT                   TPFQEITLEEWNAVLSVNLTGTMLCCQAALPGMVAQNFGRVVLVGSIAGRALPKIAGTA
FT                   YVASKAALAGFARSLIARYAGQGITVNVVAPGRIATEMAGPRDSLVNRAAVARIPAGRM
FT                   GEPEEVAAAIGFLTSDKAAFINGAIIDVNGGEFVPL"
FT   gene            538682..539404
FT                   /locus_tag="SMa0961"
FT   CDS_pept        538682..539404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0961"
FT                   /product="Response regulator"
FT                   /note="Contains a CheY-like receiver domain and a winged-
FT                   helix DNA-binding domain, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0961"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65179"
FT                   /db_xref="GOA:Q92ZG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG4"
FT                   /protein_id="AAK65179.1"
FT                   /translation="MHAGVLIYTCNAELFLLLEYILETEGFPVRHCSDVSELVGTIGAR
FT                   KPLAVLVDCSDRQLEAYGLCRRIKATRDRPPIAVLTNAPSSDLSSLGIDIVICSPYDPR
FT                   HLLAFLKGIQTSLPYGSRPDVSREQIFRHADIEMNVTRIRVMRNGHAVSLSALQFRLLL
FT                   QLLSMPDVVHSRDDLIAAGWPPEAEVEPRTVDIHIGHIRRALNQFGPDVIRTVRSIGYS
FT                   LDGLAAPGGKSGALHSAG"
FT   gene            complement(539452..539682)
FT                   /locus_tag="SMa0964"
FT   CDS_pept        complement(539452..539682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0964"
FT                   /product="hypothetical protein"
FT                   /note="Has partial similarity to Y4oE [Rhizobium sp;
FT                   NGR234] and msl9199 [Mesorhizobium loti MAFF303099]"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0964"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65180"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG3"
FT                   /protein_id="AAK65180.1"
FT                   /translation="MSKIFDNTAVGEQSPRKDGFWQKQQQEEVVEAAIGLYGSEAATAA
FT                   AYCALEAWTERRDSDYGFWFEVFLRLRDRLT"
FT   gene            complement(539831..540751)
FT                   /locus_tag="SMa0967"
FT   CDS_pept        complement(539831..540751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0967"
FT                   /product="conserved hypothetical protein"
FT                   /note="has partial similarity to nucleotidyltransferase
FT                   domain; similar to S; meliloti Smb20835"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0967"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65181"
FT                   /db_xref="GOA:Q92ZG2"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG2"
FT                   /protein_id="AAK65181.2"
FT                   /translation="MKTSLDHLPQRKQRELARIVEVLHEEFADALKEGTADFKKLGRIL
FT                   KIILFGSYARGTWVDEPHTKKGYKSDYDLLIVVNNRKLTDFSSYWQKAQDRLMHLPEIR
FT                   TPVSLIVHSRREVNTALYDGEYFFVEIRRDGILLYELDDEPLAEPRPRGPADALRIAKD
FT                   YFEDRLPHAKTFVEGTQFFVSRGRRKEAAFLLHQSIEQTYAALLLVLTSYSPASHNLRH
FT                   LRSLAEERDQRLAEVWPRDQHQYVAWFNILNEAYVKSRYSKHYEISEDALAWLLERAHQ
FT                   LIADVEAICVEHLDRLRKQAEDDVD"
FT   gene            540997..541746
FT                   /locus_tag="SMa0969"
FT   CDS_pept        540997..541746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0969"
FT                   /product="Response regulator"
FT                   /note="Belongs to OmpR family, Response regulators
FT                   consisting of a CheY-like receiver domain and a winged-
FT                   helix DNA-binding domain, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0969"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65182"
FT                   /db_xref="GOA:Q92ZG1"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG1"
FT                   /protein_id="AAK65182.1"
FT                   /translation="MRQLDRMENQYTKPLVLICSGNANFYVLLAHILASEGFQTLLLGE
FT                   EEVVDQAALRPITAIILDSAQDPELTVRTCAAIKANEITSRIPTIALISSGNERYYLAL
FT                   LKAGIDENFVRPVSPARLLAYLGSLPHNGADDKQPTDPAREETAAIFGALRIEPGRRLV
FT                   RYGDEGAQFGRIEFNLLRCLLEAPGRVRSRLELIEAAWPSNRYVQPRTVDVHVARLRRE
FT                   LERLTGRPLIRTIRATGYAIDIDDGAD"
FT   gene            541929..543182
FT                   /locus_tag="SMa0972"
FT   CDS_pept        541929..543182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0972"
FT                   /product="putative aminotransferase"
FT                   /note="Has similarity to BioF, 7-keto-8-aminopelargonate
FT                   synthetase and related enzymes, conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0972"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65183"
FT                   /db_xref="GOA:Q92ZG0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZG0"
FT                   /protein_id="AAK65183.1"
FT                   /translation="MEGKALRQGSIAGKGAPRNTASLIQYAQDHFDAAHFQGLMAIYGR
FT                   PLADRAVALTHDRGRRVVDFVRCSYLGLDNHPQIVAGAVEAMKEYGTLHWSCARTRLNF
FT                   SILGDLEAALSELFDARVITYTTVLAANMGALPLIASGHLTGGVKPLMVFDRLAHATLA
FT                   FHKGTIAAETRVETIAHNDLEALEMLCRTNGSVAFVCDGVYSMGGSADLARLRRLQERY
FT                   GLFLYIDDAHGVSIFGKHGEGFARSQMSGPLGERTIVAASLGKGFGASGGLIMLGTARQ
FT                   EELFRRFAVAHAFSASLNVAAIGAARASQQLHLTEELTELQQRLRSRTALFDSLVPTEQ
FT                   QGSPLPIRTVEIGDEMTAIGAARALLDRGFYTSAIFFPTVARGRAGLRLCPTAGHSEDD
FT                   IRGLGIAIQDVLKEISGR"
FT   gene            543237..543596
FT                   /locus_tag="SMa0974"
FT   CDS_pept        543237..543596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0974"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0974"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65184"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF9"
FT                   /protein_id="AAK65184.1"
FT                   /translation="MYEHLAECCVFVAGKRNIIESVFLRVAEFCVSTVDNGTEKIFRFI
FT                   DGEAVVRAVDVGILMRVGATDVISYYGIRTALEGSILEVAVLPPEGLAWHPVGQRPSTA
FT                   TDPINSPLSSGSNLQ"
FT   repeat_region   complement(543791..544680)
FT                   /rpt_family="ISRm3"
FT                   /note="SMa3008; predicted by homology; fragment of ISRm3"
FT   gene            complement(543828..544616)
FT                   /locus_tag="SMa0976"
FT   CDS_pept        complement(543828..544616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0976"
FT                   /product="TRm3 transposase fragment"
FT                   /note="Missing about the first 140 amino acids of the
FT                   transposase, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0976"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65185"
FT                   /db_xref="GOA:Q92ZF8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF8"
FT                   /protein_id="AAK65185.1"
FT                   /translation="MTDTVLEAVGEWQNRPLELCYPLVFFDAIRVKIRDEGFVRNKAVY
FT                   VALAVLADGSKEILGLWIEQTEGAKFWLRVMNELKNRGCQDILIAVVDGLKGFPEAITA
FT                   VFPQTIVQTCIVHLIRHSLEFVSYKDRRTVVPALRAIYRARDAEAGLKALEAFEEGYWG
FT                   QKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEALNSKLRRAVRSRGHFPGDEA
FT                   AMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIFGERFFN"
FT   repeat_region   complement(544896..546009)
FT                   /rpt_family="ISRm24"
FT                   /note="SMa4008"
FT   gene            complement(544943..545944)
FT                   /locus_tag="SMa0977"
FT   CDS_pept        complement(544943..545944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0977"
FT                   /product="TRm24 transposase"
FT                   /note="Belongs to the IS30 family, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0977"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65186"
FT                   /db_xref="GOA:Q925Z3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q925Z3"
FT                   /protein_id="AAK65186.1"
FT                   /translation="MSQCYLQLTLPDRRRVHQLLERKVPIAEIARQLGRHRSTIYRELK
FT                   RNTFHDAEFPEYSGYYSGIANDISKERRRRLRKLSRHPQLRELVIEQLKALWSPEQIAG
FT                   RLLADGVSAVRVCTETIYRFIYSKEDYALELYQHLPEGRRKRRPRRSRKPRDGSIPLDC
FT                   RISQRPDFIADRSQFGHWEGDLLIFRRDLGEANVTSLVERKSRYTVMIKNGSRHSRPLI
FT                   DKIIDAFSPLPAFARQSFTFDRGTEFRGFKALEDGLGARSWFCDPNSPWQKGAVENTNK
FT                   RIRRFVPSDTDLSAVSQPQLVALAHHLNSLPRKCLGYRTPAEVFMAHLRDCG"
FT   gene            complement(546465..546884)
FT                   /gene="ntrR2"
FT                   /locus_tag="SMa0981"
FT   CDS_pept        complement(546465..546884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrR2"
FT                   /locus_tag="SMa0981"
FT                   /product="NtrR2 PIN domain protein"
FT                   /note="Is very similar to S; meliloti NtrR1; PIN domain
FT                   protein; This PIN (PilT N terminus) domain is a compact
FT                   domain of about 100 amino acids; The domain has two nearly
FT                   invariant aspartates; The function of the PIN domain is
FT                   unknown but a role in signaling appears likely, function
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0981"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65187"
FT                   /db_xref="GOA:Q92ZF7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF7"
FT                   /protein_id="AAK65187.1"
FT                   /translation="MSRLYMLDTNIVSELARNPQGAVTKRIAEVGPEAVCVSIITAAEL
FT                   RYGCAKKGSPKLLAQIEAILGSMQVLALDVPADAEYGNIRAELETAGKPIGPNDLFIAA
FT                   HACVLGAVLVTVNSSEFTRVRDLKVENWLDFTSSG"
FT   gene            complement(547033..547404)
FT                   /locus_tag="SMa0983"
FT   CDS_pept        complement(547033..547404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0983"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0983"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF6"
FT                   /protein_id="AAK65188.1"
FT                   /translation="MQAASTKGSSPSRSKIRSGSDVPMIMPNSTFPRATARRPSNGGPS
FT                   QHSMQRPRQRRLNLRGLSDQALEIQPMGMYMHMYIQRRARCPNSDTTNHHRQGKPSSSE
FT                   IIEVRLYVSPLILSFPAIG"
FT   gene            complement(547525..548370)
FT                   /locus_tag="SMa0985"
FT   CDS_pept        complement(547525..548370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0985"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0985"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65189"
FT                   /db_xref="GOA:Q92ZF5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF5"
FT                   /protein_id="AAK65189.2"
FT                   /translation="MFLHVAEQGGLAGAAERAGVSAPTIGRRMLALERAIGRALFVRAR
FT                   TGYELAPDGHVLLERVKAMYEAAQDIHNWQESVHSLPMVRLLSDSTLSCFTAASFNHLW
FT                   SPSDSFRVCFKTSEAILDLTYREADIGLAAERPETGNVAARRSVRIAYAPYCAQGFDQQ
FT                   RNNNWVSLGTDVANQRWKRWTFEHRGQFITNWVNAPRSMFDLVKAGAGVGVLPCFIGDR
FT                   DPGFLRAGHVIDELSHHLWIVLHDDERDRESVRTVADRLSALLAANAPLFCGFTGQDPL
FT                   "
FT   gene            complement(548397..548690)
FT                   /locus_tag="SMa0988"
FT   CDS_pept        complement(548397..548690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0988"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0988"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65190"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF4"
FT                   /protein_id="AAK65190.1"
FT                   /translation="MVSFVLRAAPSTPSVAFVRRSADFSNQLTIQPKPSHSRPSSGSAK
FT                   ALVLFLRCWVTSSLYTIVHCSSISFLRHAVWPECGSWRLEDVDAQAKGTFQR"
FT   gene            549348..549827
FT                   /locus_tag="SMa0990"
FT   CDS_pept        549348..549827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0990"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65191"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF3"
FT                   /protein_id="AAK65191.1"
FT                   /translation="MKPELEAMVEDALDVSVREFTWRCFFRLFAWENSLPISLMNKVTA
FT                   GPSVSFWPRTIVACRLPHPALPQPIAASGIMSDRSRGQPSKSGMSHREYLRHIITQRMN
FT                   LNHCFEGRSLLMSVQDRSSQSPLHIKADRRKYTERYDPASRSLLSISKPLSAVIG"
FT   gene            549895..550287
FT                   /locus_tag="SMa0992"
FT   CDS_pept        549895..550287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0992"
FT                   /product="hypothetical protein"
FT                   /note="is nearly identical to orf97 of pSmeSM11a, Has weak
FT                   similarity to carboxy terminus of TraA"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0992"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65192"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF2"
FT                   /protein_id="AAK65192.1"
FT                   /translation="MRSNAIRSLATPEQRRHRSRSHQAQRRHAEAVRCFASGRKAAVPS
FT                   RSSPARRKAARCWRRPTIARALEQRLGSADPRSFKEELDRLRVKDTAAIDRINEVASLV
FT                   DRTHRAELSRTYELTRSLKKGLGLSI"
FT   gene            complement(550344..550724)
FT                   /locus_tag="SMa5007"
FT   CDS_pept        complement(550344..550724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa5007"
FT                   /product="Possible transcriptional regulator"
FT                   /note="Contains predicted helix-turn-helix motif; Is nearly
FT                   identical to orf98 of pSmeSM11a, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa5007"
FT                   /db_xref="EnsemblGenomes-Tr:ACF07981"
FT                   /db_xref="GOA:B3KLY3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:B3KLY3"
FT                   /protein_id="ACF07981.1"
FT                   /translation="MLDLKAFRTLQSEGEYNAALKEVRPYFENEPDEGSEEAAHFDALV
FT                   LLIEQYEGKHYPIPTASPVEVVKSVMAANNYTRADLVAVIGSKARAADLLNGKREINLD
FT                   QIRKLSKEWNIPAGSLIGDVAA"
FT   repeat_region   complement(551238..552577)
FT                   /rpt_family="ISRm5"
FT                   /note="SMa3009; predicted by homology"
FT   gene            complement(551249..552481)
FT                   /locus_tag="SMa0995"
FT   CDS_pept        complement(551249..552481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0995"
FT                   /product="TRm5 transposase"
FT                   /note="Belongs to the Mutator family of transposases, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0995"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65194"
FT                   /db_xref="GOA:Q92ZF0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZF0"
FT                   /protein_id="AAK65194.1"
FT                   /translation="MTKTEGKTASAAVKDILLSNPDGLREVIRTVMQEVLEAEMDEALG
FT                   AAKGERTPERLGYRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVAT
FT                   LAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLIL
FT                   DARYEKVREAGVVMSQAVLIAVGIDWDGRRQILSVEMAGRESRSAWKDFLVRLKGRGLK
FT                   GVELVVSDDHAGLVAAIGEVIPEAAWQRCYVHFLRNALDHLPRKHGDDCLQELRWLYDR
FT                   RDLDEAKADLAAWLGKWSVRYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLN
FT                   EEIRRRTYVVRIFPNTESCPTPRPRARRRNPRKLDGGQSLHQHGRPARAQETRTPSSRM
FT                   TSTHDRPICRT"
FT   repeat_region   553040..554085
FT                   /rpt_family="ISRm25"
FT                   /note="SMa4009; putative IS element. Similar to IS1407 from
FT                   Mycobacterium celatum. Unable to identify inverted
FT                   repeats--may be fragment of IS element"
FT   gene            553196..553492
FT                   /locus_tag="SMa0997"
FT   CDS_pept        553196..553492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0997"
FT                   /product="transposase, fragment"
FT                   /note="Is very similar to the amino terminal 100 amino
FT                   acids of mutator family transposases, hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0997"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65195"
FT                   /db_xref="GOA:Q92ZE9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE9"
FT                   /protein_id="AAK65195.1"
FT                   /translation="MTDDMMNLRALVEKSPDADLLREMIGFAAERLMELEVGAATGDGY
FT                   GEKNPLRTAQRNGYRERDWETRAGTVELRIPKLEARALTFRASWSRGAWPRRR"
FT   gene            553516..554085
FT                   /locus_tag="SMa0998"
FT   CDS_pept        553516..554085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa0998"
FT                   /product="ISRm25b transposase"
FT                   /note="May be a nonfunctional transposase fragment; Similar
FT                   to mutator family transposases, but much shorter,
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa0998"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65196"
FT                   /db_xref="GOA:Q92ZE8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE8"
FT                   /protein_id="AAK65196.1"
FT                   /translation="MEGISTRSVDDLVKAMGMSGISKSQVSRLCEEIDGKVKAFLDRPI
FT                   EGDWPYLWIDATYLKVRRGGRIVSVAVIIAVGVNSDGRREVLGMEVGTSEAEPIWTEFL
FT                   RKLTRRGLRGVKLVVSDAHEGLKAAVTKVLSATWQRCRVHFMRNVLAHAGKSGRREIGA
FT                   GTCAAPNRRSECRKRSSLDPRSFAPL"
FT   gene            554434..555633
FT                   /locus_tag="SMa1001"
FT   CDS_pept        554434..555633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1001"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has histidine kinase domain; Nearly identical to
FT                   SMa1696"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65197"
FT                   /db_xref="GOA:Q92ZE7"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE7"
FT                   /protein_id="AAK65197.2"
FT                   /translation="MEAAKASKPDVSAVYAVDLSQRPVSQGDAAREKAALLQLARRMHE
FT                   APGEMLRRFVELAMELTGGISAGISLLEETEPPPVFRWHHLKGILSPFNGATTPRDFSP
FT                   CGITLDRSAPTLTIHPERVYDWIPPGLFLPEVLLVPLYIGRTEPLGTLWIVADRIEHFH
FT                   CGHAATMQELAGFIGIALKMVRSEEELQQALEQQELLTREMGHRLKNLFTILDSMVRIS
FT                   ARSTDNKDDLVALLSGRLHALAAAHSLVKPSFSDVQGAASSLAELLSIVLEPHEQPAIS
FT                   GKRRLSLTGPTVLCGEQSVNGLALVFHELATNAAKYGSLCGDLGTVDVVWQIDGDDLGI
FT                   TWREDGGAQATSSSPASKGFGSTLVEATVIRQFGGTLSYDWRSTGLSVHIVIPLCRLAQ
FT                   "
FT   gene            555788..556162
FT                   /locus_tag="SMa1002"
FT   CDS_pept        555788..556162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65198"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE6"
FT                   /protein_id="AAK65198.1"
FT                   /translation="MDKSTVGDSSRPCIMYPEVKSWCRRGSRPVVHDARREPLPLVSTI
FT                   GRKSPDCTSWRGRVVANDESRHSSWLAAMTAFHPLEKFSAHAAARIVGGVFQPRRRSRH
FT                   KAAAASISERSSRRQPAPAR"
FT   gene            complement(556399..556761)
FT                   /locus_tag="SMa1004"
FT   CDS_pept        complement(556399..556761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65199"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE5"
FT                   /protein_id="AAK65199.1"
FT                   /translation="MRGCGPAIRRDSAGYNRWKVNPRFWNIAGEPPGFPDPGVRIVQLH
FT                   YMAWVATSSMLPAAIQTAIAIIIRFSVSEIKPRGTLLDPPRQAHFSSTLSCFNERLFPI
FT                   QNVRQGFFCPVTNVTA"
FT   gene            556840..557640
FT                   /locus_tag="SMa1005"
FT   CDS_pept        556840..557640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1005"
FT                   /product="hypothetical protein"
FT                   /note="Amino terminus has similarity to proteins annotated
FT                   as multicopper oxidases; However, in these proteins, the
FT                   copper oxidase domain is found in the carboxy terminus"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1005"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65200"
FT                   /db_xref="GOA:Q92ZE4"
FT                   /db_xref="InterPro:IPR025509"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE4"
FT                   /protein_id="AAK65200.1"
FT                   /translation="MWPGIQFRNNPEPSVMKWGFILVTLYLGPVGLLLYVLADKERVPG
FT                   THEEFIKPLWKQGVGSTIHCVAGDATGIIVAAVVTAVLGLPMWLDIIEYAAGFALGLFI
FT                   FQALFMKNMMGGSYWENVRKSFMPEFISMNAMMAGMAPVLAILMMGRDMRAMWPSEMLF
FT                   WGVMALGVGVGFLAAYPFNVWLVAKGMKHGLMTDRSEHSSATPAATAMPPKLLTPQRIA
FT                   SGENTTPSTGNTRRRSPRRERRSLPWRRSRRSSSLPGSRIPSPR"
FT   gene            557826..558254
FT                   /locus_tag="SMa1007"
FT   CDS_pept        557826..558254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1007"
FT                   /product="conserved hypothetical protein"
FT                   /note="has similarity to domain found in multicopper
FT                   oxdiases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65201"
FT                   /db_xref="GOA:Q92ZE3"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE3"
FT                   /protein_id="AAK65201.1"
FT                   /translation="MQLQEWLKREWLTFPAMPMESALPNFFTINGKSYPATDTIRMKVG
FT                   RTLKVRFVGSHTAAIHPMHIHGGPFEVAAVDGVTLRQSARSLADTVNVGPGQRFDVLWK
FT                   AQRPGKWLIHCHISHHTTNNNVEIQGGGGLMLVIDVQS"
FT   gene            complement(558537..558992)
FT                   /locus_tag="SMa1008"
FT   CDS_pept        complement(558537..558992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1008"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has metal-binding domain; The function of the
FT                   members of this bacterial protein family is unknown; Some
FT                   members may be involved in conferring cation resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65202"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE2"
FT                   /protein_id="AAK65202.2"
FT                   /translation="MRRREFLFSVAAAGSIGLIGPARAANEKMIVYKDPNCGCCRAWAE
FT                   AMKAAGFSVSTEEAVDLAALKGRYAIPAEMHGCHTAIVADYYVEGHVPLDAVTRLLAER
FT                   PDIAGLAVPGMPEGSLGMGDHPRASYDVFAVNGDGSSTVYQTVRPKS"
FT   gene            559107..559328
FT                   /locus_tag="SMa1009"
FT   CDS_pept        559107..559328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1009"
FT                   /product="Heavy metal binding protein"
FT                   /note="Contains a heavy-metal-associated domain; HMA is a
FT                   conserved domain of approximately 30 amino acid residues
FT                   found in a number of proteins that transport or detoxify
FT                   heavy metals, for example, the CPx-type heavy metal ATPases
FT                   and copper chaperones; HMA domain contains two cysteine
FT                   residues that are important in binding and transfer of
FT                   metal ions, such as copper, cadmium, cobalt and zinc; In
FT                   the case of copper, stoichiometry of binding is one Cu+ ion
FT                   per binding domain, Similar to S; meliloti SMb20560, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65203"
FT                   /db_xref="GOA:Q92ZE1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE1"
FT                   /protein_id="AAK65203.2"
FT                   /translation="MYHLNIPEMTCGHCVSAVEKAVKSVDPNAKVVVNLEAKTASIDSQ
FT                   AASEAFVAAIEDAGYKASFAKSCCSHVA"
FT   gene            complement(559459..559965)
FT                   /locus_tag="SMa1010"
FT   CDS_pept        complement(559459..559965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1010"
FT                   /product="hypothetical protein"
FT                   /note="Similar to SMb20559"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65204"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZE0"
FT                   /protein_id="AAK65204.1"
FT                   /translation="MKKLLPVLAVLLSPTFAAAEGEHVHSSPYAGQEQSLSADDIAALE
FT                   TGAGLGLAKAAELNGMPGPSHVLTMKTELHLNGEQEDRTRNIFQRMRREAIAEGKRLVA
FT                   GEQALESAFRERSINHGGLREHLRRIEASRAKLRYIHLAAHLAMLHVLSVGQIDRYNEL
FT                   RGYSR"
FT   gene            560008..560433
FT                   /locus_tag="SMa1011"
FT   CDS_pept        560008..560433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1011"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains a CAP_ED, effector domain of the CAP family
FT                   of transcription factors; members include CAP (or cAMP
FT                   receptor protein (CRP)), which binds cAMP, FNR (fumarate
FT                   and nitrate reduction), which uses an iron- sulfur cluster
FT                   to sense oxygen) and CooA, a heme containing CO sensor; In
FT                   all cases binding of the effector leads to conformational
FT                   changes and the ability to activate transcription; Cyclic
FT                   nucleotide-binding domain similar to CAP are also present
FT                   in cAMP- and cGMP- dependent protein kinases (cAPK and
FT                   cGPK) and vertebrate cyclic nucleotide-gated ion-channels"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65205"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD9"
FT                   /protein_id="AAK65205.1"
FT                   /translation="MVALDMIAIMSDQILVYLQTKAVAKKSLEKNEHPFHRDDPVHALF
FT                   LVTEGCVNLLRYQEDGSPAVLQRSGGRSILAEASVFSDHYHCDAVAATQTSILVVPVGV
FT                   VRALLNNEPAFAAAWARHLSFELQSARKRAEIVSRAR"
FT   gene            560686..563166
FT                   /gene="actP"
FT                   /locus_tag="SMa1013"
FT   CDS_pept        560686..563166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /locus_tag="SMa1013"
FT                   /product="ActP Copper translocating P-type ATPase"
FT                   /function="Cation transport ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="Copper-translocating P-type ATPase, regulated by
FT                   HmrR, PMID: 11936079, high confidence in function and
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65206"
FT                   /db_xref="GOA:P58341"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58341"
FT                   /protein_id="AAK65206.1"
FT                   /translation="MTAFTQIEKSAAVPAPTDFGIEGMTCASCVRRVEKAISAVPGVAS
FT                   ATVNLATERASVQFTGAPDTGGVLLAIEKAGYEPKVIIQEFGIEGMTCASCVSRVEKAL
FT                   RTVPGVADASVNLATEKGTVRFVSGVDVAAIEAAVRDAGYDVRKAKASGATAEPEDRRE
FT                   LETRTLKRLVILSAVLTLPLFLVEMGSHFMPGVHEWIMENIGMRHNLYIQFALATAVLF
FT                   GPGLRFFRKGVPNLLRWTPDMNSLVVLGTTAAWGYSVVATFASGLLPSGTANVYYEAAA
FT                   VIVTLILLGRYLEARAKGRTSQAIKRLLGLQPKTAFVAHGDEFVEIQISDVVVGDVIRI
FT                   RPGEKIPVDGTVLDGNSYVDESMITGEPVPVQKAAGAEVVGGTINKNGSFTFRATKVGG
FT                   DTLLAQIIKMVETAQGSKLPIQALVDKVTAWFVPAVILVAVLTFAAWYVFGPSPALTFA
FT                   LVNAVAVLIIACPCAMGLATPTSIMVGTGRAAELGILFRKGEALQSLREADVIALDKTG
FT                   TLTKGRPELTDIVPADGFEADEVLSFVASLEALSEHPIAEAIVSAAKSRGIALVPATDF
FT                   EATPGFGVRGAVSGLPVQVGADRAFSGVGIDVSPFVVEAERLGNSGKSPLYAAIDGRLA
FT                   AIIAVSDPIKDTTPQAIKALHDLGLKVAMITGDNRRTADAIARQLGIDEVVAEVLPDGK
FT                   VDAVKRLREGGRKVAFIGDGINDAPALTEADVGIAVGTGTDIAIESADVVLMSGDLIGV
FT                   PKAIALSKATIRNIKQNLFWAFAYNVSLVPVAAGVLYPLNGTLLSPILAAAAMAMSSVF
FT                   VLGNALRLRSVNPA"
FT   gene            563252..563668
FT                   /gene="hmrR"
FT                   /locus_tag="SMa1014"
FT   CDS_pept        563252..563668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmrR"
FT                   /locus_tag="SMa1014"
FT                   /product="HmrR"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="Belongs to CueR family of transcriptional regulators
FT                   The CueR-like proteins have been shown to activate metal
FT                   ion efflux and resistance regulons in many eubacterial
FT                   species; Besides transcriptional regulator of the copper
FT                   efflux operon, CueR from Escherichia coli, the family
FT                   includes Pseudomonas aeruginosa CadR, E; coli MerR,
FT                   Ralstonia metallidurans PbrR, Rhizobium leguminosarum ActP
FT                   and E; coli ZntR that regulate expression of the cadmium,
FT                   mercury, lead, copper and zinc resistance operons,
FT                   respectively; These proteins are comprised of two distinct
FT                   domains that harbor the regulatory (effector-binding) site
FT                   and the active (DNA-binding) site; Their conserved N-
FT                   terminal domains contain predicted HTH (helix-turn-helix)
FT                   motives that mediate DNA binding, while the dissimilar C-
FT                   terminal domains bind specific metal ions; These proteins
FT                   share the N-terminal DNA binding domain with other
FT                   transcription regulators of the MERR superfamily that
FT                   promote transcription by reconfiguring the spacer between
FT                   the -35 and -10 promoter elements, high confidence in
FT                   function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1014"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65207"
FT                   /db_xref="GOA:P58378"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58378"
FT                   /protein_id="AAK65207.1"
FT                   /translation="MSGVSSKMIRYYEQIGLIRPALRTASSYRVYGDNDIHTLQFVRRA
FT                   RDLGFSVEQIKDLLALWRDRSRNSANVKAVALEHIAELERKIAAIEEMTTTLKHLASHC
FT                   HGDDRPECPIIEEIANAADGKKPRANARFGLSAL"
FT   gene            complement(563673..564947)
FT                   /locus_tag="SMa1016"
FT   CDS_pept        complement(563673..564947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1016"
FT                   /product="acyltransferase"
FT                   /note="This family includes a range of acyltransferase
FT                   enzymes, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65208"
FT                   /db_xref="GOA:Q92ZD8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD8"
FT                   /protein_id="AAK65208.1"
FT                   /translation="MPKSLLAQPQIVTVNTTVASYSPYFPTGQSLSAGTIEKVQSRALG
FT                   PDVLRSLAILLVILVHLPVEATPPSLVGHAWLGVDVFFVLSGFLIGTQLFREVARTGRV
FT                   DLKSFYLRRAFRIFPAFFVVLGLYAIFPVIWDASTMQSVWSFATFTVNFDFDPRVGRAF
FT                   SQAWSLCVEEHFYLVLPLLVLILHRRISMGSTLLIAGAMVGGGMALRYTIWESQVGVLV
FT                   AADKLGDAFAVYLRDVYYPTYTRLDGLIFGVILAAARFFKPELCKRYAPPRIALPIGFA
FT                   LVAAALVLFSIRGPLAGTNLFLVFQAQVGSVAGFPLISIGIALILGAMLDVEHILRRWP
FT                   FPGAATVATLSYSLYLTHKSVFHIDRLVFGEGNLQGGFGFAVYLATSFAAATMLWFCVE
FT                   RTFLLLRDRVLSPKRPLAKEGAHRF"
FT   gene            565090..565296
FT                   /locus_tag="SMa1017"
FT   CDS_pept        565090..565296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1017"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65209"
FT                   /db_xref="GOA:Q92ZD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD7"
FT                   /protein_id="AAK65209.1"
FT                   /translation="MLRWRGDKEMAKANDYPGMPRWVKISGLIVAVLISLAAMIVVFDI
FT                   GGPHGPGRHMSPNSEMPPAGDRP"
FT   gene            565293..565655
FT                   /locus_tag="SMa1018"
FT   CDS_pept        565293..565655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1018"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to region found in multicopper
FT                   oxidases"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65210"
FT                   /db_xref="GOA:Q92ZD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD6"
FT                   /protein_id="AAK65210.1"
FT                   /translation="MTMPPALRKFTLVVHVTSSVSSLGAVACFLALGLVGLASADVDTA
FT                   GSLYVAMDAIARLVIVPMVLASPSLITGLVQALGTVWGLFRHYWVLAKFLPTVLTAVVL
FT                   LLQLDLIGYVAGEAAT"
FT   gene            complement(565836..566402)
FT                   /locus_tag="SMa1021"
FT   CDS_pept        complement(565836..566402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1021"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has weak similarity to domain of class 2 cytochrome
FT                   C proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65211"
FT                   /db_xref="GOA:Q92ZD5"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD5"
FT                   /protein_id="AAK65211.2"
FT                   /translation="MINASRIRTAFVLLVVGAFATTIPAVTQSIATDNVAQRQDGMKAM
FT                   AAAAKTIDGMFKGSSVYDANAFKAAAETIRSHAGEKLSSLFDRSIAAPGSKASVNIEAE
FT                   RQSFDKLAADLGVYASALAAAAERYPDVISPQMRMQSGDAMIGGPLARKAKADRDVRSI
FT                   PAEHAFHLMLQTCTSCHAQFRVRAE"
FT   gene            complement(566897..567319)
FT                   /locus_tag="SMa1024"
FT   CDS_pept        complement(566897..567319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1024"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65212"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD4"
FT                   /protein_id="AAK65212.2"
FT                   /translation="MKTILKFVVAAAAVSTFGLAAATPASAQMTMPEACKSEMAASGTM
FT                   QMPGGDMGQMAEHQKAMMEGMRETEPAMMQGMMAKDPDVAFVCGMIAHHTAAINMSEVE
FT                   LKYGDDQQAKSMAEKIIEAQKKEIEEMTNWVEEHSN"
FT   gene            complement(567768..567962)
FT                   /locus_tag="SMa1028"
FT   CDS_pept        complement(567768..567962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1028"
FT                   /product="hypothetical protein"
FT                   /note="Has partial similarity to a group of conserved
FT                   hypothetical proteins; These conserved proteins belong to
FT                   the COG1238, predicted membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1028"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65214"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD2"
FT                   /protein_id="AAK65214.1"
FT                   /translation="MYRRYGRWSLLLSWMPLFGDALTVLAGVLREPLWSFLLLVTVAKT
FT                   GRYLVLAAATLGTKAAFGV"
FT   repeat_region   complement(568052..569369)
FT                   /rpt_family="ISRm1"
FT                   /note="SMA3010; predicted by homology"
FT   gene            complement(568081..568911)
FT                   /locus_tag="SMa1029"
FT   CDS_pept        complement(568081..568911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1029"
FT                   /product="TRm1b transposase"
FT                   /note="Belongs to the IS3 family of transposases, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1029"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65215"
FT                   /db_xref="GOA:Q7APC2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7APC2"
FT                   /protein_id="AAK65215.1"
FT                   /translation="MKSVCETLGVARSNIAARAAGSPSRARGRPPLPDRELVEDIKAVI
FT                   ADMPTYGYRRVHAILRRNARKLGRSWPNAKRVYRVMKLHNLLLVRHTGAVDNRLHEGQV
FT                   AVERSNIRWCSDGFEIGCDNKEKVRVAFALDCCDREAIAHVATTEGIKSQDVQDLVITA
FT                   VENRFGRINMLSEPIEWLTDNGSCFIAKDTASLLRDIGMEPCTTPVRSPQSNGMAEAFV
FT                   KTFKRDYVAVNPTPDAETVMAQLPFWFEHYNNLHPHSALGYQSPREFISSQSQT"
FT   gene            complement(568908..569279)
FT                   /locus_tag="SMa1030"
FT   CDS_pept        complement(568908..569279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1030"
FT                   /product="TRm1a transposase"
FT                   /note="Belongs to the IS3 family of transposases, high
FT                   confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1030"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65216"
FT                   /db_xref="GOA:Q926B1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q926B1"
FT                   /protein_id="AAK65216.1"
FT                   /translation="MEVLSGPERRRRWSTAEKLAIIHETYEADATVSIVARRHGIQPNQ
FT                   LFAWRKLASQGALTATAAEEEVVPASEYRALQAQVKELQRLLGKKTMESEILKEALEIA
FT                   GSPKKHLLRSLSLPRGILG"
FT   gene            complement(569367..569612)
FT                   /locus_tag="SMa1032"
FT   CDS_pept        complement(569367..569612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1032"
FT                   /product="hypothetical protein"
FT                   /note="Has membrane spanning domain; ORF truncated by
FT                   insertion of ISRm1"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1032"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65217"
FT                   /db_xref="GOA:Q92ZD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD1"
FT                   /protein_id="AAK65217.1"
FT                   /translation="MLWSIGGSPPGNADDIFKLGRGQMLALSAYLGLFAVAFGAATLLP
FT                   FQSEPLLVGLLLSGEFSTLGLVAVASFGNVLGAVCN"
FT   gene            569810..570190
FT                   /locus_tag="SMa1033"
FT   CDS_pept        569810..570190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1033"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to S; meliloti SMc02279"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65218"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZD0"
FT                   /protein_id="AAK65218.1"
FT                   /translation="MGMVRITLQKMLVLLRLAIVMSLTVYSLPTASAAMHGAWSNPEVT
FT                   QTDDHHPEIAGGAHTHGDQKSSPDDSQKLVKTDCCKGFCVSMALAAETNTVGGLRVTSI
FT                   REFVDDARTKGELPLLHRPPNI"
FT   gene            570243..570512
FT                   /locus_tag="SMa1036"
FT   CDS_pept        570243..570512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1036"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to S; meliloti SMc02280"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65219"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC9"
FT                   /protein_id="AAK65219.1"
FT                   /translation="MLSCAAAISYSDKTMKPLFFVAALPLFASGCASTLPPDVIASGDL
FT                   AASQAQVRPLRYTSPVSGYTHRVPVDPQPWRNQNDAQTPEGDAS"
FT   gene            570509..571975
FT                   /locus_tag="SMa1037"
FT   CDS_pept        570509..571975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1037"
FT                   /product="outer membrane protein"
FT                   /note="Has domain found in outer membrane efflux proteins;
FT                   The OEP family (Outer membrane efflux protein) form
FT                   trimeric channels that allow export of a variety of
FT                   substrates in Gram negative bacteria; Each member of this
FT                   family is composed of two repeats; The trimeric channel is
FT                   composed of a 12 stranded all beta sheet barrel that spans
FT                   the outer membrane, and a long all helical barrel that
FT                   spans the periplasm, Very similar SMc02281, conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1037"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65220"
FT                   /db_xref="GOA:Q92ZC8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC8"
FT                   /protein_id="AAK65220.1"
FT                   /translation="MMRATVKRAAALALPLVLGGGCVSASEYAAKNAGFSSVEAKTAEA
FT                   VGKQTVWIQSQQHARVVSDRVKTLMAKKAIDVETAVQVALLNNKGLQAAYADLGDSAAD
FT                   AWQSTMLVNPTVSVGLTGIGTPGLEAFKSVEGMIANNILALATRDRNIAIADTGFRRAQ
FT                   LNAALRTLQLASDTRRAWINAVAAWETVAQLNQAQAAADAASELAQELGKSGALTKEGQ
FT                   AREHVFSAELAGQTAKARLEARLAKEELTRLMGLWGSGIDYQVPNRLPQLPKGIMKRDL
FT                   IEAEALQRRVDLQMAKLDLEATAKSYKLTEATRYVTDLELLTGFETERELEEGDIKRET
FT                   TGQAELEFVIPIFDSGRARMRKAELAYMRAANLLAEKAVNVRSEARSAYQAYRANYDIA
FT                   RHYRNSVVPLRTKIEEESLLTYNAMITNTFELLADSREKVNANLLAVNAKRDFWLAEAN
FT                   LAPAIYGGGAGAAAGETEVAAAAEGGGGGH"
FT   gene            571990..573339
FT                   /locus_tag="SMa1038"
FT   CDS_pept        571990..573339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1038"
FT                   /product="Multicopper oxidase"
FT                   /note="CopA related protein; very similar to Smc02282 of S;
FT                   meliloti chromosome, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65221"
FT                   /db_xref="GOA:Q92ZC7"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC7"
FT                   /protein_id="AAK65221.1"
FT                   /translation="MFNRRQLLGASAALVSTAAWAKTSNMGLPDAAVMETAETQGPLKP
FT                   TSGPDYNPVVTLNGWTLPHRMNNGVKEFHLVAEPVEREMAEDMTAYLWGYNGQSPGPTI
FT                   EAVEGDRVRIFVTNKLPEHTTIHWHGMILPSGMDGVGGLSQPHIPVGKTFVYEFDLVKS
FT                   GTFMYHPHSDEMVQMAMGMMGFFVIHPKDPKFMPVDRDFVFLLNAYDIDPGSYVPRIME
FT                   MTDFNMWCWNSRIFPDISPLVVSKNDRVRVRVGNLTMTNHPIHMHGYDFEVTCTDGGWV
FT                   RPEARWPEVSIDIPVGAMRAYEFDAKYAGDWAIHCHKSHHTMNAMGHDIPTFIGVDKSK
FT                   VAEKIKKLRPEYMPMGTKGMADMGEMEMEIPENTIPMMTGWGPHGPIEMGGMFSVVKVR
FT                   EGISAGDYADPGWYENPPGTQAWEWTGELPDWTKAKDAKTQITPKHKNHG"
FT   gene            573346..573858
FT                   /locus_tag="SMa1041"
FT   CDS_pept        573346..573858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1041"
FT                   /product="Copper binding protein"
FT                   /note="Copper binding proteins, plastocyanin/azurin family,
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65222"
FT                   /db_xref="GOA:Q92ZC6"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC6"
FT                   /protein_id="AAK65222.1"
FT                   /translation="MPMFNQPKDHTMKALIFGLLVAAHASPALAAGSHAGGHGEAMVVG
FT                   EPGKKAQATQTIQVTMKETDDGKMIFTPSTFNVSKGQTIRFAIKNAGELDHEFVLDQED
FT                   KIMEHKAVMEKFPDMEHDDPNAIRLAAGESGEIVWKFTNDGTFKIACLVPGHYDAGMHG
FT                   DVTVAKK"
FT   gene            573878..574162
FT                   /locus_tag="SMa1043"
FT   CDS_pept        573878..574162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1043"
FT                   /product="conserved hypothetical protein"
FT                   /note="Highly similar to S; meliloti SMc02284"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1043"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65223"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC5"
FT                   /protein_id="AAK65223.1"
FT                   /translation="MKSLIKLTLATALAIGTVSGAFAQEFTKATVKKVDAKAKKVTLIH
FT                   EELKSLEMPAMTMVFRVQDDAILEKLKEGANVEFVAERVNGKLTVTQVK"
FT   gene            574255..574542
FT                   /locus_tag="SMa1045"
FT   CDS_pept        574255..574542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1045"
FT                   /product="hypothetical protein"
FT                   /note="Similar to amino terminus of S; meliloti cyaE
FT                   (SMc02285)"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65224"
FT                   /db_xref="GOA:Q92ZC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC4"
FT                   /protein_id="AAK65224.1"
FT                   /translation="MTSSLHPQWDFAREFRSIILRFVAFAILVANFLLGGNEGAEGTHS
FT                   IVIVSYLAISIAAVATARYVPGRSWLKAFFVVLDALLVTLILYAHILAGR"
FT   gene            574539..575606
FT                   /gene="cyaE2"
FT                   /locus_tag="SMa1046"
FT   CDS_pept        574539..575606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaE2"
FT                   /locus_tag="SMa1046"
FT                   /product="CyaE2 adenylate/guanylate cyclase"
FT                   /function="Adenylate cyclase, family 3 (some proteins
FT                   contain HAMP domain)"
FT                   /EC_number="4.6.1.1"
FT                   /note="Small molecule metabolism; Global functions, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1046"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65225"
FT                   /db_xref="GOA:Q92ZC3"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC3"
FT                   /protein_id="AAK65225.1"
FT                   /translation="MTENHNLTTTSLVVALILLNHAGLQLERRLVLIFSGIVLIAWVAM
FT                   LAITAVRHHTADAMSLLASFFNQDLGLTVAVGFTAFAIYLLARDHDRTRKEALKADRRR
FT                   HNLTRFFSPLIVSELQERGQALGLERRNAAIMFVDLRDFTSFAETATARELAFVLAEYR
FT                   QLVSQTIFDHGGTVDKFIGDGVMAVFGQPRPTDDDADRALACALDLVDTLSDWRSHGVR
FT                   IGYPALDAAIGLHYGTVVGGVLDSGCHSEFTVIGDAVNVAQRLETLAKSLDASLVISSN
FT                   LVARLQSPVPPAAWMSVTSAALPGRRLPIDVWYLLRATDSARGHNTPGYDTGVSQTALQ
FT                   RSAFQSLPAPDMGTM"
FT   gene            complement(576097..576642)
FT                   /locus_tag="SMa1050"
FT   CDS_pept        complement(576097..576642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1050"
FT                   /product="Hypothetical protein"
FT                   /note="Has some similarity to a group of conserved
FT                   hypothetical proteins of unknown function (DUF81; SMa1050
FT                   appears to have an approximately 80 amino acid central
FT                   deletion compared to members of the DUF81 family"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65226"
FT                   /db_xref="GOA:Q92ZC2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC2"
FT                   /protein_id="AAK65226.1"
FT                   /translation="MSTSILAAVGSGGIVGFMLGLLGGGGSILATPLLLYVVGVTQPHV
FT                   AIGTGALAVSVNAFANFASHAIKGHVWWRCAAVFSALGVLGALGGSSLGKAMDGDRLIF
FT                   LFGILMVVVIGGGIVGGVLGMLLATRLSAYKNILHRLFAALIFVVAAYILYQSARQAGA
FT                   HQSLLDPHVVFDGAHAPS"
FT   gene            complement(576639..577070)
FT                   /locus_tag="SMa1052"
FT   CDS_pept        complement(576639..577070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1052"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Weak similarity to pfam04143, DUF395, YeeE/YedE
FT                   family (DUF395); This family includes YeeE and YedE from E;
FT                   coli; These proteins are integral membrane proteins of
FT                   unknown function; Many of these proteins contain two
FT                   homologous regions that are represented by this family;
FT                   This region contains several conserved glycines and an
FT                   invariant cysteine that is probably an important functional
FT                   residue, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65227"
FT                   /db_xref="GOA:Q92ZC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC1"
FT                   /protein_id="AAK65227.1"
FT                   /translation="MNRNICQFGAALASGIVFGFGLSLSGMLNPARVQGFLEVFGTWDP
FT                   SLAFVLGGAVVVAFIGVQVMKLMRHPAFDDTFHVPTIRRIDAPLVIGSAVFGLGWGIGG
FT                   FCPGPAVASLALGLPQTVLFVVAMLVGMTLHDRLWSRGT"
FT   gene            complement(577067..577477)
FT                   /locus_tag="SMa1053"
FT   CDS_pept        complement(577067..577477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1053"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Has weak similarity to pfam04143, DUF395, YeeE/YedE
FT                   family (DUF395); This family includes YeeE and YedE from E;
FT                   coli; These proteins are integral membrane proteins of
FT                   unknown function; Many of these proteins contain two
FT                   homologous regions that are represented by this family;
FT                   This region contains several conserved glycines and an
FT                   invariant cysteine that is probably an important functional
FT                   residue"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1053"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65228"
FT                   /db_xref="GOA:Q92ZC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZC0"
FT                   /protein_id="AAK65228.1"
FT                   /translation="MSAYLPSLAGGMLIGASAVMLLLLNGRIAGISGIVGRLLQGVGMT
FT                   TNLAFVLGLLLGPLAYLLMFGSWPAVQITAGWPLIIIAGLLVGFGSRMGSGCTSGHGVL
FT                   GLARVSPRSMVAVATFLTAGVAAVALLRGLAL"
FT   gene            complement(577474..577821)
FT                   /locus_tag="SMa1056"
FT   CDS_pept        complement(577474..577821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1056"
FT                   /product="Transcriptional regulator, ArsR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1056"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65229"
FT                   /db_xref="GOA:Q92ZB9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB9"
FT                   /protein_id="AAK65229.1"
FT                   /translation="MGMSTDLEAVLKAGLSPAEMASRAGEVAKLLKTLSHPARLMIVCT
FT                   LVQGEYSVGELEEKVDVHQPHLSQHLTVLRGSGIVQTRRDGKQIFYRLTGEKAARLIAA
FT                   LYDIFCVKEDK"
FT   gene            complement(577812..579110)
FT                   /locus_tag="SMa1057"
FT   CDS_pept        complement(577812..579110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1057"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Contains a GloB domain, found in Zn-dependent
FT                   hydrolases, including glyoxylases in the carboxy-terminus;
FT                   The amino terminus is similar to conserved hypothetical
FT                   proteins of the DUF442 family (COG3453)"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1057"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65230"
FT                   /db_xref="GOA:Q92ZB8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB8"
FT                   /protein_id="AAK65230.1"
FT                   /translation="MPITAISDKLSVSPQLSVEDIPSLRDKGFKTLINNRPHKEDTFQP
FT                   NTQAERQEVKHCGLTYAFIPVTADTITEADVRAFQRAVDESDGPVLAHCQTGGRSLNLY
FT                   LIGEVLDGRMSADEADAFGRSRGFDTSVAAAWLKQHAARRPQVKGFFDKRTWSVQYVVS
FT                   DPETGKCAIIDPVLDFDERAGATATINADAILDYVRDNGLTVEWILDTHPHADHFSAAQ
FT                   YLKEKTGAQTAIGERVVDVQKLWQKIYNWPELATDGSQWDRLFADGEDFKIGSIDAKVL
FT                   FSPGHTLASITYVIGDAAFVHDTLFLPDSGTARADFPGGDARVLWNSIQEILALPDETR
FT                   IFTGHDYQPDGRAPRWESTVAEQKKSNPHLAGVSEKEFVALRTKRDKTLPMPKLILHAL
FT                   QVNICGGRLPEPEANGKRYLKFPLDALQGAAWE"
FT   gene            579232..579684
FT                   /locus_tag="SMa1058"
FT   CDS_pept        579232..579684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1058"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65231"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB7"
FT                   /protein_id="AAK65231.2"
FT                   /translation="MATTANRVSAQTSDEINRLLRWQMEERLAYYETHADEIDTRLAEL
FT                   DREWDIERTLEANASTLAFTGTMLAATGDRRWLALPAIVTGFLFQHAIQGWCPPLPILR
FT                   RLGFRTAEEINQERYALKALRGDFEAQSDNKLDAVLRAVGIRRGGA"
FT   gene            complement(579986..581353)
FT                   /locus_tag="SMa1060"
FT   CDS_pept        complement(579986..581353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1060"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65232"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB6"
FT                   /protein_id="AAK65232.2"
FT                   /translation="MKRRILLQGTTALMVLSALPAFAQDDIRAVAREAYIYTYPMVKNY
FT                   LTMYQYALDPGGSQYKGPLNTLVSIARVYTPEDTAIITPNSDTPYSFIVFDLRAEPVVV
FT                   TMPPIEKDRYYSLQLIDLYTNNVDYPGTRVDGNGGGDFLITGPGWKGDVPKGIKRVIEM
FT                   PTTLALGIIRTQLFSPDDLEKVKQIQARYKAAVLSAYAGAPAPAAPPSIDWLLISDELM
FT                   VTDYWSIAAFLLQFAPPYSGDEAQRENLAKLGIRDRGVWPGTDLSPETVALMKEVAVAT
FT                   EKEIRDEAARLTDSSKIFGTPEFMKGRFMVRAAAAQGGIYGNSVQEALYVIYAFDAQKA
FT                   PLDGKTGRYKLTFTPRTLPPVDAFWSLTMYDRQNQFLVDNPIDRYLINSPMLAGLKKSN
FT                   KGEIVLYLQRESPGAELESNWLPAPSEIFYVVMRLYLPRAEALDGRWAPPPIEALS"
FT   gene            complement(581350..582180)
FT                   /locus_tag="SMa1062"
FT   CDS_pept        complement(581350..582180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65233"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB5"
FT                   /protein_id="AAK65233.2"
FT                   /translation="MTSTVIRLNRDTLYSSAVFDLDAGPVTINVPDTGTRFVSLLVIDE
FT                   DHYAHGVYYGPGSYTLTRKVIGTRYVVAAFRFFADPNNTEDMKRVHALQDAVTVNQPAA
FT                   GTFEIPEWDGKSRDKTRRALLDLGSLLPNTARMFGPRDEIDPVRHLIGAALGWGGNPDK
FT                   EALYLNVTPEKNDGKSIYRLTVKDVPVKEFWSVTVYNKEGFFTPNELDAYSLNDVTAQK
FT                   SQDGSITIQFGGCDGKIANCLPTPEGWNYMVRLYRPKSQILDGRWTFPVAEEVK"
FT   gene            complement(582116..582367)
FT                   /locus_tag="SMa1063"
FT   CDS_pept        complement(582116..582367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1063"
FT                   /product="hypothetical protein"
FT                   /note="Overlaps with SMa1062; Very short region of
FT                   similarity to proteins of unknown function DUF1214"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65234"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB4"
FT                   /protein_id="AAK65234.2"
FT                   /translation="MFLARLSFSTIAAALMSALPAAADPILVNSDNFVRAESDLYFSGI
FT                   VANGGFGKFDHTREMAPLDKHGYSPEPGHSLFFCRVRS"
FT   gene            complement(582419..583207)
FT                   /locus_tag="SMa1065"
FT   CDS_pept        complement(582419..583207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65235"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB3"
FT                   /protein_id="AAK65235.1"
FT                   /translation="MKAHVLATALLISVAADSRAIAADLQQPFIVPEANPASTEGWAFA
FT                   ATPYFWGAGILGDVEQFGLPAVHLESDFGDVLKDLDFGFMAVGEARYDRFSIFGDIIYT
FT                   KVSSGAATPLGVVAERVEATSETFAGLAAAGYAVFQDGRSNIDIVAGARVWLASTEISF
FT                   SGGVLGRISGRDSATWVDAMAAFRGRYFLTDHFYLNAWGLVGAGQADLDWDLAAGVGYE
FT                   FNDRISTVAGYRALGIDYNNDRFVFDVVQQGPILGLLVRF"
FT   gene            583446..584192
FT                   /locus_tag="SMa1067"
FT   CDS_pept        583446..584192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1067"
FT                   /product="Transcriptional regulator, CAP/Crp family"
FT                   /note="Has CAP_ED, effector domain of the CAP family of
FT                   transcription factors; members include CAP (or cAMP
FT                   receptor protein (CRP)), which binds cAMP, FNR (fumarate
FT                   and nitrate reduction), which uses an iron-sulfur cluster
FT                   to sense oxygen) and CooA, a heme containing CO sensor; In
FT                   all cases binding of the effector leads to conformational
FT                   changes and the ability to activate transcription; Cyclic
FT                   nucleotide-binding domain similar to CAP are also present
FT                   in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK)
FT                   and vertebrate cyclic nucleotide-gated ion- channels,
FT                   family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65236"
FT                   /db_xref="GOA:Q92ZB2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB2"
FT                   /protein_id="AAK65236.1"
FT                   /translation="MPWLRFCDRDRSVHMLVAMLDLTREKAEQVMRRGPWLASMTEPFR
FT                   TELLRHAHLQKFAPDQVVYRHGDAVGGMYGLVAGSLTINSAPPDAASRLIHLGMPGAWT
FT                   GEGPFLTGQPRRVELRALGGAWMMHVPLDALEQMMARDPGVSRAIAMNTVFTVDVLLRI
FT                   IHDLQKRAVGRRIASVLQRASWVGDMPIPLSQTDLGIMANASRQQVNTAMQRFARAGWV
FT                   SYTYRSVTVSNSQALRRFSEGDGSEW"
FT   repeat_region   584809..587403
FT                   /rpt_family="ISRm23"
FT                   /note="SMa4010"
FT   gene            584979..586571
FT                   /locus_tag="SMa1070"
FT   CDS_pept        584979..586571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1070"
FT                   /product="TRm23a transposase"
FT                   /note="Recombinase/integrase domain; identical to part of
FT                   SMA0779 and SMA0787, specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65237"
FT                   /db_xref="GOA:Q92ZB1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB1"
FT                   /protein_id="AAK65237.1"
FT                   /translation="MPAERLEMRRVREILRYRFEQGLGHKSIAVRVGAAPSTVRETLRR
FT                   AAIAELSWPLGDDVSDAVLEAALYKAAGTKTGHRRSPEPDWAQVHRELKRKHMTLQILW
FT                   DEYISRYPDGYRYSRFCDLYRGWAMKLPVTMRQDHAAGDKLFVDYAGDTVTVVVDRLSG
FT                   KTRQAHLFVAVLGASSLSYAQARWSETLPDWIECHILALEYFGGAPALLVPDNAKVAII
FT                   KACHFDPQVNRTYCGMAAHYGSAVLPTRPRRPRDKAKVEAAVRIVERWLLGRLRHRIFY
FT                   SLAEVNAAIGQLLHDLNDKRVLRRVGATRRQLFEELDRPALRPLPVERYIFAEWRIRRA
FT                   GLDYHVEIERHYYSVPYRFAREQVEARITANTIEIFHKGERIAAHRRSSGNGKHTRSPI
FT                   ICPLRIAALPTGRLNGFNAKPLRWGRMLRCCASAFLPTGLIPSRAFELASASSASTRAS
FT                   AATGSMPLAGVRWRLAHEPMARCDPSSTITLTGRLPQMERRRMNRSITPTSADLAITTK
FT                   ENERCLPIQHWIN"
FT   gene            586541..587278
FT                   /locus_tag="SMa1073"
FT   CDS_pept        586541..587278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1073"
FT                   /product="TRm23b IS ATP-binding protein"
FT                   /note="Similar to pfam01695, IstB, IstB-like ATP binding
FT                   protein; This protein contains an ATP/GTP binding P-loop
FT                   motif; It is found associated with IS21 family insertion
FT                   sequences; The function of this protein is unknown, but it
FT                   may perform a transposase function, function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1073"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65238"
FT                   /db_xref="GOA:Q92ZB0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZB0"
FT                   /protein_id="AAK65238.1"
FT                   /translation="MLAHPTLDKLNAMGLAGMAKAFSELVANGESEHLSHAEWLGLLLE
FT                   REWSSRYDRKLAARLRFAKLRHQATPEDVDYRAERGLDRALFMKLLGGDWINAHDNLAI
FT                   CGPSGVGKSWLACALGHKACRDDRSVLYQRVPRLFAQLALARGDGRYARLQRTLGHVQL
FT                   LILDDWGLEPLNEQARHDLLEILEDRYGRKSTIITSQLPVSAWHGVIGDPTYADAILDR
FT                   LVHNAHRIELSGDSLRRNLPRKA"
FT   gene            complement(587855..588439)
FT                   /locus_tag="SMa1076"
FT   CDS_pept        complement(587855..588439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1076"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has incomplete helix-turn-helix domain and partial
FT                   AraC-like binding domain; Similar to Streptomyces Q56185
FT                   which is annotated as an epoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65239"
FT                   /db_xref="GOA:Q92ZA9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA9"
FT                   /protein_id="AAK65239.2"
FT                   /translation="MLSDTLSTELQRYAIGPRIKALRLRKKLGLVQLAGHTGLSPAMLS
FT                   KIERGQMFPTLPTLLRIAMVFGVGLDHFFNADKEEPLIAIVRKEQRLKLPSPPGEKHPA
FT                   FLFESLDYPASDRRMEAFYAEFPVDSPPSEPHQHGSAEFIYVLSGRLIVNVNGKECALD
FT                   TGDAVYFDSSVPHSYRREGGEISTAIVVTSS"
FT   gene            588601..589083
FT                   /gene="nex18"
FT                   /locus_tag="SMa1077"
FT   CDS_pept        588601..589083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nex18"
FT                   /locus_tag="SMa1077"
FT                   /product="Nex18 Symbiotically induced conserved protein"
FT                   /note="Similar to pfam02469, Fasciclin domain; This
FT                   extracellular domain is found repeated four times in
FT                   grasshopper fasciclin I as well as in proteins from
FT                   mammals, sea urchins, plants, yeast and bacteria; Expressed
FT                   in root nodules (Oke & Long 1999), conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65240"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA8"
FT                   /protein_id="AAK65240.1"
FT                   /translation="MKLNSLLFAAAITLGSVSAFAADKDVVDTAMEAGQFKTLGAALEA
FT                   AGLIATLKETGPFTVFAPTDEAFAKLPAGTVENLLKPENKQKLTEILTYHVVAGRVMAA
FT                   DVAGIDEAKSVNGKMIDIEVEGSTVKVNDAAVTAADIAASNGVIHVIDKVIMPPEG"
FT   gene            589113..589337
FT                   /locus_tag="SMa1078"
FT   CDS_pept        589113..589337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1078"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Is nearly identical to orf109 of pSmeSM11a"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65241"
FT                   /db_xref="GOA:Q7D4K5"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D4K5"
FT                   /protein_id="AAK65241.1"
FT                   /translation="MRFINIFTLVLVIVGGLNWGLVGLFSFDLVAAIFGVGSGLARIVY
FT                   ILVGLSAAWQIIPLFSVMGSGEFAAGQNR"
FT   gene            589343..589885
FT                   /gene="tspO"
FT                   /locus_tag="SMa1079"
FT   CDS_pept        589343..589885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tspO"
FT                   /locus_tag="SMa1079"
FT                   /product="TspO Tryptophan rich sensory protein"
FT                   /note="Required for expression of S; meliloti ndiAB under
FT                   stress conditions; In Rhodobacter sphaeroides, TspO is
FT                   localized to the outer membrane and is a modulator of a
FT                   repressor/antirepressor regulatory system (Zeng & Kaplan
FT                   2001), conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1079"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65242"
FT                   /db_xref="GOA:Q92ZA7"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA7"
FT                   /protein_id="AAK65242.1"
FT                   /translation="MEGLACLAGGSLHLLQMDMHSLLVLVAFEVASFAAAATGVIFRPG
FT                   DWYKQLNKPRWRPPDWLFAPVWAVLYASIGLSGWLVWQEAGIAGAALPLGTYAVQLLLN
FT                   AAWTPIFFGLHRPGLAAVEIMVLWAAILATTVMFHPVNAAAALLLVPYLAWVSFAAALN
FT                   LSIWRRNRSKTLSQSTR"
FT   gene            589907..590068
FT                   /locus_tag="SMa1081"
FT   CDS_pept        589907..590068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1081"
FT                   /product="hypothetical protein"
FT                   /note="Has similarity to region in amino-terminus of a
FT                   group of conserved hypothetical proteins and to orf111 of
FT                   pSmeSM11a"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1081"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65243"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA6"
FT                   /protein_id="AAK65243.1"
FT                   /translation="MIACRGYRYALVAPTCRDFHPDFRPDLTPAEMLALGVFGGKYMTD
FT                   CRDEFPNS"
FT   gene            complement(590350..590970)
FT                   /locus_tag="SMa1082"
FT   CDS_pept        complement(590350..590970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65244"
FT                   /db_xref="GOA:Q92ZA5"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA5"
FT                   /protein_id="AAK65244.2"
FT                   /translation="MTTLRTILLASTILTLATPGFAEDAHHPEATGGQAGAEAVEPAAP
FT                   AANAVAAMPGGMMCRDMMGGMMQMMPGGMMAAGQGQTGQAGMSAMALMIAPEHIEGRIA
FT                   FLKAELRITPEQEPLWNAFAEVLRANSRGMDGMMQTQAAMGQLAGAAATPLQRVDVGER
FT                   ALASRLESVRKLKAALVPLYQLFEGAQKQAADKLLMPPMMGIM"
FT   gene            complement(591065..593440)
FT                   /locus_tag="SMa1084"
FT   CDS_pept        complement(591065..593440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1084"
FT                   /product="phosphoketolase"
FT                   /note="Belongs to the thiamine pyrophosphate (TPP) family,
FT                   Phosphoketolase (PK) subfamily, TPP-binding module; PK
FT                   catalyzes the conversion of D-xylulose 5-phosphate and
FT                   phosphate to acetyl phosphate, D-glyceraldehyde-3-
FT                   phosphate and H2O; This enzyme requires divalent magnesium
FT                   ions and TPP for activity, Highly similar to S; meliloti
FT                   SMc04146, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65245"
FT                   /db_xref="GOA:Q92ZA4"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ZA4"
FT                   /protein_id="AAK65245.1"
FT                   /translation="MTNTLSPELLERMDAYWRAANYLSVGQIYLRDNPLLKQKLTLADV
FT                   KPRLLGHWGTTPGLNFLYVHLNRLIQTHDLNMIYVTGPGHGGPGLVANTYLEGTYSELY
FT                   PEVSQDEAGIKRLFTQFSYPGGIPSHVAAEVPGSINEGGELGYCLMHAYGAVFDNPDLI
FT                   AACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLNGYKIANPTVLARISHDELE
FT                   ALFMGYGYEPLFVEGADPRQMHQLMASALDKAHGKIAEIQRQARSRGFSDRPAWPMIIF
FT                   RSPKGWTGPREVDGKKTEGTWRSHQVPLAKLAEVPAHLGILEEWLKSYRPWELFDESGS
FT                   LRPELRELAPKGERRMGANPHANGGLLLKDLNLPDFRQYAVEIGIPGTVTAESTRTAGL
FT                   YLRDVMKLNAQERNFRIFGPDETESNRLSPVFQETDRVFTGDILASDMQLSPDGRVMEV
FT                   LSEQLCQGWLEGYLLTGRHGFFSCYEAFIHIVDSMFNQHAKWLKVCREVPWRKPIASLT
FT                   YLLTSHVWRQDHNGFSHQDPGFIDHVANKKADIIRVYLPPDANTLLSVVDHCARSRDYI
FT                   NVIVAGKQPQLQWLDMGAAVAHCRAGLGVWEWASNDEGDPDAVVACAGDVPTMEALAAV
FT                   MIVREAFPSLRLRVVNVVDLMALQAPSQHPHGIADDAFDRMFTTDKPVIFAYHGYPGLI
FT                   HRLTYRRTNHANFHVHGYQEEGTTTTPFDMAVLNKLDRFHLAKAVVERVPSLASPREGF
FT                   AHFVESKLAEHDAYIRENGEDLPEIRNWRWLASAVDAQ"
FT   gene            complement(593620..594294)
FT                   /locus_tag="SMa1086"
FT   CDS_pept        complement(593620..594294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1086"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Contains two CBS domains; This domain is found in a
FT                   wide range of proteins, often in tandem arrangements and
FT                   together with a variety of other functional domains; It has
FT                   been proposed that the CBS domain may play a regulatory
FT                   role, although its exact function is unknown, Similar to S;
FT                   meliloti SMa0639"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1086"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65246"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA3"
FT                   /protein_id="AAK65246.1"
FT                   /translation="MLARDIMKKRVLSISPDHSVSHAARAMLENQISGLPVCDDRGRLV
FT                   GMLSEGDLLRRAELGLVSRRDIAGVRAKPEAFIKGHSWRVGDVMTQPVVTVDEDMPVGR
FT                   VAELMAAKGIKRIPVMRAEEMVGIISRSDILRAVTASLPDVIANGDEAVRRAVLARLCS
FT                   DLGLEKGAIDVTIENGTVSLSGQVESEALREAARVAAETISGAGGVRNRLRIVANGGAS
FT                   DG"
FT   gene            594396..596597
FT                   /locus_tag="SMa1087"
FT   CDS_pept        594396..596597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1087"
FT                   /product="Cation transport ATPase"
FT                   /note="Has an E1-E2 ATPase domain and a domain found in
FT                   haloacid dehalogenase-like hydrolases; Best similarity to
FT                   the ZntA-type cation transport ATPases, conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1087"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65247"
FT                   /db_xref="GOA:Q92ZA2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA2"
FT                   /protein_id="AAK65247.1"
FT                   /translation="MGIDPNHHHSRTNVHAPPAQTEGSQVPTMEGVIYTCPMHPQVRQI
FT                   GPGNCPICGMALEPAVVTAETGPSAEFVDMRRRFWIGLVLTSPVLALEMGGHLTNLHML
FT                   LGAQTSNWLQLVFATPVVLWAGAPFFERAWRSLVTRRLNMFTLIAMGTGVAWVYSVIAT
FT                   VAPGLFPATFRSADGAVPIYFEAAAVITVLVLLGQVLELRAREQTGGAIRALLDLAPKT
FT                   ARRIRNDGTDEDLPLEAVAVGDRLRVRPGEKVPVDGTLVEGRSSVDESMITGESMPVTK
FT                   EVGAKLIGGTMNKTGGFVMEAGKVGRDTMLSRIVQMVAEAQRSRAPIQRLADEVSGWFV
FT                   PAVILIAIVAFVAWMWLGPEPRFTHGLVAAVAVLIIACPCALGLATPMSIMVGVGQGAR
FT                   AGVLIKNAEALERFEKVNTLVVDKTGTLTEGKSKVTSVVAVNGIAEDELLQVAATLERA
FT                   SEHPLAAAIVEAANVSRLGLGTAENFDSPVGKGVTGTVKGHRLVIGSHQIMSEEKVDVA
FT                   PLTEKAEALRGEGATVIFVAIDGRVGGLFAISDPIKPTTPAAVAALMKDGVRVVMLTGD
FT                   NRTTANAVARKLGITEVEAEILPEHKSEIVRRLRNEGRVVAMAGDGVNDAPALAAADVG
FT                   IAMGTGTDVAIESAGVTLLKGDLQGIVRARQLSHATMRNIRQNLFFAFIYNAAGVPVAA
FT                   GVLYPAFGLLLSPIIAAAAMALSSVSVIGNSLRLRSTRI"
FT   gene            596594..596797
FT                   /locus_tag="SMa1089"
FT   CDS_pept        596594..596797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1089"
FT                   /product="hypothetical protein"
FT                   /note="Similar to central region of a group of conserved
FT                   hypothetical proteins; Almost identical to orf117 of
FT                   pSmeSM11a"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1089"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65248"
FT                   /db_xref="GOA:Q92ZA1"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA1"
FT                   /protein_id="AAK65248.1"
FT                   /translation="MILDRKWTLFAASLAVIFAFFILREHWQHALGLAPYLLLLACPLM
FT                   HLFHGHGGHGHADHRIKADDIT"
FT   gene            596794..597297
FT                   /locus_tag="SMa1091"
FT   CDS_pept        596794..597297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1091"
FT                   /product="hypothetical protein"
FT                   /note="Almost identical to orf118 of pSmeSM11a, conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1091"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65249"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ZA0"
FT                   /protein_id="AAK65249.1"
FT                   /translation="MTYAHTAQAIADVATSADVLFDYLDDQASLGSHMQKPSMMMLGGR
FT                   MSYEFDEARGRTVGSVIRMRGNILGLVLSVEEVITERQPPRRKVWETRGRSNLLAIGAY
FT                   RMGFEIIALGRAASRLRVFIDYDYPAAIAAKFLGPMFGPIYARWCVNRMANDATNAFEG
FT                   SARS"
FT   gene            complement(597521..598030)
FT                   /locus_tag="SMa1092"
FT   CDS_pept        complement(597521..598030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1092"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65250"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z99"
FT                   /protein_id="AAK65250.1"
FT                   /translation="MPRIVKVPLKTATSMSVSSIPGSSQVISHLLSVSAKSTAGATSNS
FT                   DSRGTRRMRAEAKGRCHRFGAKSSNSRSISDLRLSKGSQDSARRSTSFSSDLMGSLLAG
FT                   SAMAGVLLQSGGSRLVSPRVAYGRGRKPVWPTSTGASPPAATPDEIIKTPCCGSLIDWR
FT                   QRPGDL"
FT   gene            598284..598616
FT                   /locus_tag="SMa1093"
FT   CDS_pept        598284..598616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1093"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity to amino-terminus of a group of
FT                   conserved hypothetical proteins that includes UspA,
FT                   universal stress protein; Together with adjacent ORF,
FT                   SMa1095, may comprise a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65251"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z98"
FT                   /protein_id="AAK65251.2"
FT                   /translation="MPFKTILAVLGVPQTDRDLQTAADISIQVRAHLSVLIVGFAPQPT
FT                   SRYATLASAWFEQRDWNLKALGETAKTVRDKLSKREISFEVDSIYAEVAGATYDIGDAA
FT                   SILISS"
FT   gene            598804..599112
FT                   /locus_tag="SMa1095"
FT   CDS_pept        598804..599112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1095"
FT                   /product="hypothetical protein"
FT                   /note="Has weak similarity to a the carboxy-terminus of
FT                   universal stress protein, UspA; Together with adjacent ORF,
FT                   SMa1093, may comprise a pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1095"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65252"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z97"
FT                   /protein_id="AAK65252.1"
FT                   /translation="MSNAKSVHVAMVDPTATPRQSGDEPGADVAAYLARHGIDVTVDAL
FT                   PSAGRSVAQVLQRHANDVAADMIVMGAYGHSPLRELVFGGVTRSMLDEARLPVLMAR"
FT   gene            599155..599616
FT                   /locus_tag="SMa1096"
FT   CDS_pept        599155..599616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1096"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to carboxy-terminus of an integral membrane
FT                   protein family that includes the antibiotic resistance
FT                   protein MarC; Overlaps SMa1097"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65253"
FT                   /db_xref="GOA:Q92Z96"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z96"
FT                   /protein_id="AAK65253.1"
FT                   /translation="MLTIKSLAIAGLLGRTMLENFEISLPVLAMTGGIILFLVALRTVL
FT                   HQSSSLPDQTTEPGQPSDLRLALTPLAFPTILAVIVFATLAGGRQAEGRTVAAIVLLIL
FT                   AMDWAAMIFAESILRWIGTSLQVLAVVLGVTQAALGLQIILHSLSTVSW"
FT   gene            complement(599529..600044)
FT                   /locus_tag="SMa1097"
FT   CDS_pept        complement(599529..600044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1097"
FT                   /product="hypothetical protein"
FT                   /note="Central region has similarity to short sequence from
FT                   membrane proteins; Overlaps with SMa1096"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65254"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z95"
FT                   /protein_id="AAK65254.1"
FT                   /translation="MPLELHCTHWSEERQSVSQNRAGGPECAANAHRLRRAALLERFGS
FT                   GLITGAADADPSGIATYSQAGAQLRAKMRRRGMGVAQNMRRLFPSRAGQLEPRPFRDLS
FT                   ATVKRAVLSRLVDKFSPANASRCSTSEKHDEASGHRLHFYQETVLKLCRIIWRPSAAWV
FT                   TPSTTAKT"
FT   gene            600212..600526
FT                   /locus_tag="SMa1099"
FT   CDS_pept        600212..600526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1099"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has very weak, perhaps spurious, similarity to
FT                   pfam00034.12, Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1099"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65255"
FT                   /db_xref="GOA:Q926I1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q926I1"
FT                   /protein_id="AAK65255.1"
FT                   /translation="MRVTIASIIAGSNAIVPAVHAQDIHEGRQLALEVCAVCHAVLTGQ
FT                   AQSPFAEAPSFEAVAAIPGMTAAALNVWLTAQDHPTMPNIVLSQTDVQDVSAYILSLRK
FT                   "
FT   gene            600897..601418
FT                   /locus_tag="SMa1100"
FT   CDS_pept        600897..601418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1100"
FT                   /product="hypothetical protein"
FT                   /note="Has weak similarity to a partial UspA domain of
FT                   universal stress protein and related nucleotide-binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65256"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z94"
FT                   /protein_id="AAK65256.2"
FT                   /translation="MIKHILVATDGSAKAREAVTMAAKLCRNLGGRLTILHVIMHGLRA
FT                   EEASRLAEEEYLVRRVSAVTLPDLQPIPETMVNLFRASHGDLGEMVSILGDRIVEEAAE
FT                   SARSIGADRVDARVEPGDYAETILGVADEVDADLIVVGSRGLGGLRGLLVGSVSQKVVQ
FT                   HSDCSVLVVR"
FT   gene            601408..601827
FT                   /locus_tag="SMa1101"
FT   CDS_pept        601408..601827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65257"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z93"
FT                   /protein_id="AAK65257.1"
FT                   /translation="MCAKHPPGLDEGAATAIVVSPSGSRAGRQALESMTARAVFTDPLP
FT                   VLNAYHWISFCRKDVTFRPVGSNSFWKTASLAFESLPLFMRINDTAAEEGSNGLIRGES
FT                   WRPFDSSSVRRLRSAPVASSLCFRVHASDAAGRVD"
FT   gene            601805..603559
FT                   /gene="cyaP"
FT                   /locus_tag="SMa1103"
FT   CDS_pept        601805..603559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaP"
FT                   /locus_tag="SMa1103"
FT                   /product="Adenylate/guanylate cyclase"
FT                   /function="Adenylate cyclase, family 3 (some proteins
FT                   contain HAMP domain)"
FT                   /EC_number="4.6.1.1"
FT                   /note="Contains an adenylate and guanylate cyclase
FT                   catalytic domain (pfam00211), family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65258"
FT                   /db_xref="GOA:Q92Z92"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z92"
FT                   /protein_id="AAK65258.1"
FT                   /translation="MPLAVSTDDGKFCRRILPILRVWKTRPSASLVSMEMRGQPKLLVT
FT                   GAYRLGFEVSPFGELRDCACSSISTIRQRSRASSLGPLFGQIYACRRVNRIANSLLCRG
FT                   IMSSNPHRLRPRGEPCSEGEVCSMGIFLFNAHRYDTGRSALGRTSVEKLFRESESEAEY
FT                   TTGWVRITLGLAMFVSGILVTSGTTELTDMNNSNQLRASALFTVFAFLALGIISLLLVV
FT                   SGRFRPWMAFVLVTCDAAILGVSLYFALHGIGLGGNWVAAIPTIWAVPLLLAVGALRYR
FT                   PLVQIWATTATMIALVGVASVLGFPLSPSGPETRATLGTLGESVGRLFSLPSYLMRAVM
FT                   LTLIGLTTALAMARSRRLLIREVSETARRANLARFLPAEIAPLVGEDDLATWRQGRRQQ
FT                   GTILFIDIRGFTAYAEKLDPARLSIFISSFRRRVVRATEAFGGVVDKFIGDGALVVFGI
FT                   PEPQSDDCTRAIACAHRLLALIDRWNIKRGFDPPVRVGIGIHSGELYYGLVGDDHRLEF
FT                   TVLGDTVNVAAKIEQATKRFDTALLASETVVLRARQQPSWQAVCREPLGGRGEHVAVFI
FT                   YTGTKPAG"
FT   gene            complement(604238..604468)
FT                   /locus_tag="SMa1104"
FT   CDS_pept        complement(604238..604468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1104"
FT                   /product="hypothetical protein fragment"
FT                   /note="Has similarity to class I cytochrome C proteins, but
FT                   has a truncated amino-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65259"
FT                   /db_xref="GOA:Q92Z91"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z91"
FT                   /protein_id="AAK65259.1"
FT                   /translation="MVFARTTCAQCHSIDRVGASPLSVAPPFRDLHKLYPVETLEEALA
FT                   EGIRTGHPSMPEFRLEPDQIGDLIAFLKSLE"
FT   gene            604938..605630
FT                   /locus_tag="SMa1111"
FT   CDS_pept        604938..605630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1111"
FT                   /product="hypothetical protein"
FT                   /note="short stretch of similarity to the AcrA family of
FT                   membrane fusion proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1111"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65260"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z90"
FT                   /protein_id="AAK65260.1"
FT                   /translation="MREHELHQAQSRLLSRQEIRSLRGDCECRSEGVVEAGTPLLHIGD
FT                   PADLEIFLNFLSEDAVRTKPGQRKLQRSRSSNRALRADPGVGARNRGQRVDVILHFADP
FT                   TESWRSLGHGYRGRCRGSMRLPPPRQPTDTSLELPAERLWPQSVQRRKGPGVATERIAV
FT                   DGQPRPTEANQGLECTAPFANHPVADVIKLRTFRLAHPKNAALRDFHLWPAGTCGDFLN
FT                   RFAIDRST"
FT   gene            complement(606021..606329)
FT                   /locus_tag="SMa1113"
FT   CDS_pept        complement(606021..606329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1113"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has very weak, perhaps spurious, similarity to
FT                   pfam00034.12, Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1113"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65261"
FT                   /db_xref="GOA:Q92Z89"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z89"
FT                   /protein_id="AAK65261.1"
FT                   /translation="MGLIVRAIIFLVIVGAISSVPAVQAQDIQHGRQLALEVGAACHAV
FT                   LAGQAQSPIGEAPSFEWIAATPVMTAVALNVWFTAQDHPTIVLSQTEAQDVAAHITV"
FT   gene            606562..607890
FT                   /locus_tag="SMa1115"
FT   CDS_pept        606562..607890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1115"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="The natural resistance-associated macrophage protein
FT                   (NRAMP) family consists of Nramp1, Nramp2, and yeast
FT                   proteins Smf1 and Smf2; The NRAMP family is a novel family
FT                   of functional related proteins defined by a conserved
FT                   hydrophobic core of ten transmembrane domains; This family
FT                   of membrane proteins are divalent cation transporters;
FT                   Nramp1 is an integral membrane protein expressed
FT                   exclusively in cells of the immune system and is recruited
FT                   to the membrane of a phagosome upon phagocytosis; By
FT                   controlling divalent cation concentrations Nramp1 may
FT                   regulate the interphagosomal replication of bacteria;
FT                   Mutations in Nramp1 may genetically predispose an
FT                   individual to susceptibility to diseases including leprosy
FT                   and tuberculosis conversely this might however provide
FT                   protection form rheumatoid arthritis; Nramp2 is a multiple
FT                   divalent cation transporter for Fe2+, Mn2+ and Zn2+ amongst
FT                   others it is expressed at high levels in the intestine; and
FT                   is major transferrin-independent iron uptake system in
FT                   mammals; The yeast proteins Smf1 and Smf2 may also
FT                   transport divalent cations, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65262"
FT                   /db_xref="GOA:Q92Z88"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z88"
FT                   /protein_id="AAK65262.2"
FT                   /translation="MRRKSWHVDNDDRVQSGLLAKPVVYRLRRAALLDKLGPGLITGAA
FT                   DDDPSGIATYSQAGAQFGANMLWMMFFLYPLMCTMQMISARIGRVSGHGLAANMRRIFP
FT                   SWVVTSLVALLFIANTINIGADLAAMGAAAELVLGWGRHLFTLVFAVASLTVQVLVPYH
FT                   RYVLYLKWLTLVLFAYVGVVFTIEIDWSETALRMVTPQLALTRETAIMVVAVFGTTISP
FT                   YLLFWQASEEVEDDEADPTTDPLIDHPEQALVQLSRIRWDTYIGMAFANLVAFFIILTT
FT                   ALTLHAAGVTEIETSADAAEALRPIAGDLAFALFSLGIIGTGLLAVPILAGSAAYAVCE
FT                   SRGWPIGLEHKPREAVGFYTVIGLATLIGLAVDYSDLDPIRALFWSAVLNGVVSVPLMA
FT                   AMMIVVSRKDEMGQFVASFRLRVMGWFATACMAAAAITMFILS"
FT   gene            608683..609210
FT                   /gene="hspC2"
FT                   /locus_tag="SMa1118"
FT   CDS_pept        608683..609210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspC2"
FT                   /locus_tag="SMa1118"
FT                   /product="HspC2 heat shock protein"
FT                   /note="Belongs to alpha-crystallin-type heat shock proteins
FT                   (Hsps), family of small stress induced proteins ranging
FT                   from 12 -43 kDa, whose common feature is the alpha-
FT                   crystallin domain; They are generally active as large
FT                   oligomers consisting of multiple subunits; They are
FT                   believed to be ATP-independent chaperones that prevent
FT                   aggregation, and are important in refolding in combination
FT                   with other Hsps, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65263"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z87"
FT                   /protein_id="AAK65263.1"
FT                   /translation="MAEPATKLPIKSEEKGVERRAESWLPFESLRSEIDRLFDDFAPSL
FT                   WHRPLASALMRRVPRLSELDVAPAVDLAETEKTYEITCELPGMEEKDIEVAISNGTLTI
FT                   RGEKQEEKKENKKEYVLSERRYGSFQRTFRMPDGVDTEKIAAKFSKSVLSITLPKTPEA
FT                   QQNERKIQIKVT"
FT   gene            609267..610181
FT                   /locus_tag="SMa1120"
FT   CDS_pept        609267..610181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1120"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1120"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65264"
FT                   /db_xref="GOA:Q92Z86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z86"
FT                   /protein_id="AAK65264.1"
FT                   /translation="MAIDATEVHTELVLPPHEVSAGARASQRQISNDLLKFTFLRSRGA
FT                   SRNRPELRESTARRRSEELVVENEVSAIALEARELTKIYRMGAVEVHALRGVEVDFREG
FT                   ELIVLLGPSGSGKSTLLNILGGLDTPTSGTVMFRGQPLAMDSERALNLYRRNHVGFVFQ
FT                   FYNLIPSLTARENVSLVTEIARNPMSPVEALSIVGLGDRLDHFPAQLSGGEQQRVAIAR
FT                   AIAKRPDLLLCDEPTGALDSKTGILVLEAILKINRELGTTTALITHNAVIAEIANRVLY
FT                   FADGRIVETRQNGVQRAPGELAW"
FT   gene            610188..612551
FT                   /locus_tag="SMa1122"
FT   CDS_pept        610188..612551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1122"
FT                   /product="Putative permease"
FT                   /note="Contains two FtsX domains; This is a family of
FT                   predicted permeases and hypothetical transmembrane
FT                   proteins; One member has been shown to transport lipids
FT                   targeted to the outer membrane across the inner membrane;
FT                   Two members have been shown to require ATP, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65265"
FT                   /db_xref="GOA:Q92Z85"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z85"
FT                   /protein_id="AAK65265.1"
FT                   /translation="MSSLDRKLIRELWRLKAQVLAIALVIASGTALLIMALTTIEALEE
FT                   TTAAYYERTRFADVFAQAKRAPEHLGRDIANIPGVRLAETRIVEGAIVDMPGFAEPVVA
FT                   QLLSLPERGPELLNALVIRSGRLTDPTRPNEVVVSEPFAEAHDLKPGDSFSAVLRGRKR
FT                   TLQVVGTALSPEFVYAIAPGGLMPDDERFGVLWMGHDALAAAFDLKASFNSVTLDLLPG
FT                   ADEKDVIRRLDGLLAPFGGIGAYGRADQTSNWFLESEIAQQKNMSRIMPTIFLAVAAFL
FT                   NNMVIARLIETERHEIGLLKAFGYSNLAIGWHYAKMVLTIGTIGVLIGSLLGAWLGHWN
FT                   TELYTKFYRFPFLLYRPGPAGFVIAGAISLGAALAGSLAAVRRAVRLPPAEAMFPPSPP
FT                   IYRRSWASRTALAGALDEPSRMILRRIIRWPVRAFLASLGLAMSIAVLIMALQWVDAID
FT                   ALAETAFERGQHQDATIAFNDLLPIHTAGDYEHLPGVLAAEPYRHASARISHGHLVERQ
FT                   GIIGVPSGAILSPVFDVERGRIEVPPGGLVLSRKLAELLHVSAGDTVGVELLEGRQARL
FT                   SLPVAQVFETYLGTPAYMDMEALNRISGDGRVVSGLHILVDAPSRTRLLAKLKEIPNVA
FT                   AVLFRQAAIDTFYKTMGETIFIFVGFFVAFSMTLSVGVTYNSIRIALSERARELATLRV
FT                   LGFSRWEISYILLGEVGILTWIAIPFGATVGYGLAWYMTSAFETELYRVPLVLRDATYG
FT                   KAALIALAATLVCAALVRRRLDRLDLIAVLKTRE"
FT   gene            612555..613754
FT                   /locus_tag="SMa1124"
FT   CDS_pept        612555..613754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1124"
FT                   /product="Membrane protein"
FT                   /note="Has weak similarity to AcrA, Membrane-fusion
FT                   protein, conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65266"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z84"
FT                   /protein_id="AAK65266.1"
FT                   /translation="MGVVKRRLAIWGSLLALLAAGIAYALRPQPIQVDLAVAEIGLLRV
FT                   TLDEEGETRVRDVYTLHAPLRGQLQRITAEVGDVVKAGETQLAQIEPAPPAFLDVRTEA
FT                   ELQAAVEAARAAHNLAAAELNKAKADLTFAEGERARARQLIERRTISQRTLEDAERSYH
FT                   VAQANLATAEAALKVREHELHQARSRLLSRQEIRSLREDCECMPVTAPVSGVVLQVMRR
FT                   SEGVVEAGTPLLDIGDPTDLEIVVNFLSEDAVRIRPGQRAIITDWGGEDLNAVVRRIEP
FT                   FGQTQVSALGIEEQRVDVILDFADPTESWRSLGHGYRVDVQVILFEGEVLKLPLGALFR
FT                   QGEEWAVFVAAEGRARLRPVAVSQRNSLAVEIREGLVPGERVILYPSDRIKDGAAIVER
FT                   "
FT   gene            complement(613774..614892)
FT                   /locus_tag="SMa1126"
FT   CDS_pept        complement(613774..614892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1126"
FT                   /product="Protease"
FT                   /note="Similar to SpoIVFB, Zn-dependent proteases, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1126"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65267"
FT                   /db_xref="GOA:Q92Z83"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z83"
FT                   /protein_id="AAK65267.1"
FT                   /translation="MGWSLKLGTIAGTEIRIHMTFVLLLVWIWFTHYQIGGAPAAWEGV
FT                   AFILSVFVCVVLHEFGHIAAARRFGIKTPDITLLPIGGVARLERNPSEPREELLIAVAG
FT                   PLVNVVIAALLIAVIGGVAGLEQLVRPQDPQIDFFVRLAGVNIFLVLFNMIPAFPMDGG
FT                   RVLRAILAWRWSLERATRVAATIGQGTAFVMGVAGLFYSPLLILIAIFVYLAAESEAQS
FT                   SELQAISVTVGDVMLTEFGVLQSDARLSEAAELLLATSQNEFPVVDGEGQFAGLLTRDG
FT                   IIGAMKEGGPNALVGTVMRTDIPWVYEETALGDSLRVMQTTGAPAAAVVSRSQHPIGIM
FT                   NYETIGEMLMLRAAVHDFRFGMLRRSRAGSHG"
FT   gene            complement(614946..616274)
FT                   /gene="degP4"
FT                   /locus_tag="SMa1128"
FT   CDS_pept        complement(614946..616274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP4"
FT                   /locus_tag="SMa1128"
FT                   /product="DegP4 protease like protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="contains PDZ domain of trypsin-like serine
FT                   proteases, such as DegP/HtrA, which are oligomeric proteins
FT                   involved in heat-shock response, chaperone function, and
FT                   apoptosis; May be responsible for substrate recognition
FT                   and/or binding, as most PDZ domains bind C- terminal
FT                   polypeptides, though binding to internal (non-C- terminal)
FT                   polypeptides and even to lipids has been demonstrated; In
FT                   this subfamily of protease-associated PDZ domains a
FT                   C-terminal beta-strand forms the peptide-binding groove
FT                   base, a circular permutation with respect to PDZ domains
FT                   found in Eumetazoan signaling proteins, specificity
FT                   unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65268"
FT                   /db_xref="GOA:Q92Z82"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z82"
FT                   /protein_id="AAK65268.2"
FT                   /translation="MLKISKLLVLAALFDPFGGAAEATGIDAGVSAMLERVQPAVVSIR
FT                   TISSGIFRNEMLEDPNVRKVLGLPDEVFIVQTGATATGSGVIIDREGGYIITSRHLVAD
FT                   ADDVSVTLADGRVFHADRVGEDAPTDLAVIKIDASELAALQWGNSSELKVGEFVAAIGS
FT                   PFGLAQTATFGIVSGLGRAGLGADEYQDYIQTDAAINPGNSGGALVNVSGKLIGIARGI
FT                   AAPDQTSTGIGFAIPSNIVAKIVRELISHGEYKRGWLGLSVTAAVDAQDGSATQPTGLI
FT                   VNELACNSPAERQGVRLGDVITGLDDRAFSTEQAFRNAISLLPANARITLDVRRGETSQ
FT                   KLGMTLSDSVDRPDVSDQGSVIVKFPSESGSPACVPAGAVLVDVAPGSAAYSIGLRTGD
FT                   YLTAINGKPPVSADQIGSVLESVEGSASLDILRAGTAYRIDVQ"
FT   gene            complement(616469..618064)
FT                   /locus_tag="SMa1131"
FT   CDS_pept        complement(616469..618064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1131"
FT                   /product="Metallo-beta-lactamase superfamily protein"
FT                   /note="similar to YSH1, Predicted exonuclease of the beta-
FT                   lactamase fold involved in RNA processing, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1131"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65269"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z81"
FT                   /protein_id="AAK65269.1"
FT                   /translation="MMIEPTIRFDGAAGTVTGSCQLVEFGATKILVDCGLFQGSKTEKE
FT                   LNYRDFPFDPKTIDAVILTHAHIDHSGLLPKLARLGYDGPIFATPATTDLCSVMLPDSA
FT                   HIQESEVDQLNRRNLRRGRQTVTPIYTPRDAAVAITLFRQVRLGSWETVGEGIRFRFWN
FT                   AGHLLGSASVEMEIGTGPSPLRLLFSGDIGPRHKLLQFDAKAPSGWDYVICESTYGNIE
FT                   REEADDAARRHILRSEVLTAAHPNGALLIPSFAVERTQELLTDLVHLMETGAVPKCPII
FT                   IDSPLATRASEIFRRHARELENGDALVRGIESKNVRFTETAEQSKAVDLIRGFHIVIAA
FT                   SGMCEAGRIRHRLKNWLWRDEATVLLVGYQANGTLGRLLEEGATVVRIQGDDIRVRARI
FT                   RKLDIYSGHADGSELADWVRARQPISAGVFLVHGEDEALEGIRERLSTFLPQDHLIRPR
FT                   LDSAFRLGSHGAVQISEAVAPPRIDPVRVGRTDWHNDIQKLVLDLQDELAKAADDKARG
FT                   VVIRRLRRALQEEA"
FT   gene            618493..618882
FT                   /locus_tag="SMa1132"
FT   CDS_pept        618493..618882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1132"
FT                   /product="hypothetical protein"
FT                   /note="Carboxyl-terminus is nearly identical to orf130 of
FT                   pSmeSM11a"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1132"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65270"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z80"
FT                   /protein_id="AAK65270.1"
FT                   /translation="MTRQQRAVVWAKPAKEVARRLHPHFVREEEFALPPLSLLGALATG
FT                   KLAPGMTDVLALTDRLEAELSGMLGEHKEIVAALGDLVAAVKAENMPKYTVFAQKLVLH
FT                   ARTEEEVLYPAAILVGHYVKRVLGR"
FT   gene            618930..619556
FT                   /locus_tag="SMa1134"
FT   CDS_pept        618930..619556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1134"
FT                   /product="hypothetical protein"
FT                   /note="is nearly identical to orf131 of pSmeSM11a"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65271"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z79"
FT                   /protein_id="AAK65271.1"
FT                   /translation="MAKKLRTAVVLLGIALLPMSAHAHCDAADGPVATAAVRALDTGQV
FT                   NLILSFAPAGAEPELRAVFDQALNVRKRGPDAKALADRYFMEIAVRLHRAGEGAPYTGL
FT                   KPAGTDFGPAIPAAEEALETGKPDAVTALMTEQVGHGIAQKYRETTALRSASNEPTTQA
FT                   EVAKARDRVSAELAFIGYVEGIYLAAKGGMHVEAASTQEHHHGTE"
FT   gene            619852..620313
FT                   /locus_tag="SMa1136"
FT   CDS_pept        619852..620313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1136"
FT                   /product="hypothetical protein"
FT                   /note="is nearly identical to orf132 of pSmeSM11a"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1136"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65272"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z78"
FT                   /protein_id="AAK65272.1"
FT                   /translation="MESKMSVVYTVGPIKRHQVDKAYRLIEAAGCHFDLQAWREFCAGK
FT                   VAGERPASEIERIVTAENPLGYIAGICIMHPVQNAKYGRMLDVPVFIVTSAGDTRGAAN
FT                   ALLEYFMAVAGENSCGFIRVAALDPADWRRSITTSPREDRGILIPVQYP"
FT   gene            complement(620365..620856)
FT                   /locus_tag="SMa1138"
FT   CDS_pept        complement(620365..620856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1138"
FT                   /product="Response regulator, truncated"
FT                   /note="Probably non-functional; Lacking half of the
FT                   receiver domain; Note that orf133 of S; meliloti pSmeSM11a
FT                   represents the intact homolog, hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1138"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65273"
FT                   /db_xref="GOA:Q92Z77"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z77"
FT                   /protein_id="AAK65273.1"
FT                   /translation="MLTGRSDVVDRVVGLEVGADDYIAKPFHLREVLARVRGVLRRRQP
FT                   RRSPEVGDQQAEVYSFEGLRLDVGSRQLLSDDEREVPLTTGEFDMLCVLVKHAGRVLQR
FT                   EFLMDLTRGRNLEAFDRSIDAQIARLRRKIERDHTRPALIKSVRGVGYVFTARTTRQRS
FT                   "
FT   gene            complement(620850..621116)
FT                   /locus_tag="SMa1139"
FT   CDS_pept        complement(620850..621116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1139"
FT                   /product="Response regulator, truncated"
FT                   /note="Probably non-functional; Consists of half of a
FT                   receiver domain; Note that orf133 of S; meliloti pSmeSM11a
FT                   represents the intact homolog, hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1139"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65274"
FT                   /db_xref="GOA:Q92Z76"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z76"
FT                   /protein_id="AAK65274.1"
FT                   /translation="MGLLMANAPTLPEHILVVDDDSRIRQMLSRYFEEEGYRVSLAGDG
FT                   QEMRERLDKQPVDVILLDLMLPGEDGLHLRATYARARMYRSSC"
FT   gene            621245..622009
FT                   /locus_tag="SMa1141"
FT   CDS_pept        621245..622009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1141"
FT                   /product="Transcriptional regulator, CAP/Crp family"
FT                   /note="Best similarity to FixK proteins, family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1141"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65275"
FT                   /db_xref="GOA:Q92Z75"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z75"
FT                   /protein_id="AAK65275.1"
FT                   /translation="MNAQVVSMQDARTRATCSQAFPVADLSSLFARQPVERFAPAQAVF
FT                   WQGDEATHIFEVTVGMLRALRLLGDGRRIIVGFLRPGDLLGVSLKERYLYTVEAVSSVE
FT                   LRRFPRRRFEDEVARHSNLQQQLFSRLRDEMTAAQDQAVLLSRRSAEEKLANFFLLMGQ
FT                   NQNCKQTSIVDLPMTRLDIADYLGMTIETVSRTITKLANSGVIATPERRSVTVLKMETL
FT                   RSLADGDESDYWTPSPYRVRSMHPPVFEGGGA"
FT   gene            622009..623595
FT                   /locus_tag="SMa1142"
FT   CDS_pept        622009..623595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1142"
FT                   /product="FixL-related histidine kinase"
FT                   /note="Hybrid sensor his kinase; Contains a PAS domain,
FT                   receiver domain, HATPase-C domain & HisKA domain, family
FT                   membership"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65276"
FT                   /db_xref="GOA:Q92Z74"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z74"
FT                   /protein_id="AAK65276.1"
FT                   /translation="MEKRVEMVEETVSDIADLKSAQADVAAREAHLRSILDTVPEAMVV
FT                   IDSKGVISSFSAAAERLFGYTESEVVGLNVKVLMPSPHREAHDQYLNNYLRTGERRIIG
FT                   IGRVVTGLRKDGTTFPMELSVGEATSDGRRIFTGFIRDLTSRQRIENELRQAQKMEAVG
FT                   QLTGGLAHDFNNLLTVITGNLEMIEARLQDEKLMPLLQEAQAAADDGAKLTAQLLAFGR
FT                   RQPLNPKLVDVGELVTNFSKLLTRTLGETIELSTVVKGSANLALIDVSQLQNTVLNLGL
FT                   NARDAMPNGGRLTIEVSTTVLDRDYALMLPEVRMGHYVLVAVTDTGVGMTEEVKRHAFE
FT                   PFYTTKGFGAGTGLGLSMVYGFVKQSGGHIQLYSEPDRGASVRLFLPAAEGENQLAEIG
FT                   AAEEAAPQPMPRGHETILVVEDDARVRRVVVARLRDAGYSVIEAEAGTKALQLLAEHPE
FT                   VSLVFTDMIMPGGIDGGELAEHVRALRPDVKMLFTSGYAEPSAAGRAVGSWLQKPYTAR
FT                   ALALRLRELLD"
FT   gene            623735..626434
FT                   /locus_tag="SMa1146"
FT   CDS_pept        623735..626434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1146"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best similarity to Acyl CoA synthetase; Contains
FT                   domain, pfam00583, Acetyltransf_1, Acetyltransferase (GNAT)
FT                   family; This family contains proteins with N-
FT                   acetyltransferase functions"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1146"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65277"
FT                   /db_xref="GOA:Q92Z73"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z73"
FT                   /protein_id="AAK65277.1"
FT                   /translation="MSIRNLHHALDPTSLAIIGASDRDGSLGRVVIENVIRAGFEGEIW
FT                   PINPKHDQVAGHRCYRRVADVPGVPDLAVIVTPPQTVPALIHDLGIRGTRAAVIITAGI
FT                   SADQDLRQAMLDAAKPFLLRIIGPNTVGLIVPSAKLNASFAHLQAQPGGIALLSQSGAI
FT                   ATSLIDWAADNDVGFSKVVSLGDMADADAGDFLDLLAGDPETHAIVMYLEAISNPRKFL
FT                   SAARAAARVKPIVAIKAGRHAEAAKAAATHTGALSGADRVVDAALRRAGILRIEGLGEL
FT                   FDATETIARFPPLEHSRVAIVTNGGGAGVLAVDRLIDFGCALADLSPETVGTLDRNLPA
FT                   NWSRANPVDIIGDAPPHRYKTAVETIVRDVGVDILIVMNCPTGLASPVDAAHAIASLAQ
FT                   SGTISGKPVLTCWLGGRTAREGRTLLQQAGLANYDTPSDVALAASYLAKWSKAQQALVR
FT                   VPEGRDDEVHCNRDLGRSVLQRVAAEGRRMLNEPEAKAVLAAYGIPVPQTIIATSPKEA
FT                   EAIAGLLLAGAPKLVVKLISKSITHKSDVGGVVLDILSPVAAREAAEAIVARLKAHDPI
FT                   AVVDGFAVQPMIERKHAWELLLGVTRDPIFGPVVLFGSGGVSVEVVADTAVALPPLDAV
FT                   LAGDLIDETRVGKLLAGFRNEPAADRAAICKALTALSQLIVDFPCVLSMDINPLVASAE
FT                   GVIALDGRIEINPRAVTRPGPNRDLAIRPYPSEWQKQVTLAERRYHLRPIRPADAALYP
FT                   DFLAKTSPADIRFRFLSSRKRFQDQMLVRLTQIDYEREMAFVALDSETGELVGISRLYA
FT                   DPDHEVAEYGLLIRTDLQGHGLGWALLAYLREYASADGLKRIEGLILGDNAKMLKLCRE
FT                   FGFSISTHPGDATLRIATLALQSQASVS"
FT   gene            626512..627336
FT                   /locus_tag="SMa1147"
FT   CDS_pept        626512..627336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1147"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Contains a domain found in the universal stress
FT                   protein family; The universal stress protein Usp is a small
FT                   cytoplasmic bacterial protein whose expression is enhanced
FT                   when the cell is exposed to stress agents; Usp enhances the
FT                   rate of cell survival during prolonged exposure to such
FT                   conditions, and may provide a general 'stress endurance'
FT                   activity; The crystal structure of Haemophilus influenzae
FT                   Usp reveals an alpha/beta fold similar to that of the
FT                   Methanococcus jannaschii MJ0577 protein, which binds ATP,
FT                   athough Usp lacks ATP-binding activity, Similar to SMA1149,
FT                   SMA1158 and SMA1231 on S; meliloti pSyma"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65278"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z72"
FT                   /protein_id="AAK65278.1"
FT                   /translation="MTYKTVLLVLDANQYEADLAAAAELCAAANAHLSVFLVKVAAPSR
FT                   FGDYAALSVAWLDIRAAEFEQLDEAVEAARTTLKDLDLSFDVAGEYSEPAWADDLVGER
FT                   ARYADVTLVGTSMDPSFRARAIEGALFYSPCPVLLAPRRQSVTLLPKRILLAWNSSLES
FT                   KRAAREALDMMKNAEGVNVVLVDPAASRWNGHEPGADVATYLARHGIKVTVDRLPSAGR
FT                   RIDEVLNQHAIDTSAELIVIGAYGHTRLRQRIFGGVTKAMIEAPVVPVLMAR"
FT   gene            627474..628307
FT                   /locus_tag="SMa1149"
FT   CDS_pept        627474..628307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SMa1149"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Contains a region that is similar to a partial
FT                   domain found in the universal stress protein family; The
FT                   universal stress protein Usp is a small cytoplasmic
FT                   bacterial protein whose expression is enhanced when the
FT                   cell is exposed to stress agents; Usp enhances the rate of
FT                   cell survival during prolonged exposure to such conditions,
FT                   and may provide a general 'stress endurance' activity; The
FT                   crystal structure of Haemophilus influenzae Usp reveals an
FT                   alpha/beta fold similar to that of the Methanococcus
FT                   jannaschii MJ0577 protein, which binds ATP, athough Usp
FT                   lacks ATP-binding activity, Similar to SMA1149, SMA1158 and
FT                   SMA1231 on S; meliloti pSyma"
FT                   /db_xref="EnsemblGenomes-Gn:SMa1149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK65279"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q92Z71"
FT                   /protein_id="AAK65279.1"
FT